N Unused Total %Cov %Cov(50) %Cov(95) Accessions Names Used Annotation Contrib Conf Sequence Modifications Cleavages dMass Prec MW Prec m/z Theor MW Theor m/z Theor z Sc Spectrum Specific Time PrecursorSignal PrecursorElution 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0094251399859786 1691.94384765625 846.9792 1691.9345703125 846.974548339844 2 14 1.1.1.4425.5 1 56.9561 1282.048 56.7001 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTKLVTDLTKVHK missed K-L@8; missed K-V@15 0.00272410991601646 2056.15966796875 686.3938 2056.15673828125 686.392883300781 3 13 1.1.1.4321.5 1 54.3738 620.6621 54.367 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 -0.00441250018775463 2497.17944335938 625.3021 2497.18359375 625.303161621094 4 16 1.1.1.4219.7 1 51.8572 4427.334 51.9488 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 0.0117522999644279 2866.43286132813 956.4849 2866.42114257813 956.48095703125 3 32 1.1.1.4172.4 1 50.7237 2208.084 50.6065 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.0230036005377769 2994.49267578125 500.0894 2994.51611328125 500.093292236328 6 20 1.1.1.4103.3 1 49.0013 3636.225 48.9956 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0248659998178482 3990.09326171875 666.0228 3990.11767578125 666.02685546875 6 24 1.1.1.4335.4 1 54.7254 1221.432 54.7446 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ALKAWSVAR missed K-A@3 0.00102359999436885 1000.58288574219 501.2987 1000.58178710938 501.298187255859 2 15 1.1.1.3231.2 1 28.3712 1781.542 28.4762 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ATEEQLKTVMENFVAFVDK missed K-T@7 0.00724805006757379 2198.10009765625 733.7073 2198.09301757813 733.704895019531 3 30 1.1.1.4715.4 1 63.8864 421.129 63.9428 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.0202686991542578 4122.84814453125 825.5769 4122.8681640625 825.580932617188 5 16 1.1.1.4358.5 1 55.2958 1843.531 55.2165 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 0.00166810001246631 1194.58325195313 598.2989 1194.58154296875 598.298034667969 2 11 1.1.1.3075.6 1 24.8078 2483.25 24.9343 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 -0.00282519008032978 1926.78820800781 643.27 1926.791015625 643.270935058594 3 22 1.1.1.3392.12 1 32.0587 2060.188 32.0876 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 0.000310626986902207 1137.49084472656 569.7527 1137.49072265625 569.752624511719 2 15 1.1.1.3083.7 1 25.0003 12038.05 24.9833 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.0182125996798277 2999.37573242188 750.8512 2999.39404296875 750.855773925781 4 14 1.1.1.3975.12 1 45.8544 6770.404 46.0186 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESER Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.00328060006722808 1165.48229980469 583.7484 1165.48559570313 583.750061035156 2 13 1.1.1.2512.2 1 14.9741 464.0809 14.8753 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12 missed R-M@9 -0.0101095996797085 2887.28686523438 722.829 2887.29736328125 722.831604003906 4 17 1.1.1.4237.5 1 52.3031 1929.284 52.3462 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Lys->Allysine(K)@4; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0215237997472286 3749.71264648438 750.9498 3749.734375 750.954162597656 5 23 1.1.1.4539.3 1 59.6465 782.3729 59.7104 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Lys->Allysine(K)@4; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30 -0.0311367008835077 4391.041015625 732.8475 4391.07275390625 732.852722167969 6 19 1.1.1.4434.4 1 57.1778 1014.695 57.197 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0239656008780003 4736.287109375 790.3884 4736.310546875 790.392333984375 6 18 1.1.1.4327.4 1 54.5271 1253.911 54.5463 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAFLGSFLYEYSR 0.00557002006098628 1566.74108886719 784.3778 1566.73547363281 784.375 2 22 1.1.1.4491.3 1 58.597 2103.124 58.3374 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 -0.00177406996954232 2457.17163085938 820.0645 2457.17333984375 820.065063476563 3 16 1.1.1.4206.7 1 51.5424 2363.357 51.3579 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DDPHACYSTVFDKLK Carbamidomethyl(C)@6 missed K-L@13 -0.00346618006005883 1794.82116699219 599.281 1794.82470703125 599.282165527344 3 13 1.1.1.3868.7 1 43.218 232.0905 43.2256 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DDSPDLPK 0.000427416991442442 885.408447265625 443.7115 885.407958984375 443.711273193359 2 9 1.1.1.3104.3 1 25.4988 665.1797 25.3731 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DTHKSEIAHR missed K-S@4 -0.000112191002699547 1192.59484863281 597.3047 1192.59484863281 597.304748535156 2 16 1.1.1.2489.2 1 14.7786 403.4743 14.6811 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ECCDKPLLEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@3 -0.00355711998417974 1290.59106445313 431.2043 1290.59484863281 431.205535888672 3 12 1.1.1.3048.2 1 24.1705 937.7617 24.0798 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ECCHGDLLECADDRADLAK Carbamidomethyl(C)@2; Carbamidomethyl(C)@3; Carbamidomethyl(C)@10 missed R-A@14 -0.00418638018891215 2246.93139648438 749.9844 2246.935546875 749.985778808594 3 25 1.1.1.3606.7 1 37.0687 754.115 37.0737 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EKVLTSSAR missed K-V@2 -0.00184777996037155 989.548645019531 495.7816 989.550537109375 495.782562255859 2 12 1.1.1.2770.3 1 18.1786 7180.982 18.0779 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ETYGDMADCCEK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.00304424995556474 1477.51904296875 739.7668 1477.51599121094 739.765258789063 2 12 1.1.1.3139.15 1 26.3181 255.3669 26.3477 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EYEATLEECCAK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.000357971992343664 1501.60693359375 751.8107 1501.6064453125 751.810546875 2 20 1.1.1.3274.5 1 29.2779 482.8007 29.3361 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EYGFQNALIVR Glu->pyro-Glu@N-term cleaved G-E@N-term 0.0111026996746659 1290.68322753906 646.3489 1290.67211914063 646.343322753906 2 12 1.1.1.4295.5 1 53.7138 137.4013 53.6809 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 FVEVTKLVTDLTK cleaved E-F@N-term; missed K-L@6 0.00563827995210886 1491.86047363281 746.9375 1491.85485839844 746.934692382813 2 13 1.1.1.4407.2 1 56.5065 236.3144 56.5274 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 GKYLYEIAR cleaved W-G@N-term; missed K-Y@2 0.00391501002013683 1111.6064453125 556.8105 1111.6025390625 556.80859375 2 12 1.1.1.3435.14 1 33.0845 462.6326 33.0896 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIK -0.000667989021167159 1304.70825195313 653.3614 1304.70886230469 653.361694335938 2 17 1.1.1.3604.3 1 37.0152 3593.706 37.2402 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIKQNCDQFEK Carbamidomethyl(C)@14 missed K-Q@11 -0.00136366998776793 2354.13134765625 785.7177 2354.13256835938 785.718078613281 3 31 1.1.1.3767.4 1 40.8033 754.6769 40.8799 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@14 missed K-Q@11; missed K-L@19 -0.0179443992674351 3814.89208984375 763.9857 3814.91015625 763.989318847656 5 21 1.1.1.4350.6 1 55.0998 2132.606 55.1673 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPEYAVSVLLR 0.00319998990744352 1282.70642089844 642.3605 1282.70336914063 642.358947753906 2 9 1.1.1.3930.7 1 44.7339 866.8412 44.6765 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 -0.0142371002584696 4355.99755859375 872.2068 4356.01171875 872.209655761719 5 27 1.1.1.4423.7 1 56.9169 448.7348 56.8729 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 IETMREKVLTSSAR missed R-E@5; missed K-V@7 -0.00711185019463301 1619.859375 540.9604 1619.86645507813 540.962768554688 3 12 1.1.1.3139.9 1 26.3081 306.0111 26.3232 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KFWGKYLYEIAR missed K-F@1; missed K-Y@5 0.00110720994416624 1572.84643554688 525.2894 1572.84533691406 525.2890625 3 10 1.1.1.4007.5 1 46.6583 392.092 46.6487 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KQTALVELLK missed K-Q@1 0.000906119996216148 1141.70812988281 571.8613 1141.70703125 571.860778808594 2 17 1.1.1.3797.11 1 41.5136 17929.55 41.476 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.00333363004028797 1638.92700195313 547.3163 1638.93041992188 547.317443847656 3 21 1.1.1.3772.2 1 40.9225 26770.8 40.6651 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LAKEYEATLEECCAKDD Carbamidomethyl(C)@12; Carbamidomethyl(C)@13 cleaved D-P@C-term; missed K-E@3; missed K-D@15 -0.00182839995250106 2043.87463378906 682.2988 2043.87646484375 682.299438476563 3 24 1.1.1.3496.6 1 34.5435 470.1526 34.621 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LCVLHEKTPVSEK Carbamidomethyl(C)@2 missed K-T@7 -0.0066240900196135 1538.80603027344 513.9426 1538.81262207031 513.94482421875 3 18 1.1.1.3186.2 1 27.3681 2136.058 27.4053 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LCVLHEKTPVSEKVTK Carbamidomethyl(C)@2 missed K-T@7; missed K-V@13 -0.00459911022335291 1867.01916503906 623.347 1867.02368164063 623.348510742188 3 19 1.1.1.3193.18 1 27.5424 1009.885 27.5746 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LFTFHADICTLPDTEK Carbamidomethyl(C)@9 -0.0017581699648872 1906.91162109375 636.6445 1906.91345214844 636.645080566406 3 12 1.1.1.4128.8 1 49.618 906.4969 49.6833 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LGEYGFQNALIVR 0.00631396006792784 1478.79443359375 740.4045 1478.78820800781 740.4013671875 2 17 1.1.1.4185.4 1 51.0259 24405.1 50.7768 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -0.00733717996627092 1531.76647949219 511.5961 1531.77380371094 511.598541259766 3 15 1.1.1.3057.9 1 24.3836 5098.376 24.5916 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKPDPNTLCDEFKADEKK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17 0.00620026001706719 2147.06323242188 537.7731 2147.05688476563 537.771484375 4 18 1.1.1.3638.4 1 37.8119 0 -1 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.0154609996825457 2665.3056640625 534.0684 2665.32104492188 534.071472167969 5 16 1.1.1.4151.3 1 50.1841 501.3736 50.2025 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0303164999932051 3605.75610351563 601.9666 3605.78637695313 601.9716796875 6 19 1.1.1.4277.3 1 53.2651 1159.091 53.3322 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 -0.00289635988883674 1749.96362304688 584.3285 1749.96655273438 584.329467773438 3 24 1.1.1.3645.3 1 37.9784 2769.696 37.8645 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.0102732004597783 2520.41015625 631.1098 2520.42041015625 631.112365722656 4 15 1.1.1.4420.4 1 56.8289 859.8435 56.8236 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LVNELTEFAK 0.00162561994511634 1162.62512207031 582.3198 1162.62341308594 582.318969726563 2 10 1.1.1.3980.9 1 45.9784 2561.677 45.8167 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNR Carbamidomethyl(C)@3 0.0111036999151111 1723.83850097656 862.9265 1723.82727050781 862.920959472656 2 19 1.1.1.4491.4 1 58.6004 528.1288 58.7086 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14 -0.00370764010585845 2603.28735351563 651.8291 2603.291015625 651.830017089844 4 18 1.1.1.4657.3 1 62.429 449.1342 62.4719 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.00885664019733667 3244.62060546875 649.9314 3244.62939453125 649.933166503906 5 19 1.1.1.4579.2 1 60.5367 839.846 60.5814 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21; missed K-V@27 -0.00818927958607674 3572.83227539063 596.4793 3572.84057617188 596.480712890625 6 18 1.1.1.4491.2 1 58.5937 114.2514 58.6121 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 NECFLSHKDDSPDLPK Carbamidomethyl(C)@3 missed K-D@8 -0.00332444999366999 1900.85925292969 634.627 1900.86254882813 634.628112792969 3 16 1.1.1.3457.5 1 33.6022 823.9171 33.6619 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 NYQEAKDAFLGSFLYEYSR missed K-D@6 0.00323867006227374 2300.078125 767.7 2300.07495117188 767.698913574219 3 20 1.1.1.4351.5 1 55.1239 2087.27 55.1921 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QEPERNECFLSHKDDSPDLPK Carbamidomethyl(C)@8 missed R-N@5; missed K-D@13 -0.00664310995489359 2540.15356445313 847.7251 2540.16015625 847.727355957031 3 22 1.1.1.3408.10 1 32.4407 513.6024 32.4219 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEK Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 -0.00302616995759308 1050.40466308594 526.2096 1050.40771484375 526.211120605469 2 12 1.1.1.3115.4 1 25.7727 454.5115 25.7417 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 missed K-L@8 0.000842267007101327 2511.18603515625 838.0693 2511.18530273438 838.069030761719 3 19 1.1.1.4399.4 1 56.3125 1928.015 56.3317 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEKLGEYGFQNALIVRYTR Carbamidomethyl(C)@3 missed K-L@8; missed R-Y@21 -0.0158417001366615 2948.408203125 738.1093 2948.423828125 738.11328125 4 15 1.1.1.4266.3 1 53.006 499.6504 53.0169 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLK Gln->pyro-Glu@N-term 0.00465235020965338 996.590270996094 499.3024 996.585571289063 499.300048828125 2 12 1.1.1.4478.4 1 58.2684 2180.564 58.3374 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLKHKPK missed K-H@9 0.000866312009748071 1503.91442871094 502.3121 1503.91369628906 502.311828613281 3 13 1.1.1.3593.9 1 36.757 1552.824 36.8121 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPEYAVSVLLR missed R-H@1 0.000429942010669038 1438.80480957031 480.6089 1438.80444335938 480.608764648438 3 19 1.1.1.3675.9 1 38.6905 17862.4 38.5551 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANK missed R-H@1 -0.00171771994791925 2044.01904296875 512.012 2044.02062988281 512.012451171875 4 13 1.1.1.4153.6 1 50.2349 781.7759 50.3027 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0290881991386414 4512.08349609375 753.0212 4512.11279296875 753.026123046875 6 18 1.1.1.4335.5 1 54.7262 1102.051 54.8183 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.0061145001091063 1879.90771484375 627.6432 1879.91381835938 627.645202636719 3 20 1.1.1.3882.14 1 43.556 6252.056 43.6159 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@30 missed K-A@16; missed K-L@21 -0.0091264396905899 4359.07763671875 872.8228 4359.0869140625 872.824645996094 5 13 1.1.1.4347.7 1 55.0255 277.8722 55.0169 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 -0.0016410700045526 1071.50024414063 536.7574 1071.501953125 536.758239746094 2 15 1.1.1.2889.2 1 20.6024 2022.893 20.4547 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SHCIAEVEKDAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@3; Carbamidomethyl(C)@30 missed K-D@9; missed K-D@27 -0.0231435000896454 3510.6416015625 703.1356 3510.66479492188 703.140197753906 5 22 1.1.1.4144.9 1 50.014 1026.298 50.0785 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 -0.000696355011314154 1418.68591308594 710.3502 1418.68640136719 710.350463867188 2 13 1.1.1.3976.9 1 45.8774 686.4749 45.8669 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLHTLFGDELCKVASLR Carbamidomethyl(C)@11 missed K-V@12 -0.00132083997596055 1945.0078125 649.3432 1945.00915527344 649.343627929688 3 24 1.1.1.4273.4 1 53.1679 1426.914 53.1863 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.00882343016564846 1462.57287597656 488.5316 1462.58166503906 488.534515380859 3 17 1.1.1.2781.3 1 18.4447 10879.77 18.3624 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TPVSEKVTK missed K-V@6 -0.00027419300749898 987.559875488281 494.7872 987.56005859375 494.787292480469 2 14 1.1.1.2792.2 1 18.715 9009.147 18.5294 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TVMENFVAFVDK 0.00541226007044315 1398.69091796875 700.3527 1398.68530273438 700.349975585938 2 12 1.1.1.4350.5 1 55.0989 664.3603 55.1423 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 -0.0101814996451139 3323.45043945313 831.8699 3323.46069335938 831.872436523438 4 32 1.1.1.4182.4 1 50.9596 3402.221 51.0169 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VASLRETYGDMADCCEK Oxidation(M)@11; Carbamidomethyl(C)@14; Carbamidomethyl(C)@15 missed R-E@5 -0.0064062001183629 2019.82727050781 674.283 2019.83361816406 674.28515625 3 25 1.1.1.3168.3 1 26.9874 1046.178 27.0161 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VHKECCHGDLLECADDRADLAK Carbamidomethyl(C)@5; Carbamidomethyl(C)@6; Carbamidomethyl(C)@13 missed K-E@3; missed R-A@17 -0.0117130996659398 2611.14624023438 653.7938 2611.15771484375 653.796691894531 4 23 1.1.1.3286.5 1 29.5416 788.8072 29.5737 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VPQVSTPTLVEVSR 0.00130046997219324 1510.8369140625 756.4257 1510.83544921875 756.425048828125 2 11 1.1.1.3911.15 1 44.2699 2587.162 44.4534 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.000248747004661709 1442.63452148438 722.3245 1442.634765625 722.324645996094 2 9 1.1.1.3104.6 1 25.5038 20308.15 25.7417 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.95860815048218 99.0000009536743 PVSEKVTK cleaved T-P@N-term; missed K-V@5 -0.000207642995519564 886.512268066406 444.2634 886.512390136719 444.263458251953 2 10 1.1.1.2784.2 1 18.5109 483.5036 18.5294 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.92081785202026 99.0000009536743 KECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved L-K@N-term; missed K-E@1 -0.00559386983513832 1418.68420410156 473.902 1418.68981933594 473.903869628906 3 14 1.1.1.3068.2 1 24.6275 170.7607 24.6409 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.92081785202026 99.0000009536743 SHCIAEVEKD Carbamidomethyl(C)@3 cleaved D-A@C-term; missed K-D@9 0.00479784980416298 1186.53369140625 594.2741 1186.52880859375 594.271667480469 2 13 1.1.1.2938.5 1 21.6544 185.8036 21.6628 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.832682609558105 99.0000009536743 SLGKVGTR Formyl(K)@4 missed K-V@4 0.001423169975169 844.478088378906 423.2463 844.476684570313 423.24560546875 2 10 1.1.1.2996.3 1 22.9996 232.8482 23.0387 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.829738259315491 99.0000009536743 FWGKYLYEIAR Dioxidation(W)@2 missed K-Y@4 0.00305280997417867 1476.7431640625 493.255 1476.74011230469 493.253997802734 3 10 1.1.1.4046.9 1 47.627 500.6277 47.6174 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.756961941719055 99.0000009536743 HAGCEKSLHTLFGDELCK reduced HNE(H)@1; Carbamidomethyl(C)@4; MDA adduct +54(K)@6; Carbamidomethyl(C)@17 cleaved S-H@N-term; missed K-S@6 -0.002873620018363 2313.11059570313 772.0441 2313.11328125 772.045043945313 3 11 1.1.1.3958.18 1 45.4366 642.4504 45.3696 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.63264411687851 76.7300009727478 YLYEIARR missed R-R@7 0.00122755998745561 1082.58850097656 542.3015 1082.58728027344 542.300903320313 2 11 1.1.1.3303.3 1 29.9492 869.2294 30.0259 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.598599493503571 74.8199999332428 LSQKFPK missed K-F@4 0.00344700994901359 846.499877929688 424.2572 846.496337890625 424.255432128906 2 11 1.1.1.2934.5 1 21.5524 25982.69 21.4961 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.525783777236938 70.1499998569489 RPCFSALTPDETYVPKAFDEK Carbamidomethyl(C)@3 missed K-A@16 -0.00830102991312742 2470.17553710938 824.3991 2470.18383789063 824.401916503906 3 10 1.1.1.4026.13 1 47.1364 165.717 47.1231 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.4710833132267 66.2000000476837 LCVLHEK Carbamidomethyl(C)@2 -0.000145355996210128 897.474060058594 449.7443 897.474243164063 449.744384765625 2 10 1.1.1.3044.4 1 24.0747 1054.555 24.0074 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.454692870378494 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQ Carbamidomethyl(C)@14; acrolein addition +76(K)@24; acrolein addition +94(K)@25 cleaved Q-T@C-term; missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0103032002225518 3292.63745117188 659.5348 3292.64794921875 659.536865234375 5 13 1.1.1.4103.5 1 49.0046 1197.409 48.9714 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.279014259576797 47.3800003528595 LRCASIQK Carbamidomethyl(C)@3 missed R-C@2 0.00062624498968944 974.533874511719 488.2742 974.533142089844 488.273834228516 2 10 1.1.1.2805.6 1 19.0265 2342.19 19.0797 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.270835191011429 99.0000009536743 ESHAGCEKSLHTLFGDELCK Glu->pyro-Glu@N-term; reduced HNE(H)@3; Carbamidomethyl(C)@6; ONE addition +154(K)@8; Carbamidomethyl(C)@19 cleaved D-E@N-term; missed K-S@8 -0.0147067001089454 2611.25122070313 871.4244 2611.26611328125 871.429321289063 3 11 1.1.1.3959.17 1 45.4607 489.0107 45.3946 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.255707025527954 44.5199996232986 NECFLSHK Carbamidomethyl(C)@3 0.00228509004227817 1033.46752929688 517.741 1033.46508789063 517.739807128906 2 9 1.1.1.3039.5 1 23.95 183.2523 23.9584 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.24949161708355 99.0000009536743 LKAWSVAR acrolein addition +112(K)@2; Dioxidation(W)@4 cleaved A-L@N-term; missed K-A@2 0.00244934996590018 1073.58947753906 537.802 1073.5869140625 537.800720214844 2 12 1.1.1.3189.8 1 27.4455 779.1501 27.4531 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.237321436405182 42.0800000429153 YLYEIAR 0.00276582990773022 926.488891601563 464.2517 926.486145019531 464.250366210938 2 9 1.1.1.3632.4 1 37.6575 2669.184 37.6504 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.224753752350807 40.4000014066696 CCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@39 missed R-R@9; missed K-A@25; missed K-L@30 -0.0123915998265147 5478.55419921875 914.0997 5478.56689453125 914.101745605469 6 12 1.1.1.4328.10 1 54.5573 341.0927 54.521 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.164943903684616 31.6000014543533 DAIPENLPPLTADFAEDKDVCKNYQEAK Carbamidomethyl(C)@21 missed K-D@18; missed K-N@22 0.00484343990683556 3190.51782226563 798.6367 3190.51293945313 798.635498046875 4 10 1.1.1.4134.9 1 49.7669 290.0886 49.7573 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.146301791071892 28.6399990320206 LVVSTQTALA 0.00346631999127567 1001.57928466797 501.7969 1001.57568359375 501.795135498047 2 10 1.1.1.3830.4 1 42.3024 6977.492 42.0484 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.100179500877857 99.0000009536743 VGTRCCTKPESER Didehydro(T)@3; Carbamidomethyl(C)@5; Carbamidomethyl(C)@6 missed R-C@4 -0.00472339987754822 1576.7041015625 526.5753 1576.70861816406 526.576843261719 3 14 1.1.1.2677.4 1 16.3371 155.0053 16.3173 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0574958920478821 99.0000009536743 TKCCTESLVNR Acetyl@N-term; hexanoyl addition +98(K)@2; Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved V-T@N-term; missed K-C@2 0.00631952006369829 1506.72338867188 503.2484 1506.71704101563 503.246307373047 3 14 1.1.1.3075.5 1 24.8045 322.297 24.8372 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0555173270404339 99.0000009536743 AEFVEVTKLVTDL Amidated@C-term cleaved L-T@C-term; missed K-L@8 0.0111499996855855 1461.81909179688 731.9168 1461.80786132813 731.911193847656 2 14 1.1.1.4461.4 1 57.8415 152.8376 57.8582 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0282604098320007 23.7800002098084 IETMREK Oxidation(M)@4 missed R-E@5 -0.000566757982596755 921.45849609375 461.7365 921.458984375 461.736755371094 2 10 1.1.1.2388.2 1 13.8795 827.6295 13.9813 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0204516258090734 99.0000009536743 AEFVEVTKLVTDLTKVH Amidated@C-term cleaved H-K@C-term; missed K-L@8; missed K-V@15 0.00394651992246509 1927.08190917969 643.3679 1927.07788085938 643.366577148438 3 11 1.1.1.4398.2 1 56.286 267.5034 56.3317 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00966114550828934 99.0000009536743 AEFVEVTK Amidated@C-term -0.0388973988592625 920.457885742188 461.2362 920.496704101563 461.255645751953 2 12 1.1.1.3198.4 1 27.6609 212.9093 27.5746 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00436480529606342 42.0399993658066 VDEPQNLIKQNCDQFEKLGEYGFQNALIVR MDA adduct +54(K)@9; Carbamidomethyl(C)@12; acrolein addition +76(K)@17 cleaved L-V@N-term; missed K-Q@9; missed K-L@17 0.0468446016311646 3694.85620117188 739.9785 3694.80908203125 739.969055175781 5 10 1.1.1.4194.7 1 51.2421 1205.315 50.993 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00305075151845813 66.3999974727631 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVE acrolein addition +112(K)@19; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; acrolein addition +112(K)@26; Carbamidomethyl(C)@29 cleaved E-G@C-term; missed K-T@7; missed K-C@19; missed K-E@26 0.0491668991744518 4048.85791015625 810.7789 4048.80908203125 810.769104003906 5 11 1.1.1.4586.4 1 60.7118 378.5804 60.6814 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00261361571028829 45.5000013113022 KKQTALVELLK ONE addition +154(K)@1; acrolein addition +76(K)@2 cleaved I-K@N-term; missed K-K@1; missed K-Q@2 -0.00617991993203759 1499.92651367188 750.9705 1499.93273925781 750.9736328125 2 7 1.1.1.4096.6 1 48.8337 423.9118 48.8272 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000434511806815863 98.6299991607666 YGFQNALIVRYTRKVPQVSTPTLVEVSR Carbamidomethyl@N-term cleaved E-Y@N-term; missed R-Y@10; missed R-K@13; missed K-V@14 0.0675569996237755 3277.8623046875 1093.628 3277.79345703125 1093.60510253906 3 12 1.1.1.3746.7 1 40.3037 733.905 40.3326 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTK -0.000742572010494769 921.480102539063 461.7473 921.480773925781 461.747650146484 2 12 1.1.1.3273.3 1 29.2542 20938.26 29.0176 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 70.8100020885468 AEFVEVTK 0.00102736998815089 921.481872558594 461.7482 921.480773925781 461.747650146484 2 11 1.1.1.3265.6 1 29.0836 27631.66 28.9939 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 68.4099972248077 AEFVEVTK 0.00102736998815089 921.481872558594 461.7482 921.480773925781 461.747650146484 2 11 1.1.1.3257.4 1 28.8898 27631.66 28.9939 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 35.9499990940094 AEFVEVTK Oxidation(F)@3 0.00477756001055241 937.48046875 469.7475 937.475646972656 469.7451171875 2 9 1.1.1.3263.3 1 29.0262 883.4393 28.9939 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0122327003628016 1691.94689941406 846.9807 1691.9345703125 846.974548339844 2 26 1.1.1.4404.3 1 56.4362 17296.42 56.5274 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0122327003628016 1691.94689941406 846.9807 1691.9345703125 846.974548339844 2 26 1.1.1.4411.3 1 56.6055 17296.42 56.5274 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0095472102984786 1691.94409179688 846.9793 1691.9345703125 846.974548339844 2 22 1.1.1.4418.5 1 56.7804 1261.325 56.7988 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 26.4999985694885 AEFVEVTKLVTDLTK missed K-L@8 0.00600726995617151 1691.9404296875 846.9775 1691.9345703125 846.974548339844 2 7 1.1.1.4433.4 1 57.153 241.3428 57.0975 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 0.000544591981451958 2497.18408203125 833.402 2497.18359375 833.401794433594 3 28 1.1.1.4226.9 1 52.0378 5171.464 51.9488 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 55.0100028514862 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14; Dicarbamidomethyl(D)@18; reduced acrolein addition +96(K)@21 missed K-L@5 0.0168571993708611 2707.30102539063 677.8325 2707.28393554688 677.828247070313 4 10 1.1.1.4222.8 1 51.9329 282.0647 51.9488 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 0.0117522999644279 2866.43286132813 956.4849 2866.42114257813 956.48095703125 3 20 1.1.1.4165.19 1 50.5488 2208.084 50.6065 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14; Dehydrated(T)@19; reduced acrolein addition +58(K)@21; Deamidated(Q)@22 missed K-L@5; missed K-Q@21 0.00536529999226332 2907.44165039063 727.8677 2907.4365234375 727.866394042969 4 21 1.1.1.4183.4 1 50.9787 594.3051 50.9689 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.0117634003981948 2994.50463867188 749.6334 2994.51611328125 749.636291503906 4 30 1.1.1.4099.3 1 48.9124 4001.126 48.9956 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.0174361001700163 2994.49853515625 599.907 2994.51611328125 599.910522460938 5 19 1.1.1.4102.3 1 48.9772 5805.384 48.9714 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 0.00664102006703615 2994.52270507813 999.1815 2994.51611328125 999.179321289063 3 16 1.1.1.4105.16 1 49.0597 1199.966 48.9956 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.0117634003981948 2994.50463867188 749.6334 2994.51611328125 749.636291503906 4 20 1.1.1.4106.6 1 49.079 4001.126 48.9956 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14; Dehydrated(T)@19; Deamidated(Q)@22; reduced acrolein addition +58(K)@24 missed K-L@5; missed K-Q@21; missed K-K@24 -0.00656744977459311 3035.5244140625 608.1122 3035.53149414063 608.113586425781 5 16 1.1.1.4109.6 1 49.1487 1177.448 49.1899 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0180411990731955 3990.099609375 799.0272 3990.11767578125 799.030822753906 5 15 1.1.1.4335.6 1 54.7271 1392.203 54.7446 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 84.8299980163574 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 -0.0180411990731955 3990.099609375 799.0272 3990.11767578125 799.030822753906 5 13 1.1.1.4342.4 1 54.898 1392.203 54.7446 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR missed K-A@3 0.00102359999436885 1000.58288574219 501.2987 1000.58178710938 501.298187255859 2 13 1.1.1.3241.4 1 28.5435 1778.952 28.4762 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Oxidation(W)@5 missed K-A@3 -0.000222339993342757 1016.57647705078 509.2955 1016.57672119141 509.295623779297 2 10 1.1.1.2972.7 1 22.4455 611.8484 22.4796 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.00702062994241714 1032.56469726563 517.2896 1032.57165527344 517.293090820313 2 10 1.1.1.2989.2 1 22.8334 181.0113 22.8952 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Trp->Kynurenin(W)@5 missed K-A@3 0.00031476400909014 1004.57708740234 503.2958 1004.57672119141 503.295623779297 2 9 1.1.1.3107.7 1 25.5786 253.1564 25.5658 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -6.29370988463052E-05 1032.57153320313 517.293 1032.57165527344 517.293090820313 2 12 1.1.1.3165.3 1 26.9106 12742.15 27.1159 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.000307067006360739 1032.5712890625 517.2929 1032.57165527344 517.293090820313 2 15 1.1.1.3173.3 1 27.0771 13765.91 27.1395 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.000307067006360739 1032.5712890625 517.2929 1032.57165527344 517.293090820313 2 15 1.1.1.3181.4 1 27.2514 13765.91 27.1395 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Trp->Kynurenin(W)@5 missed K-A@3 -0.000661754980683327 1004.57604980469 503.2953 1004.57672119141 503.295623779297 2 14 1.1.1.3187.4 1 27.3936 3378.69 27.4531 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.6800007820129 ALKAWSVAR Oxidation(W)@5 missed K-A@3 -0.000832665013149381 1016.57586669922 509.2952 1016.57672119141 509.295623779297 2 6 1.1.1.3132.7 1 26.1335 255.9703 26.1502 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 22.4600002169609 ALKAWSVAR Trp->Hydroxykynurenin(W)@5 missed K-A@3 -0.00111386994831264 1020.57049560547 511.2925 1020.57165527344 511.293090820313 2 8 1.1.1.3129.5 1 26.063 1342.441 26.1254 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 17.849999666214 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.00702062994241714 1032.56469726563 517.2896 1032.57165527344 517.293090820313 2 6 1.1.1.2996.4 1 23.003 181.0113 22.8952 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK Oxidation(M)@10 missed K-T@7 0.00280990009196103 2214.09057617188 739.0375 2214.087890625 739.036560058594 3 19 1.1.1.4321.8 1 54.3763 1505.203 54.4436 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK Oxidation(M)@10 missed K-T@7 0.00189439998939633 2214.08959960938 739.0372 2214.087890625 739.036560058594 3 24 1.1.1.4334.3 1 54.6998 1416.652 54.7446 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK missed K-T@7 0.00724805006757379 2198.10009765625 733.7073 2198.09301757813 733.704895019531 3 28 1.1.1.4722.3 1 64.058 421.129 63.9428 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.0202686991542578 4122.84814453125 825.5769 4122.8681640625 825.580932617188 5 20 1.1.1.4351.9 1 55.1273 1843.531 55.2165 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.000374731986084953 4122.86669921875 1031.724 4122.8681640625 1031.72436523438 4 15 1.1.1.4352.18 1 55.1598 1507.739 55.2165 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.0187427997589111 4122.849609375 825.5772 4122.8681640625 825.580932617188 5 29 1.1.1.4367.5 1 55.5162 1288.612 55.5589 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.00281607010401785 4122.87060546875 1031.725 4122.8681640625 1031.72436523438 4 15 1.1.1.4374.10 1 55.6968 613.2181 55.6809 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.000613817013800144 4106.87451171875 1027.726 4106.87353515625 1027.7255859375 4 12 1.1.1.4624.13 1 61.6438 301.322 61.6263 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.0199992656708 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Methyl(E)@11; Deamidated(N)@12; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.0461076982319355 4121.8271484375 825.3727 4121.873046875 825.381896972656 5 13 1.1.1.4374.4 1 55.6868 626.7941 55.7052 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 95.3199982643127 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Deamidated(N)@12; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 -0.0103561002761126 4123.84228515625 825.7757 4123.8525390625 825.777709960938 5 11 1.1.1.4376.2 1 55.7341 1144.423 55.5833 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 0.00166810001246631 1194.58325195313 598.2989 1194.58154296875 598.298034667969 2 16 1.1.1.3082.10 1 24.9782 2483.25 24.9343 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1; Carbamidomethyl(K)@6 missed K-F@6 -0.0040119499899447 1251.59887695313 418.2069 1251.60302734375 418.208282470703 3 9 1.1.1.3078.3 1 24.8705 287.3569 24.9098 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1; Deamidated(Q)@5; acrolein addition +56(K)@6 missed K-F@6 0.0136099001392722 1251.60546875 626.81 1251.591796875 626.803161621094 2 7 1.1.1.3081.11 1 24.9521 194.1906 24.9343 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.1699987649918 CASIQKFGER Carbamidomethyl(C)@1; Dehydrated(S)@3; Deamidated(Q)@5 missed K-F@6 0.00698971003293991 1177.56213378906 589.7883 1177.55493164063 589.784790039063 2 11 1.1.1.3584.4 1 36.5455 3021.276 36.5268 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.6800007820129 CASIQKFGER Carbamidomethyl(C)@1; Acetyl(K)@6 missed K-F@6 0.000500854977872223 1236.59265136719 619.3036 1236.59216308594 619.303344726563 2 8 1.1.1.3465.21 1 33.8019 279.3154 33.6858 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 -0.00282519008032978 1926.78820800781 643.27 1926.791015625 643.270935058594 3 20 1.1.1.3385.10 1 31.8899 2116.477 32.1115 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 0.000310626986902207 1137.49084472656 569.7527 1137.49072265625 569.752624511719 2 13 1.1.1.3076.5 1 24.8287 12038.05 24.9833 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.0182125996798277 2999.37573242188 750.8512 2999.39404296875 750.855773925781 4 20 1.1.1.3982.11 1 46.0304 6770.404 46.0186 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 0.00351554993540049 2982.37084960938 995.1309 2982.36743164063 995.129760742188 3 17 1.1.1.4124.14 1 49.525 14475.65 49.4856 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ser->Oxoalanine(S)@5; Carbamidomethyl(C)@12 missed R-R@9 -0.013951700180769 2997.36450195313 750.3484 2997.37841796875 750.351867675781 4 14 1.1.1.3921.10 1 44.516 586.7108 44.6023 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00625124014914036 2982.36083984375 746.5975 2982.36743164063 746.59912109375 4 14 1.1.1.4125.7 1 49.5497 1389.16 49.4856 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 93.970000743866 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 -0.00625124014914036 2982.36083984375 746.5975 2982.36743164063 746.59912109375 4 10 1.1.1.4126.8 1 49.5684 1389.16 49.4856 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 83.8599979877472 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 0.00351554993540049 2982.37084960938 995.1309 2982.36743164063 995.129760742188 3 11 1.1.1.4117.14 1 49.3554 14475.65 49.4856 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 64.5500004291534 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 -0.0182125996798277 2999.37573242188 750.8512 2999.39404296875 750.855773925781 4 12 1.1.1.3989.14 1 46.2102 6770.404 46.0186 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 39.7300004959106 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 0.0104734003543854 2982.37768554688 995.1332 2982.36743164063 995.129760742188 3 10 1.1.1.4106.10 1 49.0857 471.4752 49.0681 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESER Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.00267027993686497 1165.48291015625 583.7487 1165.48559570313 583.750061035156 2 12 1.1.1.2471.2 1 14.6338 401.7785 14.6925 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESER Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.00193788995966315 1165.48364257813 583.7491 1165.48559570313 583.750061035156 2 14 1.1.1.2490.2 1 14.8037 655.8959 14.7597 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESER Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 -0.00267027993686497 1165.48291015625 583.7487 1165.48559570313 583.750061035156 2 13 1.1.1.2529.2 1 15.1427 146.3114 15.1135 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Met->Hcy(M)@10; Carbamidomethyl(C)@12 missed R-M@9 -0.00179171003401279 2857.28491210938 715.3285 2857.28662109375 715.328979492188 4 12 1.1.1.4288.4 1 53.5343 272.3543 53.5289 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0213086996227503 3766.73974609375 754.3552 3766.76098632813 754.359436035156 5 19 1.1.1.4423.5 1 56.9102 1018.152 56.9963 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0213086996227503 3766.73974609375 754.3552 3766.76098632813 754.359436035156 5 16 1.1.1.4430.4 1 57.0783 1018.152 56.9963 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 39.4300013780594 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0288223996758461 3766.732421875 628.796 3766.76098632813 628.80078125 6 12 1.1.1.4425.2 1 56.9511 1084.741 56.9712 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 35.7499986886978 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30 -0.0088377995416522 4408.0908203125 882.6254 4408.099609375 882.627136230469 5 12 1.1.1.4362.3 1 55.3974 674.5182 55.3881 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00605829013511539 1566.74169921875 784.3781 1566.73547363281 784.375 2 21 1.1.1.4470.6 1 58.0782 3713.151 58.2377 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00605829013511539 1566.74169921875 784.3781 1566.73547363281 784.375 2 22 1.1.1.4477.3 1 58.2475 3713.151 58.2377 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.00605829013511539 1566.74169921875 784.3781 1566.73547363281 784.375 2 23 1.1.1.4484.6 1 58.424 3713.151 58.2377 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 55.0100028514862 DAFLGSFLYEYSR Oxidation(R)@13 0.0157904997467995 1582.74621582031 792.3804 1582.73034667969 792.372436523438 2 7 1.1.1.4478.5 1 58.2692 69.3587 58.2626 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 -0.00177406996954232 2457.17163085938 820.0645 2457.17333984375 820.065063476563 3 15 1.1.1.4192.7 1 51.1983 2363.357 51.3579 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 -0.00177406996954232 2457.17163085938 820.0645 2457.17333984375 820.065063476563 3 20 1.1.1.4199.6 1 51.369 2363.357 51.3579 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.2599990367889 DDSPDLPK 0.000427416991442442 885.408447265625 443.7115 885.407958984375 443.711273193359 2 10 1.1.1.3097.2 1 25.3316 665.1797 25.3731 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DTHKSEIAHR missed K-S@4 9.87445037026191E-06 1192.59484863281 597.3047 1192.59484863281 597.304748535156 2 17 1.1.1.2371.2 1 13.7619 245.4674 13.819 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DTHKSEIAHR missed K-S@4 0.000254004000453278 1192.59521484375 597.3049 1192.59484863281 597.304748535156 2 17 1.1.1.2391.2 1 13.9341 1801.808 13.9987 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DTHKSEIAHR missed K-S@4 9.87445037026191E-06 1192.59484863281 597.3047 1192.59484863281 597.304748535156 2 17 1.1.1.2407.2 1 14.1029 1965.578 14.0475 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DTHKSEIAHR missed K-S@4 0.000376068986952305 1192.59521484375 597.3049 1192.59484863281 597.304748535156 2 17 1.1.1.2426.3 1 14.2721 981.0558 14.1745 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DTHKSEIAHR missed K-S@4 9.87445037026191E-06 1192.59484863281 597.3047 1192.59484863281 597.304748535156 2 17 1.1.1.2448.2 1 14.4404 499.0922 14.3671 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DTHKSEIAHR missed K-S@4 0.000986394006758928 1192.59582519531 597.3052 1192.59484863281 597.304748535156 2 17 1.1.1.2470.2 1 14.6087 362.6812 14.6563 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DTHKSEIAHR missed K-S@4 0.000986394006758928 1192.59582519531 597.3052 1192.59484863281 597.304748535156 2 17 1.1.1.2515.2 1 15.0098 135.728 14.9541 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DTHKSEIAHR Cation:Na(E)@6 missed K-S@4 -0.0023042899556458 1214.57470703125 608.2946 1214.57678222656 608.295715332031 2 12 1.1.1.2395.2 1 13.9762 156.7624 13.9987 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DTHKSEIAHR acrolein addition +56(K)@4; Ser->LacticAcid(S)@5 missed K-S@4 0.00555330980569124 1233.61560058594 412.2125 1233.61022949219 412.210662841797 3 13 1.1.1.2606.2 1 15.7257 268.6464 15.7376 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EKVLTSSAR missed K-V@2 -0.00184777996037155 989.548645019531 495.7816 989.550537109375 495.782562255859 2 12 1.1.1.2761.3 1 18.0068 7191.916 18.0779 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EKVLTSSAR Carbamidomethyl(K)@2 missed K-V@2 -0.0160949993878603 1046.55590820313 524.2852 1046.57202148438 524.293273925781 2 9 1.1.1.2770.6 1 18.1861 0 -1 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EKVLTSSAR Glu->pyro-Glu@N-term; Hydroxytrimethyl(K)@2 missed K-V@2 0.00577360996976495 1030.59545898438 516.305 1030.58972167969 516.302124023438 2 13 1.1.1.2807.7 1 19.0747 619.6418 19.0556 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EKVLTSSAR Carbamyl@N-term missed K-V@2 0.00823551043868065 1032.56469726563 517.2896 1032.55639648438 517.285461425781 2 10 1.1.1.2989.2 1 22.8334 181.0113 22.8952 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EKVLTSSAR Formyl(K)@2 missed K-V@2 0.00234930007718503 1017.5478515625 509.7812 1017.54547119141 509.779998779297 2 12 1.1.1.3023.2 1 23.556 306.4866 23.5694 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EKVLTSSAR Glu->pyro-Glu@N-term missed K-V@2 0.00110357999801636 971.541076660156 486.7778 971.539978027344 486.777282714844 2 11 1.1.1.3001.2 1 23.1206 282.524 23.1396 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ETYGDMADCCEK Oxidation(M)@6; Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.00451974989846349 1493.51550292969 747.765 1493.51086425781 747.7626953125 2 18 1.1.1.2900.2 1 20.7703 579.5995 20.8225 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 28.1399995088577 GCEKSLHTLFGDELCK Delta:H(4)C(2)@N-term; Carbamidomethyl(C)@2; acrolein addition +94(K)@4; Carbamidomethyl(C)@15 cleaved A-G@N-term; missed K-S@4 0.019759900867939 2014.96948242188 1008.492 2014.94921875 1008.48187255859 2 10 1.1.1.3959.19 1 45.464 260.2242 45.3696 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 27.3099988698959 HAGCEKSLHTLFGDELCK reduced HNE(H)@1; Carbamidomethyl(C)@4; MDA adduct +54(K)@6; Carbamidomethyl(C)@17 cleaved S-H@N-term; missed K-S@6 -0.002873620018363 2313.11059570313 772.0441 2313.11328125 772.045043945313 3 11 1.1.1.3951.13 1 45.2622 642.4504 45.3696 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.000552661018446088 1304.70947265625 653.362 1304.70886230469 653.361694335938 2 17 1.1.1.3612.2 1 37.2029 7041.064 37.3357 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.000650660018436611 1304.70935058594 435.9104 1304.70886230469 435.910217285156 3 14 1.1.1.3616.2 1 37.295 2330.672 37.3357 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.000552661018446088 1304.70947265625 653.362 1304.70886230469 653.361694335938 2 19 1.1.1.3619.3 1 37.3682 7041.064 37.3357 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.000650660018436611 1304.70935058594 435.9104 1304.70886230469 435.910217285156 3 13 1.1.1.3624.2 1 37.4854 2330.672 37.3357 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.000430596002843231 1304.70922851563 653.3619 1304.70886230469 653.361694335938 2 18 1.1.1.3628.5 1 37.5705 6628.464 37.3357 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.00367175997234881 1304.71240234375 435.9114 1304.70886230469 435.910217285156 3 12 1.1.1.3608.3 1 37.1062 1204.943 37.145 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK Deamidated(Q)@7 0.015887500718236 1305.70861816406 436.2435 1305.69287109375 436.238220214844 3 13 1.1.1.3620.4 1 37.3977 1249.356 37.3357 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 57.669997215271 HLVDEPQNLIK 0.000650660018436611 1304.70935058594 435.9104 1304.70886230469 435.910217285156 3 11 1.1.1.3611.5 1 37.1875 2330.672 37.3357 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 66.5899991989136 HPEYAVSVLLR 0.00417651003226638 1282.70751953125 642.361 1282.70336914063 642.358947753906 2 9 1.1.1.3951.10 1 45.2572 198.9694 45.1715 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 60.0199997425079 HPEYAVSVLLR 0.00258965999819338 1282.70593261719 642.3602 1282.70336914063 642.358947753906 2 10 1.1.1.3937.8 1 44.9104 955.6401 44.8003 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 52.3400008678436 HPEYAVSVLLR 0.00319998990744352 1282.70642089844 642.3605 1282.70336914063 642.358947753906 2 8 1.1.1.3923.8 1 44.5615 866.8412 44.6765 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 20.1499998569489 IETMREK Oxidation(M)@4 missed R-E@5 -0.000993984052911401 921.458068847656 461.7363 921.458984375 461.736755371094 2 10 1.1.1.2404.2 1 14.0671 1065.227 14.0722 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 19.6199998259544 IETMREK Oxidation(M)@4 missed R-E@5 -0.000566757982596755 921.45849609375 461.7365 921.458984375 461.736755371094 2 10 1.1.1.2423.2 1 14.2361 1161.192 14.2476 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 18.5900002717972 IETMREK Oxidation(M)@4 missed R-E@5 -0.000810887024272233 921.458251953125 461.7364 921.458984375 461.736755371094 2 10 1.1.1.2445.2 1 14.4049 1095.977 14.3737 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 IETMREKVLTSSAR Oxidation(M)@4 missed R-E@5; missed K-V@7 -0.00572605011984706 1635.85559082031 546.2925 1635.86145019531 546.29443359375 3 17 1.1.1.2971.4 1 22.4223 982.1835 22.4555 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 IETMREKVLTSSAR Oxidation(M)@4; Carbamidomethyl(K)@7 missed R-E@5; missed K-V@7 -0.010665699839592 1692.8720703125 565.298 1692.8828125 565.301574707031 3 17 1.1.1.2973.7 1 22.472 223.8787 22.4555 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KECCDKPLLEK ONE addition +154(K)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved L-K@N-term; missed K-E@1 0.0140282995998859 1572.80322265625 787.4089 1572.78918457031 787.40185546875 2 14 1.1.1.3086.10 1 25.0769 202.9783 25.057 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.000906119996216148 1141.70812988281 571.8613 1141.70703125 571.860778808594 2 17 1.1.1.3789.7 1 41.3214 17929.55 41.476 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.000906119996216148 1141.70812988281 571.8613 1141.70703125 571.860778808594 2 17 1.1.1.3804.10 1 41.6804 17929.55 41.476 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.00322535005398095 1141.71032714844 571.8624 1141.70703125 571.860778808594 2 13 1.1.1.3843.6 1 42.6144 419.5728 42.5749 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 63.7899994850159 KQTALVELLK Carbamyl@N-term missed K-Q@1 0.00181493000127375 1184.71472167969 593.3646 1184.712890625 593.363708496094 2 9 1.1.1.4113.5 1 49.2469 392.6281 49.3622 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 41.9099986553192 KQTALVELLK missed K-Q@1 0.00310328998602927 1141.71032714844 571.8624 1141.70703125 571.860778808594 2 8 1.1.1.3809.8 1 41.8045 12610.23 41.5475 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 25.6599992513657 KQTALVELLK reduced acrolein addition +58(K)@1; Deamidated(Q)@2; Dehydrated(T)@3 missed K-Q@1 0.00380931003019214 1182.72631835938 592.3704 1182.72241210938 592.368469238281 2 11 1.1.1.3818.8 1 42.0168 1466.689 42.0724 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 21.8899995088577 KQTALVELLK Carbamyl@N-term missed K-Q@1 0.00181493000127375 1184.71472167969 593.3646 1184.712890625 593.363708496094 2 6 1.1.1.4122.9 1 49.4705 392.6281 49.3622 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.0027843399439007 1638.927734375 547.3165 1638.93041992188 547.317443847656 3 23 1.1.1.3741.3 1 40.1793 43511.38 40.3088 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.0027843399439007 1638.927734375 547.3165 1638.93041992188 547.317443847656 3 22 1.1.1.3749.6 1 40.3717 43511.38 40.3088 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.000328313006320968 1638.93103027344 547.3176 1638.93041992188 547.317443847656 3 23 1.1.1.3757.2 1 40.5568 42817.22 40.3088 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.000328313006320968 1638.93103027344 547.3176 1638.93041992188 547.317443847656 3 22 1.1.1.3765.3 1 40.7554 35832.48 40.4989 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.0029674400575459 1638.927734375 547.3165 1638.93041992188 547.317443847656 3 21 1.1.1.3779.3 1 41.0838 9928.748 40.8322 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 -0.0029674400575459 1638.927734375 547.3165 1638.93041992188 547.317443847656 3 21 1.1.1.3786.3 1 41.2507 616.2111 41.2378 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00545503990724683 1638.93603515625 547.3193 1638.93041992188 547.317443847656 3 19 1.1.1.3795.3 1 41.4651 463.2651 41.4284 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Butyryl(K)@1; Oxidation(P)@3 missed K-V@1 0.0133597003296018 1724.98071289063 863.4976 1724.96728515625 863.490905761719 2 18 1.1.1.4174.3 1 50.7659 3653.49 50.5556 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Butyryl(K)@1; Oxidation(P)@3 missed K-V@1 0.0133597003296018 1724.98071289063 863.4976 1724.96728515625 863.490905761719 2 18 1.1.1.4167.17 1 50.5981 3653.49 50.5556 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@3; Deamidated(Q)@4 missed K-V@1 0.0230794008821249 1653.91687011719 827.9657 1653.89379882813 827.954162597656 2 13 1.1.1.3743.4 1 40.2325 621.7645 40.3326 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 0.00262056989595294 1652.91223144531 827.4634 1652.90979003906 827.462158203125 2 14 1.1.1.3744.9 1 40.2563 566.197 40.3563 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Dioxidation(P)@3 missed K-V@1 0.00594870978966355 1670.92626953125 836.4704 1670.92028808594 836.467407226563 2 14 1.1.1.3746.6 1 40.3003 714.4083 40.3088 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 -0.000550807977560908 1652.9091796875 551.977 1652.90979003906 551.977172851563 3 18 1.1.1.3752.5 1 40.4429 815.8252 40.4039 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Dioxidation(P)@8 missed K-V@1 -0.00125314004253596 1670.91906738281 836.4668 1670.92028808594 836.467407226563 2 18 1.1.1.3754.3 1 40.4939 570.1381 40.4989 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Deamidated(Q)@4; Pro->pyro-Glu(P)@8 missed K-V@1 0.0253986995667219 1653.91931152344 827.9669 1653.89379882813 827.954162597656 2 14 1.1.1.3757.3 1 40.5651 420.7579 40.5227 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@3 missed K-V@1 0.0118998000398278 1652.92138671875 551.9811 1652.90979003906 551.977172851563 3 18 1.1.1.3760.3 1 40.6305 449.4231 40.6414 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@8 missed K-V@1 0.0118998000398278 1652.92138671875 551.9811 1652.90979003906 551.977172851563 3 13 1.1.1.3768.10 1 40.8238 449.4231 40.6414 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR acrolein addition +56(K)@1; Deamidated(Q)@4 missed K-V@1 0.0044255699031055 1695.94519042969 566.3223 1695.94067382813 566.320861816406 3 12 1.1.1.3768.11 1 40.8255 365.0281 40.7366 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1; Deamidated(Q)@4; Dehydrated(S)@6 missed K-V@1 0.00907843001186848 1679.95471191406 560.9922 1679.94580078125 560.989196777344 3 17 1.1.1.3770.10 1 40.8748 3434.695 40.9515 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1; Deamidated(Q)@4; Dehydrated(S)@6 missed K-V@1 0.0136529998853803 1679.95947265625 840.987 1679.94580078125 840.980163574219 2 12 1.1.1.3777.8 1 41.0419 1044.005 40.9515 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Carbamyl@N-term missed K-V@1 0.0047615198418498 1681.94104003906 841.9778 1681.93627929688 841.975402832031 2 12 1.1.1.3955.10 1 45.3562 565.3191 45.4691 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Carbamyl@N-term missed K-V@1 0.0047615198418498 1681.94104003906 841.9778 1681.93627929688 841.975402832031 2 11 1.1.1.3962.12 1 45.5309 565.3191 45.4691 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Formyl@N-term missed K-V@1 0.0016413499834016 1666.92712402344 834.4708 1666.92541503906 834.469970703125 2 15 1.1.1.3963.8 1 45.5632 1292.043 45.6923 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Formyl@N-term missed K-V@1 0.0016413499834016 1666.92712402344 834.4708 1666.92541503906 834.469970703125 2 18 1.1.1.3970.14 1 45.7319 1292.043 45.6923 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Acetyl@N-term missed K-V@1 0.00395847018808126 1680.94506835938 841.4798 1680.94104003906 841.477783203125 2 16 1.1.1.3979.14 1 45.9575 1074.26 45.9178 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.3599979877472 KVPQVSTPTLVEVSR acrolein addition +56(K)@1; Oxidation(P)@3; Methyl(Q)@4 missed K-V@1 0.0133597003296018 1724.98071289063 863.4976 1724.96728515625 863.490905761719 2 11 1.1.1.4160.17 1 50.4201 3653.49 50.5556 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 92.5499975681305 KVPQVSTPTLVEVSR Acetyl@N-term missed K-V@1 0.00395847018808126 1680.94506835938 841.4798 1680.94104003906 841.477783203125 2 9 1.1.1.3972.16 1 45.7824 1074.26 45.9178 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.1699987649918 KVPQVSTPTLVEVSR Oxidation(P)@3; Deamidated(Q)@4; Pro->pyro-Glu(P)@8 missed K-V@1 0.0159837994724512 1669.90478515625 557.6422 1669.888671875 557.636840820313 3 13 1.1.1.3747.4 1 40.3233 478.4964 40.3563 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 24.0500003099442 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1 missed K-V@1 -0.0315513983368874 1696.94091796875 849.4777 1696.97229003906 849.493469238281 2 8 1.1.1.4028.17 1 47.1895 170.2451 47.173 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LAKEYEATLEECCAKDD Carbamidomethyl(C)@12; Carbamidomethyl(C)@13 cleaved D-P@C-term; missed K-E@3; missed K-D@15 -0.00182839995250106 2043.87463378906 682.2988 2043.87646484375 682.299438476563 3 18 1.1.1.3503.5 1 34.7123 470.1526 34.621 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 61.6599977016449 LCVLHEK Carbamidomethyl(C)@2 0.00162458000704646 897.475891113281 449.7452 897.474243164063 449.744384765625 2 10 1.1.1.3030.2 1 23.7337 1024.607 23.9094 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 54.2200028896332 LCVLHEK Carbamidomethyl(C)@2 -0.000145355996210128 897.474060058594 449.7443 897.474243164063 449.744384765625 2 10 1.1.1.3037.3 1 23.8985 1054.555 24.0074 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 21.9300001859665 LFTFHADICTLPDTEK Carbamidomethyl(C)@9 0.0108639001846313 1906.92443847656 954.4695 1906.91345214844 954.464050292969 2 7 1.1.1.4128.18 1 49.6264 306.0629 49.7078 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.00631396006792784 1478.79443359375 740.4045 1478.78820800781 740.4013671875 2 23 1.1.1.4171.4 1 50.693 24467.44 50.7768 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Oxidation(Y)@4 0.00297612999565899 1494.7861328125 748.4003 1494.78308105469 748.398803710938 2 22 1.1.1.4173.5 1 50.7444 481.8383 50.8008 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.00631396006792784 1478.79443359375 740.4045 1478.78820800781 740.4013671875 2 23 1.1.1.4178.3 1 50.8676 24467.44 50.7768 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.0103422002866864 1478.79870605469 740.4066 1478.78820800781 740.4013671875 2 20 1.1.1.4202.3 1 51.4445 238.1626 51.4311 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Delta:H(2)C(2)@N-term 0.00476243998855352 1504.80871582031 753.4116 1504.80383300781 753.4091796875 2 18 1.1.1.4283.4 1 53.4107 425.4728 53.4546 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.00517369015142322 1536.798828125 769.4067 1536.79370117188 769.404113769531 2 15 1.1.1.4145.11 1 50.0421 3128.175 50.0291 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.7600028514862 LGEYGFQNALIVR Carbamidomethyl@N-term; Deamidated(N)@8 0.00517369015142322 1536.798828125 769.4067 1536.79370117188 769.404113769531 2 11 1.1.1.4138.7 0 49.8707 3128.175 50.0291 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 33.3099991083145 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.00517369015142322 1536.798828125 769.4067 1536.79370117188 769.404113769531 2 7 1.1.1.4152.12 1 50.2147 3128.175 50.0291 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.1699987649918 LKAWSVAR cleaved A-L@N-term; missed K-A@2 -0.0160949006676674 929.528686523438 465.7716 929.544677734375 465.779632568359 2 10 1.1.1.2795.3 1 18.7809 1498.858 18.7918 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.6800007820129 LKAWSVAR cleaved A-L@N-term; missed K-A@2 -0.0162780005484819 929.528503417969 465.7715 929.544677734375 465.779632568359 2 9 1.1.1.2811.6 1 19.1688 1049.105 19.2018 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -0.00404143007472157 1531.76977539063 511.5972 1531.77380371094 511.598541259766 3 20 1.1.1.3065.7 1 24.5594 6556.392 24.6163 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -0.00404143007472157 1531.76977539063 511.5972 1531.77380371094 511.598541259766 3 20 1.1.1.3072.4 1 24.735 6556.392 24.6163 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5; Dehydrated(D)@6; Oxidation(K)@7 missed K-E@2 -0.00429246015846729 1529.75378417969 510.9252 1529.75817871094 510.926666259766 3 15 1.1.1.3056.3 1 24.3537 159.8516 24.3193 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00726972008123994 2697.3037109375 675.3332 2697.31079101563 675.3349609375 4 19 1.1.1.4114.8 1 49.2782 1238.887 49.3374 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.0046348599717021 2669.31127929688 668.3351 2669.31591796875 668.336242675781 4 18 1.1.1.4135.7 1 49.7933 1666.991 49.8561 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.0046348599717021 2669.31127929688 668.3351 2669.31591796875 668.336242675781 4 18 1.1.1.4142.8 1 49.968 1666.991 49.8561 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00812883954495192 2665.31298828125 667.3355 2665.32104492188 667.337524414063 4 12 1.1.1.4152.10 1 50.2131 546.5374 50.1529 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.0154609996825457 2665.3056640625 534.0684 2665.32104492188 534.071472167969 5 16 1.1.1.4156.2 1 50.3075 501.3736 50.2025 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.0114885997027159 2669.3046875 534.8682 2669.31591796875 534.870483398438 5 16 1.1.1.4136.6 1 49.8187 1586.399 49.9056 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.0114885997027159 2669.3046875 534.8682 2669.31591796875 534.870483398438 5 14 1.1.1.4139.5 1 49.8872 1586.399 49.9056 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.0114885997027159 2669.3046875 534.8682 2669.31591796875 534.870483398438 5 14 1.1.1.4140.9 1 49.9153 1586.399 49.9056 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00726972008123994 2697.3037109375 675.3332 2697.31079101563 675.3349609375 4 12 1.1.1.4121.8 1 49.4449 1238.887 49.3374 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.00678145000711083 2697.30419921875 675.3333 2697.31079101563 675.3349609375 4 13 1.1.1.4107.4 1 49.105 1197.425 49.3374 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.0114885997027159 2669.3046875 534.8682 2669.31591796875 534.870483398438 5 12 1.1.1.4137.6 1 49.8385 1586.399 49.9056 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 70.2899992465973 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.0114885997027159 2669.3046875 534.8682 2669.31591796875 534.870483398438 5 9 1.1.1.4145.7 1 50.0371 1586.399 49.9056 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 47.0699995756149 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.0154609996825457 2665.3056640625 534.0684 2665.32104492188 534.071472167969 5 10 1.1.1.4154.8 1 50.2616 501.3736 50.2025 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.3099989891052 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.0154609996825457 2665.3056640625 534.0684 2665.32104492188 534.071472167969 5 11 1.1.1.4146.5 1 50.0617 501.3736 50.2025 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 17.739999294281 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 -0.0154122998937964 2697.29541015625 540.4664 2697.31079101563 540.469421386719 5 9 1.1.1.4125.4 1 49.543 1031.314 49.3374 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0154154002666473 3605.77099609375 722.1615 3605.78637695313 722.16455078125 5 19 1.1.1.4277.5 1 53.2684 1371.86 53.3322 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0154154002666473 3605.77099609375 722.1615 3605.78637695313 722.16455078125 5 19 1.1.1.4284.5 1 53.4362 1371.86 53.3322 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0119011998176575 3577.77978515625 597.3039 3577.79150390625 597.305847167969 6 14 1.1.1.4319.3 1 54.3234 689.8152 54.2922 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 66.5899991989136 LSQKFPK missed K-F@4 0.00344700994901359 846.499877929688 424.2572 846.496337890625 424.255432128906 2 11 1.1.1.2927.2 1 21.3841 19989.55 21.3523 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.2600001096725 LSQKFPK missed K-F@4 0.00344700994901359 846.499877929688 424.2572 846.496337890625 424.255432128906 2 10 1.1.1.2934.4 1 21.5507 25982.69 21.4961 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.1699987649918 LSQKFPK Dioxidation(P)@6 missed K-F@4 0.0025697099044919 878.488647460938 440.2516 878.486145019531 440.250366210938 2 11 1.1.1.2931.2 1 21.4827 657.4695 21.5436 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 24.0500003099442 LSQKFPK Oxidation(F)@5 missed K-F@4 -0.0013564700493589 862.489868164063 432.2522 862.491271972656 432.252899169922 2 8 1.1.1.2925.7 1 21.3389 629.3798 21.3523 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 -0.00289635988883674 1749.96362304688 584.3285 1749.96655273438 584.329467773438 3 22 1.1.1.3637.7 1 37.7881 2769.696 37.8645 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00905255042016506 2520.41137695313 631.1101 2520.42041015625 631.112365722656 4 11 1.1.1.4413.2 1 56.6544 341.4441 56.6256 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.00280679995194077 2520.42309570313 841.1483 2520.42041015625 841.147399902344 3 15 1.1.1.4422.5 1 56.8791 295.1097 56.8481 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00270508998073637 2520.41772460938 631.1117 2520.42041015625 631.112365722656 4 17 1.1.1.4429.3 1 57.0521 1238.784 57.0975 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -0.00270508998073637 2520.41772460938 631.1117 2520.42041015625 631.112365722656 4 17 1.1.1.4436.3 1 57.2264 1238.784 57.0975 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 47.8300005197525 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.0117787001654506 2520.43212890625 841.1513 2520.42041015625 841.147399902344 3 10 1.1.1.4429.7 1 57.0555 542.0585 57.0722 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LVNELTEFAK 0.00162561994511634 1162.62512207031 582.3198 1162.62341308594 582.318969726563 2 11 1.1.1.3966.6 1 45.6293 2549.127 45.8167 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LVNELTEFAK 0.00162561994511634 1162.62512207031 582.3198 1162.62341308594 582.318969726563 2 13 1.1.1.3973.6 1 45.7991 2561.677 45.8167 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LVNELTEFAK 0.0024800798855722 1162.62585449219 582.3202 1162.62341308594 582.318969726563 2 11 1.1.1.3987.6 1 46.1525 1632.199 45.8925 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 28.4900009632111 LVVSTQTALA 0.00328322011046112 1001.5791015625 501.7968 1001.57568359375 501.795135498047 2 10 1.1.1.3816.5 1 41.9648 12194.15 41.9765 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 28.2000005245209 LVVSTQTALA 0.00364942010492086 1001.57946777344 501.797 1001.57568359375 501.795135498047 2 10 1.1.1.3837.4 1 42.4673 2809.971 42.2159 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 0.0088875200599432 1739.83129882813 870.9229 1739.822265625 870.918395996094 2 19 1.1.1.4415.5 1 56.7096 1616.954 56.774 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 0.0088875200599432 1739.83129882813 870.9229 1739.822265625 870.918395996094 2 20 1.1.1.4422.6 1 56.8799 1616.954 56.774 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 45.5900013446808 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 0.00510344980284572 1739.82751464844 870.921 1739.822265625 870.918395996094 2 10 1.1.1.4430.8 1 57.0816 237.9815 57.0467 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14 -0.00938579998910427 2619.27661132813 655.8264 2619.28588867188 655.828735351563 4 22 1.1.1.4600.2 1 61.0541 1660.222 61.0738 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.0159514993429184 3260.60864257813 816.1594 3260.62426757813 816.163391113281 4 17 1.1.1.4539.4 1 59.6523 367.8355 59.5862 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.0194790996611118 3260.6044921875 653.1282 3260.62426757813 653.132141113281 5 24 1.1.1.4541.2 1 59.6698 855.4874 59.6574 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Met->Hcy(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 -0.010397800244391 3230.60327148438 647.1279 3230.61376953125 647.130004882813 5 14 1.1.1.4583.4 1 60.6369 300.9038 60.6561 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEKVTK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21; missed K-V@27 -0.0108543997630477 3588.82470703125 718.7722 3588.83544921875 718.774353027344 5 13 1.1.1.4434.3 1 57.177 1013.004 57.2464 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 31.5400004386902 PDETYVPK cleaved T-P@N-term -0.00545408995822072 947.454650878906 948.4619 947.460021972656 948.46728515625 1 7 1.1.1.3886.17 1 43.6597 109.4707 43.5669 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 63.4800016880035 QNCDQFEK Carbamidomethyl(C)@3 6.2999599322211E-05 1067.43432617188 534.7244 1067.43420410156 534.724365234375 2 11 1.1.1.2842.8 1 19.7791 3056.454 19.6888 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.1699987649918 QNCDQFEK Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3; Deamidated(Q)@5 0.0174301993101835 1051.40930175781 526.7119 1051.39172363281 526.703125 2 7 1.1.1.3113.9 1 25.7333 241.0957 25.7417 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 21.1999997496605 QNCDQFEK Carbamidomethyl(C)@3 6.2999599322211E-05 1067.43432617188 534.7244 1067.43420410156 534.724365234375 2 9 1.1.1.2834.11 1 19.5873 3056.454 19.6888 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Carbamidomethyl(Y)@12; Deamidated(N)@16 missed K-L@8 0.0101950997486711 2586.2275390625 863.0831 2586.21728515625 863.079711914063 3 20 1.1.1.4229.13 1 52.1126 1799.578 52.1478 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.00479843001812696 2528.216796875 843.7462 2528.2119140625 843.744567871094 3 25 1.1.1.4269.7 1 53.0725 15022.63 53.1376 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 -0.00635077012702823 2528.20581054688 633.0587 2528.2119140625 633.060241699219 4 17 1.1.1.4270.3 1 53.0951 1685.523 53.1376 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.00479843001812696 2528.216796875 843.7462 2528.2119140625 843.744567871094 3 28 1.1.1.4276.4 1 53.2408 15022.63 53.1376 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 missed K-L@8 0.000842267007101327 2511.18603515625 838.0693 2511.18530273438 838.069030761719 3 29 1.1.1.4399.3 1 56.3116 1928.015 56.3317 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3; Carbamidomethyl(Y)@12; Deamidated(N)@16 missed K-L@8 -0.00163794995751232 2569.18896484375 857.4036 2569.19067382813 857.404174804688 3 13 1.1.1.4344.7 1 54.95 298.9655 54.9917 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Oxidation(Y)@12 missed K-L@8 -0.0014494500355795 2544.20532226563 849.0757 2544.20678710938 849.076171875 3 12 1.1.1.4272.11 1 53.1485 508.8283 53.1619 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 20.0800001621246 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Deamidated(N)@16 missed K-L@8 0.0227065999060869 2529.21850585938 844.0801 2529.19580078125 844.072570800781 3 9 1.1.1.4230.11 1 52.1344 161.8173 52.1226 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK 0.00271832011640072 1013.61486816406 507.8147 1013.61212158203 507.813323974609 2 14 1.1.1.4096.4 1 48.832 51608.91 48.8032 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK Gln->pyro-Glu@N-term 0.00465235020965338 996.590270996094 499.3024 996.585571289063 499.300048828125 2 13 1.1.1.4485.4 1 58.452 2180.564 58.3374 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK 0.00271832011640072 1013.61486816406 507.8147 1013.61212158203 507.813323974609 2 12 1.1.1.4103.4 1 49.003 51608.91 48.8032 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK 0.00253522000275552 1013.61468505859 507.8146 1013.61212158203 507.813323974609 2 9 1.1.1.4152.5 1 50.2089 987.4404 50.1032 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK Dehydrated(T)@2 -0.000860513013321906 995.600646972656 498.8076 995.601501464844 498.808044433594 2 15 1.1.1.4093.2 1 48.7617 1079.003 48.8032 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK Dehydrated(T)@2 -0.000860513013321906 995.600646972656 498.8076 995.601501464844 498.808044433594 2 12 1.1.1.4100.3 1 48.9297 1079.003 48.8032 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 84.8299980163574 QTALVELLK 0.00271832011640072 1013.61486816406 507.8147 1013.61212158203 507.813323974609 2 12 1.1.1.4089.2 1 48.6668 51608.91 48.8032 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 84.8299980163574 QTALVELLK 0.00436621019616723 1013.61645507813 507.8155 1013.61212158203 507.813323974609 2 9 1.1.1.4145.6 1 50.0362 1068.598 50.0043 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 50.3400027751923 QTALVELLK 0.00235211988911033 1013.61450195313 507.8145 1013.61212158203 507.813323974609 2 8 1.1.1.4110.3 1 49.1698 18330.4 48.9233 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 48.6000001430511 QTALVELLK 0.00473240995779634 1013.61688232422 507.8157 1013.61212158203 507.813323974609 2 7 1.1.1.4124.5 1 49.5167 829.9452 49.6092 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 47.8300005197525 QTALVELLK 0.00253522000275552 1013.61468505859 507.8146 1013.61212158203 507.813323974609 2 9 1.1.1.4131.4 1 49.6911 1114.663 49.8561 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 44.870001077652 QTALVELLK -8.92012030817568E-05 1013.61206054688 507.8133 1013.61212158203 507.813323974609 2 7 1.1.1.4117.3 1 49.3421 539.4454 49.3622 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 44.5899993181229 QTALVELLK Gln->pyro-Glu@N-term; Cation:Na(E)@6 0.00399906001985073 1018.57147216797 510.293 1018.56750488281 510.291015625 2 6 1.1.1.4481.4 1 58.3453 59.4825 58.3374 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 44.5899993181229 QTALVELLK Dehydrated(T)@2 -0.00464456016197801 995.596862792969 498.8057 995.601501464844 498.808044433594 2 7 1.1.1.4493.2 1 58.6445 291.7417 58.6373 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.5499993562698 QTALVELLK 0.00253522000275552 1013.61468505859 507.8146 1013.61212158203 507.813323974609 2 9 1.1.1.4138.3 1 49.8624 1114.663 49.8561 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 18.019999563694 QTALVELLK 0.00253522000275552 1013.61468505859 507.8146 1013.61212158203 507.813323974609 2 6 1.1.1.4162.4 1 50.4601 685.5443 50.2025 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 32.1200013160706 QTALVELLKHKPK Gln->pyro-Glu@N-term missed K-H@9 0.000474486005259678 1486.8876953125 496.6365 1486.88720703125 496.636322021484 3 7 1.1.1.4051.4 1 47.7464 1019.776 47.8398 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPEYAVSVLLR missed R-H@1 0.000429942010669038 1438.80480957031 480.6089 1438.80444335938 480.608764648438 3 19 1.1.1.3668.8 1 38.5237 17862.4 38.5551 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPEYAVSVLLR Dioxidation(Y)@5 missed R-H@1 -0.00606764992699027 1470.7880859375 491.27 1470.79431152344 491.272033691406 3 14 1.1.1.3670.5 1 38.5738 452.6366 38.5551 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANK missed R-H@1 0.0030338300857693 2044.02368164063 682.3485 2044.02062988281 682.347534179688 3 15 1.1.1.4152.11 1 50.2139 1635.949 50.3027 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0236319992691278 4513.07373046875 753.1862 4513.09716796875 753.190124511719 6 15 1.1.1.4305.3 1 53.9671 427.6821 53.9872 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.0103973997756839 4513.08642578125 903.6246 4513.09716796875 903.626647949219 5 24 1.1.1.4305.7 1 53.9704 1064.707 53.9618 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.014817800372839 4512.09814453125 903.4269 4512.11279296875 903.429870605469 5 28 1.1.1.4335.9 1 54.7296 2339.461 54.8183 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.00489964010193944 4512.10693359375 1129.034 4512.11279296875 1129.03552246094 4 14 1.1.1.4337.9 1 54.7888 958.939 54.8183 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 -0.014817800372839 4512.09814453125 903.4269 4512.11279296875 903.429870605469 5 31 1.1.1.4342.6 1 54.8997 2339.461 54.8183 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.8700000047684 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK HPNE addition +172(K)@16; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Deamidated(Q)@26; acrolein addition +38(K)@30; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0386742986738682 4723.26123046875 945.6595 4723.22265625 945.651794433594 5 10 1.1.1.4334.5 1 54.7031 25488.97 54.8923 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.00281873997300863 1879.91101074219 627.6443 1879.91381835938 627.645202636719 3 14 1.1.1.3875.15 1 43.3859 6209.452 43.6159 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.0061145001091063 1879.90771484375 627.6432 1879.91381835938 627.645202636719 3 20 1.1.1.3889.8 1 43.7247 6252.056 43.6159 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 -0.00281873997300863 1879.91101074219 627.6443 1879.91381835938 627.645202636719 3 16 1.1.1.3896.8 1 43.8992 5378.391 43.6404 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 0.00177673995494843 1071.50366210938 536.7591 1071.501953125 536.758239746094 2 14 1.1.1.2863.2 1 20.2612 943.2528 20.3331 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 -0.0016410700045526 1071.50024414063 536.7574 1071.501953125 536.758239746094 2 14 1.1.1.2878.3 1 20.4336 2020.306 20.4547 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEK Acetyl@N-term; Carbamidomethyl(C)@3 0.0121788000687957 1113.52465820313 557.7696 1113.51245117188 557.763488769531 2 14 1.1.1.3152.5 1 26.624 260.6519 26.6087 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.6800007820129 SHCIAEVEK Carbamidomethyl(C)@3; Cation:Na(E)@6 -0.000551434990484267 1093.48327636719 547.7489 1093.48388671875 547.749206542969 2 9 1.1.1.2877.3 1 20.4099 75.9855 20.4149 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEKDAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@3; Carbamidomethyl(C)@30 missed K-D@9; missed K-D@27 -1.01282000541687 3509.65185546875 878.4202 3510.66479492188 878.673461914063 4 17 1.1.1.4143.9 1 49.9967 572.9142 50.0538 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLGKVGTR Acetyl(K)@4 missed K-V@4 -0.00125929003115743 858.491088867188 430.2528 858.492309570313 430.253448486328 2 12 1.1.1.3051.2 1 24.2308 1370.415 24.1756 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 48.3799993991852 SLGKVGTR Formyl(K)@4 missed K-V@4 0.000629748974461108 844.477294921875 423.2459 844.476684570313 423.24560546875 2 9 1.1.1.3004.2 1 23.1739 241.2868 23.0625 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 25.6599992513657 SLGKVGTR Carbamyl(K)@4 missed K-V@4 -0.00436624977737665 859.483276367188 430.7489 859.487548828125 430.751068115234 2 7 1.1.1.2972.5 1 22.4404 365.0287 22.4315 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00308766006492078 1418.68969726563 710.3521 1418.68640136719 710.350463867188 2 12 1.1.1.3947.16 1 45.1622 5295.24 45.3696 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.0164528992027044 1418.70275878906 473.9082 1418.68640136719 473.902740478516 3 11 1.1.1.3954.5 1 45.3264 2574.825 45.3696 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.000524296017829329 1418.68713378906 710.3508 1418.68640136719 710.350463867188 2 19 1.1.1.3954.10 1 45.3331 5568.256 45.3946 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.000524296017829329 1418.68713378906 710.3508 1418.68640136719 710.350463867188 2 20 1.1.1.3961.11 1 45.5086 5568.256 45.3946 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00333178997971118 1418.68981933594 710.3522 1418.68640136719 710.350463867188 2 13 1.1.1.3968.9 1 45.6773 782.4319 45.6923 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.00711491005495191 1418.69348144531 473.9051 1418.68640136719 473.902740478516 3 12 1.1.1.3961.7 1 45.5019 1756.899 45.4691 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Formyl@N-term; Carbamidomethyl(C)@11 0.00477358978241682 1446.68603515625 724.3503 1446.68127441406 724.347961425781 2 14 1.1.1.4227.5 1 52.0601 74.0549 52.0231 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 0.00120079994667321 1462.58288574219 732.2987 1462.58166503906 732.298095703125 2 21 1.1.1.2774.7 1 18.2859 8555.161 18.3624 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 0.0131631996482611 1462.59484863281 732.3047 1462.58166503906 732.298095703125 2 14 1.1.1.2798.6 1 18.8584 100.1165 18.8634 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Cation:Na(E)@6; Carbamidomethyl(C)@11 0.00086445698980242 1484.564453125 743.2895 1484.56359863281 743.2890625 2 20 1.1.1.2778.6 1 18.3778 345.7467 18.3624 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.5300004482269 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.00882343016564846 1462.57287597656 488.5316 1462.58166503906 488.534515380859 3 12 1.1.1.2774.3 1 18.2742 10879.77 18.3624 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TPVSEKVTK missed K-V@6 -0.00027419300749898 987.559875488281 494.7872 987.56005859375 494.787292480469 2 15 1.1.1.2785.2 1 18.5356 9009.147 18.5294 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TPVSEKVTK Formyl(K)@6 missed K-V@6 -4.45771984232124E-05 1015.55487060547 508.7847 1015.55499267578 508.784759521484 2 14 1.1.1.3038.2 1 23.9288 136.6571 23.9338 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.000112544999865349 1414.68041992188 708.3475 1414.68029785156 708.347412109375 2 15 1.1.1.4094.9 1 48.7882 339.1687 48.7793 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.0038966101128608 1414.68432617188 708.3494 1414.68029785156 708.347412109375 2 16 1.1.1.4101.5 1 48.9596 541.6817 49.0681 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.0038966101128608 1414.68432617188 708.3494 1414.68029785156 708.347412109375 2 13 1.1.1.4108.5 1 49.1227 541.6817 49.0681 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00340834003873169 1414.68371582031 708.3491 1414.68029785156 708.347412109375 2 16 1.1.1.4115.4 1 49.2961 582.4304 49.2882 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.00426281010732055 1414.68444824219 708.3495 1414.68029785156 708.347412109375 2 16 1.1.1.4122.10 1 49.4714 595.7256 49.3622 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.000600810977630317 1414.68090820313 708.3477 1414.68029785156 708.347412109375 2 15 1.1.1.4129.7 1 49.6511 418.5876 49.5844 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 22.3199993371964 TVMENFVAFVDK Oxidation(M)@3 0.0114647001028061 1414.69165039063 708.3531 1414.68029785156 708.347412109375 2 10 1.1.1.4136.8 1 49.8237 155.8185 49.8313 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.00129277002997696 3323.46215820313 831.8728 3323.46069335938 831.872436523438 4 31 1.1.1.4189.4 1 51.1323 1841.123 51.2589 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.00129277002997696 3323.46215820313 831.8728 3323.46069335938 831.872436523438 4 21 1.1.1.4196.8 1 51.2928 1841.123 51.2589 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 61.7699980735779 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.00674356007948518 3323.46801757813 1108.83 3323.46069335938 1108.82751464844 3 13 1.1.1.4197.9 1 51.3282 693.5745 51.2343 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 20.0800001621246 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.00129277002997696 3323.46215820313 831.8728 3323.46069335938 831.872436523438 4 11 1.1.1.4200.7 1 51.4017 1841.123 51.2589 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR 0.00374177005141974 1510.83923339844 756.4269 1510.83544921875 756.425048828125 2 20 1.1.1.3918.8 1 44.4434 2669.949 44.4782 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR 0.00374177005141974 1510.83923339844 756.4269 1510.83544921875 756.425048828125 2 21 1.1.1.3925.10 1 44.6153 2669.949 44.4782 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 27.3200005292892 VPQVSTPTLVEVSR 0.00105634005740285 1510.83642578125 756.4255 1510.83544921875 756.425048828125 2 8 1.1.1.3933.14 1 44.8151 2021.697 44.5526 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 23.6399993300438 VPQVSTPTLVEVSR 0.00374177005141974 1510.83923339844 756.4269 1510.83544921875 756.425048828125 2 10 1.1.1.3919.10 1 44.4664 2669.949 44.4782 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.1699987649918 YGFQNALIVRYTRKVPQVSTPTLVEVSR Carbamidomethyl@N-term cleaved E-Y@N-term; missed R-Y@10; missed R-K@13; missed K-V@14 0.0675569996237755 3277.8623046875 1093.628 3277.79345703125 1093.60510253906 3 11 1.1.1.3758.8 1 40.5888 327.4517 40.5702 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 0.00280288001522422 1442.63745117188 722.326 1442.634765625 722.324645996094 2 17 1.1.1.3083.8 1 25.0028 235.1483 25.0079 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.000248747004661709 1442.63452148438 722.3245 1442.634765625 722.324645996094 2 21 1.1.1.3111.17 1 25.6827 23147.31 25.7665 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 -0.000248747004661709 1442.63452148438 722.3245 1442.634765625 722.324645996094 2 21 1.1.1.3118.10 1 25.8572 23147.31 25.7665 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 0.00219255988486111 1442.63684082031 722.3257 1442.634765625 722.324645996094 2 18 1.1.1.3128.5 1 26.0462 6242.508 25.8397 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3; Deamidated(N)@5 0.00165552005637437 1443.62048339844 722.8175 1443.61877441406 722.816650390625 2 17 1.1.1.3182.6 1 27.2784 198.6829 27.2631 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Oxidation(Y)@1; Carbamidomethyl(C)@3 0.00500875990837812 1458.63464355469 730.3246 1458.62963867188 730.322143554688 2 13 1.1.1.3079.4 1 24.9048 135.8502 24.9098 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3; Amidated@C-term 0.000166241006809287 1441.65087890625 721.8327 1441.65075683594 721.832641601563 2 16 1.1.1.3093.6 1 25.248 135.8322 25.2531 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Dioxidation(Y)@1; Carbamidomethyl(C)@3 0.000135794005473144 1474.62463378906 738.3196 1474.62463378906 738.319580078125 2 11 1.1.1.3112.17 1 25.7081 599.8923 25.7665 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Trioxidation(Y)@1; Carbamidomethyl(C)@3 0.00417449977248907 1490.62365722656 746.3191 1490.61950683594 746.317016601563 2 10 1.1.1.3112.18 1 25.7089 296.4327 25.7417 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3; Cation:Na(D)@7 -9.84245998552069E-05 1464.61669921875 733.3156 1464.61669921875 733.315612792969 2 15 1.1.1.3114.7 1 25.7548 354.2994 25.7665 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Dioxidation(Y)@1; Carbamidomethyl(C)@3 0.000135794005473144 1474.62463378906 738.3196 1474.62463378906 738.319580078125 2 10 1.1.1.3119.5 1 25.8798 599.8923 25.7665 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 18.6000004410744 YICDNQDTISSKLK Carbamidomethyl(C)@3; Ser->LacticAcid(S)@11; acrolein addition +56(K)@14 missed K-L@12 0.00550050009042025 1724.83447265625 575.9521 1724.8291015625 575.950317382813 3 10 1.1.1.3512.7 1 34.9255 235.9258 34.8381 1 175.01 175.01 90.60999751091 88.6300027370453 88.6300027370453 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 62.9999995231628 YLYEIARR missed R-R@7 0.00122755998745561 1082.58850097656 542.3015 1082.58728027344 542.300903320313 2 9 1.1.1.3310.8 1 30.1136 869.2294 30.0259 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.00447130994871259 3634.94067382813 727.9954 3634.93579101563 727.994445800781 5 26 1.1.1.4297.4 1 53.7639 13595.71 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 APVLSDSSCK Carbamidomethyl(C)@9 0.00446389010176063 1062.50610351563 532.2603 1062.50158691406 532.258056640625 2 11 1.1.1.2972.9 1 22.4505 118.2409 22.4315 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.00500115007162094 2661.384765625 888.1355 2661.37963867188 888.1337890625 3 25 1.1.1.4394.4 1 56.1849 6426.826 56.1787 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term 0.00431230990216136 1345.69543457031 673.855 1345.69116210938 673.852844238281 2 12 1.1.1.4120.6 1 49.4185 360.2693 49.3868 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00517314998432994 2400.2734375 801.0984 2400.26831054688 801.0966796875 3 33 1.1.1.4329.9 1 54.5812 30992.02 54.5715 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IDVLEGNEQFINAAK cleaved N-I@N-term 0.00547013990581036 1659.85229492188 830.9334 1659.84680175781 830.9306640625 2 21 1.1.1.4053.14 1 47.8041 851.0997 47.8398 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IITHPNFNGN cleaved N-T@C-term 0.00170153996441513 1125.55847167969 563.7865 1125.55676269531 563.78564453125 2 9 1.1.1.3304.10 1 29.9714 494.3202 30.0735 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIK Ammonia-loss(N)@10 -0.00324981007725 2265.14306640625 756.055 2265.14624023438 756.056091308594 3 18 1.1.1.4269.6 1 53.0717 948.9982 53.0409 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATL Delta:H(4)C(2)(K)@20 cleaved L-N@C-term; missed K-L@20 0.00157679000403732 2979.57543945313 994.1991 2979.57397460938 994.198608398438 3 26 1.1.1.4565.3 1 60.1979 281.463 60.1847 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLN Delta:H(4)C(2)(K)@20 cleaved N-S@C-term; missed K-L@20 0.0195712000131607 3093.63525390625 1032.219 3093.61694335938 1032.212890625 3 19 1.1.1.4468.11 1 58.0301 497.6069 58.0096 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Methyl(K)@20 missed K-L@20 -0.00749523006379604 3305.70043945313 827.4324 3305.70776367188 827.434204101563 4 27 1.1.1.4374.5 1 55.6885 1920.994 55.7786 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IMLIKLSSPATLNSR Methyl(K)@5 cleaved D-I@N-term; missed K-L@5 0.00284431991167367 1656.96252441406 553.3281 1656.95971679688 553.3271484375 3 20 1.1.1.4060.9 1 47.9743 488.6826 47.9894 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.00773066002875566 2706.4013671875 677.6076 2706.40893554688 677.609497070313 4 28 1.1.1.4153.11 1 50.239 17006.98 50.1529 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24 missed R-L@4; missed K-I@24; missed K-L@44 0.0163410007953644 6025.12646484375 1005.195 6025.11181640625 1005.19262695313 6 24 1.1.1.4581.10 1 60.5993 1234.797 60.6308 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IVGGYTCAANSIPYQVSLNSG Carbamidomethyl(C)@7 cleaved G-S@C-term 0.0172035004943609 2170.05346679688 1086.034 2170.03637695313 1086.02551269531 2 17 1.1.1.4152.21 1 50.2223 1666.819 50.3027 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Deamidated(N)@19; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0278683993965387 4814.28271484375 1204.578 4814.2568359375 1204.57141113281 4 15 1.1.1.4271.5 1 53.1326 5165.061 53.1863 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 KIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@1; Oxidation(H)@5; Dethiomethyl(M)@18; acrolein addition +76(K)@21 cleaved A-K@N-term; missed K-I@1; missed K-L@21 0.0192414000630379 3634.95483398438 909.746 3634.93579101563 909.741271972656 4 30 1.1.1.4292.14 1 53.6441 12493.94 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQF cleaved F-I@C-term 0.00814513023942709 1712.80871582031 857.4116 1712.80053710938 857.407592773438 2 18 1.1.1.4053.15 1 47.8049 1279.094 47.8398 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0116103002801538 1939.93933105469 970.9769 1939.92761230469 970.971069335938 2 23 1.1.1.4117.10 1 49.3488 16375.39 49.3622 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.0161956008523703 2082.01733398438 1042.016 2082.00170898438 1042.00817871094 2 20 1.1.1.4166.21 1 50.5761 3325.364 50.5051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00603186013177037 2210.0908203125 737.7042 2210.0966796875 737.706176757813 3 28 1.1.1.4036.9 1 47.381 53753.32 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(K)@20 cleaved N-F@C-term; missed K-I@20 -0.00410996982827783 2913.49462890625 729.3809 2913.49853515625 729.381896972656 4 22 1.1.1.4303.6 1 53.9187 7568.41 53.8342 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.0353684015572071 3156.5888671875 790.1545 3156.62451171875 790.163391113281 4 19 1.1.1.4404.2 1 56.4337 5180.419 56.552 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20 cleaved N-G@C-term; missed K-I@20 0.00309321004897356 3174.61303710938 794.6605 3174.60986328125 794.659729003906 4 24 1.1.1.4390.4 1 56.0853 3669.391 56.2041 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20; Deamidated(N)@30 cleaved N-T@C-term; missed K-I@20 -0.0040319599211216 3346.65405273438 837.6708 3346.658203125 837.671813964844 4 23 1.1.1.4391.10 1 56.1132 2437.694 56.1021 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIML Delta:H(4)C(2)(K)@20 cleaved L-I@C-term; missed K-I@20 0.00154305994510651 4261.11474609375 1066.286 4261.111328125 1066.28515625 4 25 1.1.1.4591.17 1 60.8471 2406.321 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24 missed K-I@20 -0.0117419995367527 4488.2626953125 1123.073 4488.27490234375 1123.07592773438 4 21 1.1.1.4567.6 1 60.2474 457.9372 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(N)@17 missed K-I@20; missed K-L@40 -0.0235453993082047 5514.796875 920.1401 5514.8203125 920.14404296875 6 33 1.1.1.4588.3 1 60.7628 4145.799 60.7804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 LSSPATLNSR -0.000722002005204558 1044.5556640625 523.2851 1044.55639648438 523.285461425781 2 12 1.1.1.3133.5 1 26.1632 32930.03 26.3477 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00767495017498732 1773.8974609375 887.956 1773.88977050781 887.9521484375 2 25 1.1.1.4116.9 1 49.324 1131.72 49.239 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 SQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAK Carbamidomethyl(C)@10; MDA adduct +54(K)@12 cleaved N-S@N-term; missed K-S@12; missed R-I@14; missed R-L@18 -0.0337664000689983 4420.1796875 885.0432 4420.21337890625 885.049987792969 5 17 1.1.1.4042.13 1 47.5321 493.5445 47.519 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 SSPATLNSR cleaved L-S@N-term -0.00136198999825865 931.470886230469 466.7427 931.472290039063 466.743438720703 2 11 1.1.1.2838.2 1 19.6753 3791.228 19.594 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 TLDNDIMLIKLSSPATLNSR Methyl(K)@10 cleaved N-T@N-term; missed K-L@10 0.00633620982989669 2215.19482421875 739.4055 2215.18823242188 739.4033203125 3 16 1.1.1.4290.7 1 53.587 1217.476 53.655 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 VLEGNEQFINAAK cleaved D-V@N-term 0.00880069006234407 1431.74462890625 716.8796 1431.73583984375 716.875183105469 2 19 1.1.1.3663.11 1 38.4051 602.707 38.4357 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 2 99.0000009536743 YVNWIQQTIAAN cleaved N-Y@N-term 0.00582766998559237 1419.72045898438 710.8675 1419.71472167969 710.864624023438 2 18 1.1.1.4322.4 1 54.3984 3114.961 54.3418 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 1.85387206077576 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00551711022853851 1565.73767089844 783.8761 1565.73217773438 783.873352050781 2 19 1.1.1.3752.6 1 40.4463 1304.508 40.3326 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 1.79588079452515 99.0000009536743 IITHPNFNGNTLDNDIML cleaved L-I@C-term 0.0181693006306887 2041.01147460938 1021.513 2040.99389648438 1021.50421142578 2 13 1.1.1.4274.8 1 53.1988 872.0648 53.2592 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 1.76955056190491 99.0000009536743 LGEHNIDVLEG cleaved G-N@C-term 0.00258893007412553 1194.59069824219 598.3026 1194.58801269531 598.301330566406 2 10 1.1.1.3789.8 1 41.3231 964.7341 41.214 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 1.74472737312317 99.0000009536743 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term 0.0236763004213572 3807.826171875 952.9638 3807.80249023438 952.957885742188 4 16 1.1.1.4199.10 1 51.3773 10344.41 51.2839 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 1.65757703781128 99.0000009536743 TLDNDIMLIK cleaved N-T@N-term -0.000118550000479445 1174.62670898438 588.3206 1174.62670898438 588.320678710938 2 14 1.1.1.4063.2 1 48.042 726.0189 48.0373 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 1.63827216625214 99.0000009536743 LGEHNIDVLEGNEQFINA cleaved A-A@C-term 0.0137702999636531 2010.9794921875 1006.497 2010.96472167969 1006.48962402344 2 10 1.1.1.4152.18 1 50.2197 2214.955 50.3027 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 1.61978900432587 99.0000009536743 SPATLNSR cleaved S-S@N-term -0.000580672000069171 844.439697265625 423.2271 844.440307617188 423.227416992188 2 10 1.1.1.2804.2 1 18.9867 1126.917 18.9592 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 1.13667702674866 99.0000009536743 VNWIQQTIAAN cleaved Y-V@N-term 0.00131552002858371 1256.65270996094 629.3336 1256.6513671875 629.332946777344 2 9 1.1.1.4195.8 1 51.268 341.2182 51.3824 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.917214632034302 99.0000009536743 FNGNTLDNDIMLIK cleaved N-F@N-term 0.0211989991366863 1606.82373046875 804.4191 1606.80249023438 804.408508300781 2 11 1.1.1.4240.7 1 52.3804 78.6406 52.3709 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.899629473686218 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000468239013571292 823.492065429688 412.7533 823.491577148438 412.753082275391 2 9 1.1.1.3422.2 1 32.7597 16763.43 32.5175 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.899629473686218 99.0000009536743 VLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@13 cleaved D-V@N-term; missed K-I@13; missed K-L@33 0.0220801997929811 4778.4921875 956.7057 4778.47021484375 956.701293945313 5 14 1.1.1.4574.6 1 60.4172 1429.126 60.4324 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.508638322353363 99.0000009536743 NKPGVYTK Delta:H(4)C(2)@N-term 0.00144642998930067 933.529846191406 467.7722 933.528381347656 467.771453857422 2 11 1.1.1.2718.2 1 17.1695 377.6996 17.2088 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.476253539323807 99.0000009536743 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.0440203994512558 5006.62353515625 1002.332 5006.5810546875 1002.32348632813 5 12 1.1.1.4706.5 1 63.6558 425.7857 63.635 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.37675067782402 99.0000009536743 LSSPATLNSRVATVSLPR missed R-V@10 -11.0382995605469 1857.009765625 465.2597 1868.04797363281 468.019256591797 4 12 1.1.1.3335.7 1 30.7116 1163.956 30.6953 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.369572132825851 99.0000009536743 KPGVYTKVCNYVNWIQQTIAAN acrolein addition +56(K)@1; acrolein addition +76(K)@7; Carbamidomethyl(C)@9; Deamidated(N)@10 cleaved N-K@N-term; missed K-V@7 -0.00286776991561055 2699.3388671875 900.7869 2699.341796875 900.787841796875 3 17 1.1.1.4588.2 1 60.7603 255.3857 60.7804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.35852587223053 96.9799995422363 NYVNWIQQTIAAN cleaved C-N@N-term 0.00725898006930947 1533.76489257813 767.8897 1533.75756835938 767.886047363281 2 7 1.1.1.4431.2 1 57.1017 98.2703 57.0722 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.24949161708355 98.9499986171722 EQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@28 cleaved N-E@N-term; missed K-I@8; missed K-L@28 0.0236152000725269 4266.23486328125 854.2542 4266.21044921875 854.249389648438 5 12 1.1.1.4469.5 1 58.0459 2281.363 58.0351 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.130768269300461 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Delta:H(4)C(2)(K)@20 cleaved H-P@C-term; missed K-I@20 -0.00340966996736825 2702.3994140625 676.6071 2702.40283203125 676.607971191406 4 18 1.1.1.4293.4 1 53.6616 408.8598 53.6809 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0772745460271835 94.3400025367737 FINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@26 cleaved Q-F@N-term; missed K-I@6; missed K-L@26 0.0239195004105568 4009.13354492188 802.834 4009.10961914063 802.829162597656 5 11 1.1.1.4403.4 1 56.4152 705.5085 56.4051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0670191794633865 99.0000009536743 IKLSSPATLNSR Delta:H(4)C(2)(K)@2 cleaved L-I@N-term; missed K-L@2 0.000248552008997649 1313.76696777344 438.9296 1313.76672363281 438.929504394531 3 13 1.1.1.3367.8 1 31.4543 1444.654 31.49 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0506099946796894 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKS Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43 cleaved S-R@C-term; missed K-S@43 0.0524386018514633 4800.2666015625 1201.074 4800.2158203125 1201.06127929688 4 13 1.1.1.4241.8 1 52.4149 3339.314 52.4677 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0467236638069153 99.0000009536743 NTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@8; acrolein addition +76(K)@11 cleaved G-N@N-term; missed K-L@11 0.00772937014698982 2343.25122070313 782.091 2343.24340820313 782.088439941406 3 15 1.1.1.4326.7 1 54.5043 1229.747 54.5463 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0347982980310917 99.0000009536743 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term 0.000593941018451005 1290.62109375 646.3178 1290.62048339844 646.317504882813 2 12 1.1.1.3780.5 1 41.1135 2967.595 40.856 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0273344088345766 99.0000009536743 LIKLSSPATLNSR Delta:H(4)C(2)(K)@3 cleaved M-L@N-term; missed K-L@3 0.00028116098837927 1426.85107421875 476.6243 1426.85070800781 476.624206542969 3 19 1.1.1.3635.4 1 37.7405 2122.951 37.7456 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0150228748098016 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@19; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.0123308002948761 5527.81689453125 922.3101 5527.8046875 922.308044433594 6 16 1.1.1.4621.3 1 61.5584 1032.811 61.5304 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0136762224137783 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +76(K)@23; Deamidated(N)@31; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0538825988769531 5971.99951171875 996.3405 5972.05322265625 996.349426269531 6 21 1.1.1.4673.3 1 62.8317 192.0834 62.7641 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0136762224137783 99.0000009536743 RLGEHNIDVLEGNEQFINAAK cleaved V-R@N-term; missed R-L@1 -7.02304983139038 2359.17529296875 1180.595 2366.19775390625 1184.10620117188 2 13 1.1.1.4039.14 1 47.4649 337.076 47.47 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0101054366677999 96.1300015449524 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Trp->Hydroxykynurenin(W)@34; Carbamidomethyl(C)@41; HPNE addition +172(K)@43 missed K-S@43 0.00793683994561434 5094.41357421875 1019.89 5094.40625 1019.88854980469 5 12 1.1.1.4277.9 1 53.2751 807.9897 53.1863 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00833099242299795 99.0000009536743 SRIQVRLGEHNIDVLEGNEQFINAAK Glycerophospho(S)@1; Deamidated(Q)@4 missed R-I@2; missed R-L@6 -0.0135733000934124 3104.51611328125 1035.846 3104.529296875 1035.85034179688 3 13 1.1.1.4036.21 1 47.391 474.8038 47.47 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00788851175457239 40.200001001358 WIQQTIAAN cleaved N-W@N-term 0.00788875017315149 1043.5478515625 522.7812 1043.5400390625 522.777282714844 2 10 1.1.1.3726.6 1 39.829 565.7332 39.8341 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00700490176677704 99.0000009536743 PGVYTKVCNYVNWIQQTIAAN Octanoyl(T)@5; HPNE addition +172(K)@6; Carbamidomethyl(C)@8 cleaved K-P@N-term; missed K-V@6 -0.00317382998764515 2736.41650390625 913.1461 2736.41967773438 913.147155761719 3 16 1.1.1.4467.6 1 57.9929 443.8848 58.0351 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00612308504059911 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVATV cleaved V-S@C-term; missed K-I@20; missed K-L@40; missed R-V@50 1.94541001319885 5872.9716796875 979.8359 5871.0263671875 979.51171875 6 14 1.1.1.4608.10 1 61.2546 515.4923 61.2903 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00524305552244186 98.8300025463104 IQVRLGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@24; Delta:H(2)C(2)(H)@28 cleaved F-N@C-term; missed R-L@4; missed K-I@24 -0.026375399902463 3652.91015625 914.2348 3652.9365234375 914.241394042969 4 13 1.1.1.4398.11 1 56.2935 600.7887 56.2817 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.0048037082888186 86.4600002765656 IITHPNFNGNTLDNDIMLIKLS hexanoyl addition +98(K)@20 cleaved S-S@C-term; missed K-L@20 -0.0323334001004696 2580.32983398438 861.1172 2580.36206054688 861.127990722656 3 11 1.1.1.4237.10 1 52.3081 337.1184 52.3215 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00392634514719248 71.5699970722198 INAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; acrolein addition +38(K)@5 cleaved F-I@N-term; missed K-I@5; missed K-L@25 0.0561204999685287 3845.07080078125 770.0214 3845.0146484375 770.010192871094 5 11 1.1.1.4293.6 1 53.6633 2206.052 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00392634514719248 40.4700011014938 PNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@16 cleaved H-P@N-term; missed K-L@16 0.0329651981592178 2898.48754882813 967.1698 2898.45458984375 967.158813476563 3 9 1.1.1.4657.9 1 62.4424 183.6762 62.3987 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00305075151845813 30.6300014257431 AAGTECLISGWGNTKSSGSSYPSLLQCLKAPVLSDSSCKSSYPGQITGN Carbamidomethyl(C)@6; Carbamidomethyl(C)@27; acrolein addition +76(K)@29; Carbamidomethyl(C)@38; acrolein addition +94(K)@39 cleaved A-A@N-term; cleaved N-M@C-term; missed K-S@15; missed K-A@29; missed K-S@39 -0.0149373998865485 5290.4736328125 1059.102 5290.48974609375 1059.10522460938 5 10 1.1.1.4443.5 1 57.4099 862.8345 57.2464 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00305075151845813 36.3099992275238 NFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@15 cleaved P-N@N-term; missed K-L@15 -0.00307188997976482 2919.498046875 974.1733 2919.50122070313 974.17431640625 3 9 1.1.1.4645.6 1 62.1464 226.3969 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00261361571028829 99.0000009536743 AAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@3; Dethiomethyl(M)@20; MDA adduct +62(K)@23 cleaved N-A@N-term; missed K-I@3; missed K-L@23 -0.0612547993659973 3648.865234375 913.2236 3648.92651367188 913.238891601563 4 15 1.1.1.4352.16 1 55.1581 692.0209 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00261361571028829 29.6200007200241 LGEHNIDVLEGNEQFINAAKIITHP acrolein addition +112(K)@20 cleaved P-N@C-term; missed K-I@20 0.000835323997307569 2883.47729492188 962.1664 2883.4765625 962.166137695313 3 9 1.1.1.4639.8 1 61.9984 178.5522 62.0118 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00217691925354302 21.6700002551079 IQVRLGEHNID cleaved D-V@C-term; missed R-L@4 0.00449622981250286 1292.68823242188 647.3514 1292.68371582031 647.34912109375 2 7 1.1.1.3516.16 1 35.0244 217.8824 35.0337 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.00217691925354302 98.1400012969971 SSGSSYPSLLQCLK Phospho(S)@8; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +38(K)@14 0.0182984992861748 1644.72912597656 823.3718 1644.71069335938 823.362609863281 2 12 1.1.1.4566.4 1 60.2214 1112.571 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.000869458774104714 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAK Carbamidomethyl@N-term; Oxidation(R)@3 cleaved I-Q@N-term; missed R-L@3 0.00445985002443194 2666.345703125 889.7892 2666.34130859375 889.787719726563 3 11 1.1.1.4046.17 1 47.6337 219.0907 47.5929 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.000434511806815863 55.0100028514862 IQVRLGEHNIDVLEGNEQFINAAKIITHPN acrolein addition +112(K)@24; reduced HNE(H)@28; Deamidated(N)@30 cleaved N-F@C-term; missed R-L@4; missed K-I@24 -0.0362714007496834 3652.91015625 914.2348 3652.94653320313 914.243896484375 4 11 1.1.1.4398.11 1 56.2935 600.7887 56.2817 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.000434511806815863 61.2100005149841 LGEHNIDVLEGNEQFINAAKIITHPNFNGNT hexanoyl addition +98(K)@20; reduced HNE(H)@24 cleaved T-L@C-term; missed K-I@20 -0.060546699911356 3674.83422851563 919.7158 3674.89453125 919.730895996094 4 11 1.1.1.4425.7 1 56.9595 1403.422 57.0213 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.000434511806815863 96.5799987316132 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDND Formyl(K)@20 cleaved D-I@C-term; missed K-I@20 0.0445153005421162 3903.91088867188 976.985 3903.86645507813 976.973876953125 4 13 1.1.1.4397.11 1 56.2683 1297.52 56.3069 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.000434511806815863 16.9300004839897 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKL MDA adduct +54(K)@20; Deamidated(N)@34; acrolein addition +76(K)@40 cleaved L-S@C-term; missed K-I@20; missed K-L@40 -0.0194068998098373 4718.3505859375 1180.595 4718.369140625 1180.59948730469 4 10 1.1.1.4039.14 1 47.4649 337.076 47.47 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0.000434511806815863 91.729998588562 VRLGEHNIDVLEGNEQFINAAK Carbamidomethyl@N-term cleaved Q-V@N-term; missed R-L@2 -0.0299529992043972 2522.2578125 841.7599 2522.28784179688 841.769836425781 3 12 1.1.1.4047.8 1 47.6516 1712.296 47.815 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 75.2799987792969 AAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@3; Deamidated(N)@17 cleaved N-A@N-term; missed K-I@3; missed K-L@23 -0.011867200024426 3635.88623046875 909.9788 3635.89819335938 909.981811523438 4 10 1.1.1.4347.8 1 55.0263 320.1893 55.0924 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 31.1500012874603 AAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@13; acrolein addition +56(K)@23 cleaved N-A@N-term; missed K-I@3; missed K-L@23 0.0212108008563519 3635.91967773438 728.1912 3635.89819335938 728.186889648438 5 10 1.1.1.4321.7 1 54.3754 927.9776 54.3418 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 80.9099972248077 AKIITHPNFNGNTLDNDIMLIK Carbamyl@N-term; acrolein addition +38(K)@2; Deamidated(N)@12 cleaved A-A@N-term; missed K-I@2 -0.00546453986316919 2563.30517578125 855.4423 2563.310546875 855.444091796875 3 12 1.1.1.4273.7 1 53.1729 421.4168 53.1863 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.00447130994871259 3634.94067382813 727.9954 3634.93579101563 727.994445800781 5 21 1.1.1.4290.6 1 53.5862 13595.71 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@10; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.00944758020341396 3634.92700195313 606.8284 3634.93579101563 606.829956054688 6 16 1.1.1.4294.3 1 53.6866 1287.731 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.4399974346161 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@2; Oxidation(M)@19; acrolein addition +56(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0221263002604246 3635.919921875 728.1913 3635.89819335938 728.186889648438 5 12 1.1.1.4333.3 1 54.6753 3789.876 54.7199 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0192414000630379 3634.95483398438 909.746 3634.93579101563 909.741271972656 4 28 1.1.1.4292.14 1 53.6441 12493.94 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.6100018024445 EQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@28 cleaved N-E@N-term; missed K-I@8; missed K-L@28 0.0236152000725269 4266.23486328125 854.2542 4266.21044921875 854.249389648438 5 12 1.1.1.4462.7 1 57.8731 2281.363 58.0351 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 22.7500006556511 EQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@28 cleaved N-E@N-term; missed K-I@8; missed K-L@28 0.0407544001936913 4266.25048828125 1067.57 4266.21044921875 1067.55993652344 4 10 1.1.1.4467.10 1 57.9995 1808.152 58.0351 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 0.00742125976830721 2662.36767578125 888.4632 2662.3603515625 888.460693359375 3 20 1.1.1.4446.6 1 57.4737 1371.935 57.4669 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 -0.00456993002444506 2661.375 666.351 2661.37963867188 666.352172851563 4 17 1.1.1.4392.5 1 56.1347 569.866 56.1787 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.0024377501104027 2661.3818359375 888.1346 2661.37963867188 888.1337890625 3 16 1.1.1.4408.10 1 56.5378 740.8558 56.3563 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 -0.00456993002444506 2661.375 666.351 2661.37963867188 666.352172851563 4 16 1.1.1.4393.2 1 56.1577 569.866 56.1787 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 0.00668885977938771 2662.3671875 888.463 2662.3603515625 888.460693359375 3 14 1.1.1.4429.8 1 57.0563 444.6886 57.0722 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 0.00837197992950678 2661.384765625 888.1355 2661.37622070313 888.132690429688 3 14 1.1.1.4401.3 1 56.3623 6426.826 56.1787 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@4; Dethiomethyl(M)@11; acrolein addition +76(K)@14 cleaved N-F@N-term; missed K-L@14 0.00742125976830721 2662.36767578125 888.4632 2662.3603515625 888.460693359375 3 13 1.1.1.4453.3 1 57.6422 1371.935 57.4669 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 92.2299981117249 FNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Dethiomethyl(M)@11; reduced acrolein addition +58(K)@14 cleaved N-F@N-term; missed K-L@14 -0.0101298997178674 2644.36059570313 882.4608 2644.37084960938 882.464233398438 3 12 1.1.1.4602.2 1 61.1083 484.9288 61.0738 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@19; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.00317574990913272 5527.80810546875 922.3086 5527.8046875 922.308044433594 6 19 1.1.1.4642.2 1 62.0672 678.6681 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.5199987888336 GGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@5; Glucuronyl(S)@20; Carbamidomethyl(C)@23; reduced HNE(H)@38; Carbamidomethyl(C)@39; acrolein addition +56(K)@41 cleaved V-G@N-term 0.0160495005548 4837.2265625 1210.314 4837.2099609375 1210.30969238281 4 14 1.1.1.4327.18 1 54.5387 46756.3 54.521 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 85.6299996376038 GGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@5; Hex(N)@17; Carbamidomethyl(C)@23; reduced HNE(H)@38; Carbamidomethyl(C)@39; acrolein addition +56(K)@41 cleaved V-G@N-term -0.0223833005875349 4823.20654296875 1206.809 4823.23046875 1206.81494140625 4 12 1.1.1.4298.20 1 53.8028 22777 53.7322 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 55.0100028514862 GGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@5; Oxidation(P)@11; Phospho(S)@20; Carbamidomethyl(C)@23; reduced HNE(H)@38; Carbamidomethyl(C)@39; acrolein addition +56(K)@41 cleaved V-G@N-term 0.100174002349377 4757.23876953125 952.4551 4757.13916015625 952.43505859375 5 13 1.1.1.4446.8 1 57.4762 494.7415 57.4426 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 31.1500012874603 GGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@5; Hex(N)@17; Carbamidomethyl(C)@23; reduced HNE(H)@38; Carbamidomethyl(C)@39; acrolein addition +56(K)@41 cleaved V-G@N-term -0.0347082987427711 4823.19580078125 965.6464 4823.23046875 965.653381347656 5 11 1.1.1.4299.12 1 53.8217 6960.985 53.7322 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.1599998474121 GGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@5; Hex(N)@8; Carbamidomethyl(C)@23; reduced HNE(H)@38; Carbamidomethyl(C)@39; acrolein addition +56(K)@41 cleaved V-G@N-term -0.0347082987427711 4823.19580078125 965.6464 4823.23046875 965.653381347656 5 11 1.1.1.4292.16 1 53.6458 6960.985 53.7322 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 24.49000030756 GGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@5; Hex(N)@17; Carbamidomethyl(C)@23; reduced HNE(H)@38; Carbamidomethyl(C)@39; acrolein addition +56(K)@41 cleaved V-G@N-term -0.0347082987427711 4823.19580078125 965.6464 4823.23046875 965.653381347656 5 11 1.1.1.4306.10 1 53.9983 7285.297 53.7322 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term 0.00492264982312918 1345.69604492188 673.8553 1345.69116210938 673.852844238281 2 10 1.1.1.4113.7 1 49.2502 368.5166 49.239 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 33.3099991083145 GNTLDNDIMLIK cleaved N-G@N-term 0.00492264982312918 1345.69604492188 673.8553 1345.69116210938 673.852844238281 2 6 1.1.1.4108.4 1 49.1219 368.5166 49.239 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Oxidation(M)@9; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00056544499238953 2416.263671875 806.4285 2416.26318359375 806.428344726563 3 29 1.1.1.4258.2 1 52.8085 2005.803 52.9208 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Oxidation(M)@9; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00056544499238953 2416.263671875 806.4285 2416.26318359375 806.428344726563 3 25 1.1.1.4265.4 1 52.9736 2005.803 52.9208 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00517314998432994 2400.2734375 801.0984 2400.26831054688 801.0966796875 3 23 1.1.1.4336.5 1 54.751 30992.02 54.5715 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00367219001054764 2401.255859375 801.4259 2401.25219726563 801.424682617188 3 24 1.1.1.4345.4 1 54.9725 4300.403 54.8677 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00367219001054764 2401.255859375 801.4259 2401.25219726563 801.424682617188 3 16 1.1.1.4357.5 1 55.2713 973.9772 55.339 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Oxidation(N)@6; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00477675022557378 2416.26782226563 806.4299 2416.26318359375 806.428344726563 3 18 1.1.1.4329.10 1 54.5821 2067.141 54.5463 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00367219001054764 2401.255859375 801.4259 2401.25219726563 801.424682617188 3 15 1.1.1.4364.7 1 55.4448 973.9772 55.339 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00517314998432994 2400.2734375 801.0984 2400.26831054688 801.0966796875 3 13 1.1.1.4322.7 1 54.4009 30992.02 54.5715 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Methyl(K)@12 cleaved N-G@N-term; missed K-L@12 0.00341973011381924 2386.25634765625 796.426 2386.25268554688 796.4248046875 3 14 1.1.1.4320.8 1 54.3511 2446.082 54.4692 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR cleaved N-G@N-term; missed K-L@12 0.00459669018164277 2372.24169921875 791.7545 2372.23706054688 791.7529296875 3 11 1.1.1.4315.5 1 54.224 465.7303 54.2675 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12; Deamidated(N)@20 cleaved N-G@N-term; missed K-L@12 0.0212833993136883 2401.2734375 1201.644 2401.25219726563 1201.63342285156 2 14 1.1.1.4338.12 1 54.8132 1396.23 54.8677 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.0199992656708 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 -0.00658140983432531 2401.24560546875 801.4225 2401.25219726563 801.424682617188 3 13 1.1.1.4371.5 1 55.617 413.0189 55.5589 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 38.2999986410141 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.00422149011865258 2401.25634765625 801.4261 2401.25219726563 801.424682617188 3 10 1.1.1.4287.10 1 53.5146 2324.169 53.6293 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 83.8599979877472 IDVLEGNEQFINAAK cleaved N-I@N-term 0.00547013990581036 1659.85229492188 830.9334 1659.84680175781 830.9306640625 2 9 1.1.1.4050.9 1 47.7291 851.0997 47.8398 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGN cleaved N-T@C-term 0.00170153996441513 1125.55847167969 563.7865 1125.55676269531 563.78564453125 2 13 1.1.1.3312.5 1 30.1603 494.3202 30.0735 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.000629831978585571 2298.16723632813 767.063 2298.16772460938 767.063232421875 3 17 1.1.1.4159.14 1 50.3924 3109.963 50.5051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 -0.000629831978585571 2298.16723632813 767.063 2298.16772460938 767.063232421875 3 22 1.1.1.4166.13 1 50.5695 3109.963 50.5051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17; Methyl(K)@20 1.99668993445812E-05 2312.18359375 771.7351 2312.18334960938 771.735107421875 3 24 1.1.1.4169.6 1 50.6431 1423.873 50.7047 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 6.60060031805187E-05 2299.15161132813 767.3912 2299.15185546875 767.391235351563 3 19 1.1.1.4210.10 1 51.6373 913.9185 51.7248 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 6.60060031805187E-05 2299.15161132813 767.3912 2299.15185546875 767.391235351563 3 23 1.1.1.4217.7 1 51.8142 913.9185 51.7248 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17; Methyl(K)@20 0.0047440598718822 2313.17236328125 772.0647 2313.16748046875 772.063110351563 3 21 1.1.1.4220.4 1 51.8872 454.2926 51.899 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.0076096598058939 2298.17529296875 767.0657 2298.16772460938 767.063232421875 3 20 1.1.1.4235.10 1 52.258 1435.708 52.3462 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.0198352001607418 2282.193359375 1142.104 2282.1728515625 1142.09375 2 16 1.1.1.4235.17 1 52.2672 3741.687 52.3215 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.0076096598058939 2298.17529296875 767.0657 2298.16772460938 767.063232421875 3 16 1.1.1.4240.6 1 52.3788 1435.708 52.3462 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.00490105990320444 2282.177734375 761.7332 2282.1728515625 761.731567382813 3 30 1.1.1.4242.3 1 52.4329 19265.31 52.3462 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.0076096598058939 2298.17529296875 767.0657 2298.16772460938 767.063232421875 3 24 1.1.1.4243.3 1 52.4568 1435.708 52.3462 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Methyl(K)@20 0.00536681991070509 2296.19409179688 766.4053 2296.1884765625 766.403442382813 3 30 1.1.1.4247.3 1 52.5494 12556.78 52.6106 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17; Methyl(K)@20 0.00386506994254887 2312.18725585938 771.7364 2312.18334960938 771.735107421875 3 22 1.1.1.4249.2 1 52.5938 716.2473 52.6106 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Methyl(K)@20 0.00105958001222461 2296.18969726563 575.0547 2296.1884765625 575.054443359375 4 21 1.1.1.4250.2 1 52.6177 1708.667 52.6106 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Methyl(K)@20 0.00536681991070509 2296.19409179688 766.4053 2296.1884765625 766.403442382813 3 27 1.1.1.4254.2 1 52.7121 12556.78 52.6106 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.00248412997461855 2283.15942382813 762.0604 2283.15698242188 762.0595703125 3 27 1.1.1.4261.4 1 52.8876 2219.262 52.9208 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0030334300827235 2283.15991210938 762.0606 2283.15698242188 762.0595703125 3 29 1.1.1.4272.5 1 53.1435 8656.433 53.1863 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Methyl(K)@20 0.00349923991598189 2297.17602539063 766.7326 2297.17260742188 766.7314453125 3 21 1.1.1.4272.6 1 53.1444 988.8459 53.1376 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Methyl(K)@20 0.00533023988828063 2297.177734375 766.7332 2297.17260742188 766.7314453125 3 19 1.1.1.4279.5 1 53.3138 2827.146 53.4055 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Dethiomethyl(M)@17; MDA adduct +62(K)@20 0.00870107021182776 2297.177734375 766.7332 2297.16918945313 766.730346679688 3 13 1.1.1.4287.7 1 53.5121 2827.146 53.4055 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14 0.00830669980496168 2284.1494140625 762.3904 2284.14086914063 762.387573242188 3 13 1.1.1.4218.7 1 51.834 207.8299 51.7995 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Dethiomethyl(M)@17; MDA adduct +62(K)@20 0.0198765993118286 2296.20532226563 1149.11 2296.18530273438 1149.09985351563 2 12 1.1.1.4253.3 1 52.6949 2114.937 52.6106 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 19.3800002336502 IITHPNFNGNTLDNDIMLIK Carbamidomethyl@N-term; reduced HNE(H)@4 -0.00218483991920948 2497.32275390625 833.4482 2497.32495117188 833.448974609375 3 9 1.1.1.4237.9 1 52.3064 201.5231 52.3215 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATL Methyl(K)@20 cleaved L-N@C-term; missed K-L@20 -0.013387200422585 2965.544921875 989.5222 2965.55834960938 989.526733398438 3 14 1.1.1.4555.2 1 59.9495 175.9576 59.9663 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17 missed K-L@20 0.0044403001666069 3324.71826171875 832.1868 3324.71362304688 832.185668945313 4 15 1.1.1.4298.11 1 53.7953 317.2114 53.8342 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.000828463002108037 3338.73022460938 835.6898 3338.72924804688 835.689575195313 4 23 1.1.1.4301.8 1 53.8693 2673.075 54.0638 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 -0.000148071005241945 3338.72924804688 835.6896 3338.72924804688 835.689575195313 4 20 1.1.1.4307.13 1 54.0265 4189.878 54.1916 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 -0.000148071005241945 3338.72924804688 835.6896 3338.72924804688 835.689575195313 4 25 1.1.1.4311.9 1 54.1255 4189.878 54.1916 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00522417016327381 3352.73974609375 839.1922 3352.74487304688 839.193481445313 4 31 1.1.1.4313.6 1 54.1741 5110.826 54.2424 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 -0.000148071005241945 3338.72924804688 835.6896 3338.72924804688 835.689575195313 4 36 1.1.1.4315.8 1 54.2265 4189.878 54.1916 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00522417016327381 3352.73974609375 839.1922 3352.74487304688 839.193481445313 4 22 1.1.1.4323.8 1 54.4276 5110.826 54.2424 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 -0.00751896994188428 3324.69506835938 832.181 3324.70239257813 832.182861328125 4 24 1.1.1.4333.7 1 54.6803 291.3405 54.646 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00473786005750299 3338.72290039063 835.688 3338.71801757813 835.686767578125 4 21 1.1.1.4334.4 1 54.7015 669.9874 54.7199 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.00178018002770841 3308.72045898438 828.1874 3308.71875 828.186950683594 4 18 1.1.1.4344.6 1 54.9492 12219.97 55.0673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.00658390996977687 3308.72631835938 1103.916 3308.71875 1103.91357421875 3 16 1.1.1.4346.15 1 55.0068 2429.324 55.0673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.0157079994678497 3308.703125 662.7479 3308.71875 662.751037597656 5 22 1.1.1.4348.4 1 55.048 1066.109 55.0673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.0157079994678497 3308.703125 662.7479 3308.71875 662.751037597656 5 24 1.1.1.4349.3 1 55.0723 1066.109 55.0673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.0157079994678497 3308.703125 662.7479 3308.71875 662.751037597656 5 20 1.1.1.4350.4 1 55.0981 1066.109 55.0673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 0.00874350965023041 3322.7421875 1108.588 3322.734375 1108.58544921875 3 19 1.1.1.4350.13 1 55.1056 16286.39 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.0147737003862858 3322.7197265625 665.5512 3322.734375 665.554138183594 5 28 1.1.1.4351.3 1 55.1223 7238.283 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.00178018002770841 3308.72045898438 828.1874 3308.71875 828.186950683594 4 34 1.1.1.4351.10 1 55.1281 12219.97 55.0673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.00178018002770841 3308.72045898438 828.1874 3308.71875 828.186950683594 4 21 1.1.1.4352.8 1 55.1514 12219.97 55.0673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.00178018002770841 3308.72045898438 828.1874 3308.71875 828.186950683594 4 17 1.1.1.4352.9 1 55.1523 12219.97 55.0673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00256468006409705 3322.73168945313 831.6902 3322.734375 831.690856933594 4 35 1.1.1.4352.10 1 55.1531 77311.04 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.01319620013237 3337.74731445313 835.4441 3337.73413085938 835.440795898438 4 24 1.1.1.4352.11 1 55.1539 32163.85 55.3638 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00256468006409705 3322.73168945313 831.6902 3322.734375 831.690856933594 4 36 1.1.1.4353.7 1 55.1753 77311.04 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20 missed K-L@20 0.0316736996173859 3336.74536132813 835.1936 3336.71362304688 835.185668945313 4 19 1.1.1.4353.10 1 55.1778 58572.31 55.3638 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.0222407002002001 3340.71923828125 836.1871 3340.697265625 836.181579589844 4 21 1.1.1.4353.11 1 55.1787 1660.815 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00256468006409705 3322.73168945313 831.6902 3322.734375 831.690856933594 4 35 1.1.1.4354.6 1 55.199 77311.04 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0190265998244286 3336.73120117188 668.3535 3336.75 668.357299804688 5 27 1.1.1.4355.2 1 55.2207 7055.352 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00256468006409705 3322.73168945313 831.6902 3322.734375 831.690856933594 4 37 1.1.1.4355.4 1 55.224 77311.04 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00389510998502374 3353.73291015625 839.4405 3353.72900390625 839.439514160156 4 27 1.1.1.4355.5 1 55.2257 2584.245 55.3142 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.0147737003862858 3322.7197265625 665.5512 3322.734375 665.554138183594 5 28 1.1.1.4356.2 1 55.2451 7238.283 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0184163004159927 3336.7314453125 668.3536 3336.75 668.357299804688 5 28 1.1.1.4357.2 1 55.2688 7078.06 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00256468006409705 3322.73168945313 831.6902 3322.734375 831.690856933594 4 33 1.1.1.4357.8 1 55.2738 77311.04 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0305658001452684 3324.73291015625 832.1905 3324.70239257813 832.182861328125 4 24 1.1.1.4357.9 1 55.2746 16403.35 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.0147737003862858 3322.7197265625 665.5512 3322.734375 665.554138183594 5 26 1.1.1.4358.2 1 55.2933 7238.283 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0184163004159927 3336.7314453125 668.3536 3336.75 668.357299804688 5 28 1.1.1.4358.3 1 55.2941 7078.06 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.0147737003862858 3322.7197265625 665.5512 3322.734375 665.554138183594 5 24 1.1.1.4359.4 1 55.3197 7238.283 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00959447026252747 3336.74047851563 835.1924 3336.75 835.194763183594 4 34 1.1.1.4359.10 1 55.3247 62002.09 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.0147737003862858 3322.7197265625 665.5512 3322.734375 665.554138183594 5 20 1.1.1.4360.3 1 55.3437 7238.283 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0144169004634023 3337.74853515625 835.4444 3337.73413085938 835.440795898438 4 22 1.1.1.4363.6 1 55.4219 34748.23 55.437 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0162102002650499 3352.72900390625 839.1895 3352.74487304688 839.193481445313 4 32 1.1.1.4363.7 1 55.4236 2856.341 55.339 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0184163004159927 3336.7314453125 668.3536 3336.75 668.357299804688 5 28 1.1.1.4364.2 1 55.4406 7078.06 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00505555979907513 3308.7138671875 828.1857 3308.71875 828.186950683594 4 15 1.1.1.4364.8 1 55.4456 582.243 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00476187979802489 3322.72973632813 831.6897 3322.734375 831.690856933594 4 30 1.1.1.4364.9 1 55.4465 5900.142 55.437 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.025194900110364 3324.72729492188 832.1891 3324.70239257813 832.182861328125 4 22 1.1.1.4364.10 1 55.4473 1790.517 55.437 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00959447026252747 3336.74047851563 835.1924 3336.75 835.194763183594 4 20 1.1.1.4364.11 1 55.4481 62002.09 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Glycerophospho(S)@22 missed K-L@20 0.0599943995475769 3616.88134765625 905.2276 3616.8212890625 905.212585449219 4 20 1.1.1.4365.5 1 55.4674 1000.755 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00959447026252747 3336.74047851563 835.1924 3336.75 835.194763183594 4 36 1.1.1.4366.2 1 55.49 62002.09 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20; Deamidated(N)@28 missed K-L@20 -0.00199015997350216 3323.71655273438 831.9364 3323.71826171875 831.936889648438 4 29 1.1.1.4371.6 1 55.6187 5197.612 55.5833 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10 missed K-L@20 -0.0105844000354409 3309.69213867188 828.4303 3309.70263671875 828.432983398438 4 14 1.1.1.4372.3 1 55.6365 795.1879 55.7298 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 -0.00242830999195576 3337.73168945313 835.4402 3337.73413085938 835.440795898438 4 26 1.1.1.4373.2 1 55.6615 4942.582 55.7052 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 0.0105039998888969 3337.7451171875 1113.589 3337.73413085938 1113.58532714844 3 20 1.1.1.4373.6 1 55.6723 1213.426 55.7542 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00242830999195576 3337.73168945313 835.4402 3337.73413085938 835.440795898438 4 22 1.1.1.4380.2 1 55.8316 4942.582 55.7052 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00451620994135737 3319.71899414063 830.937 3319.72338867188 830.938171386719 4 27 1.1.1.4385.5 1 55.9592 2128.858 55.9526 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00910620018839836 3336.74096679688 835.1925 3336.75 835.194763183594 4 30 1.1.1.4387.3 1 56.0076 2935.695 55.9526 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.0155440997332335 3323.703125 665.7479 3323.71826171875 665.7509765625 5 20 1.1.1.4389.3 1 56.0573 801.9888 56.0524 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Methyl(K)@20 missed K-L@20 -0.00101362995337695 3323.71728515625 831.9366 3323.71826171875 831.936889648438 4 31 1.1.1.4390.6 1 56.0887 6827.363 56.0774 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0105039998888969 3337.7451171875 1113.589 3337.73413085938 1113.58532714844 3 19 1.1.1.4393.14 1 56.1678 2712.775 56.2302 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8 missed K-L@20 0.00284292991273105 3309.70581054688 828.4337 3309.70263671875 828.432983398438 4 26 1.1.1.4395.5 1 56.2118 4444.812 56.256 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8 missed K-L@20 0.0138745000585914 3309.71606445313 1104.246 3309.70263671875 1104.24157714844 3 18 1.1.1.4396.15 1 56.2459 1161.578 56.256 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.01613499969244 3337.71752929688 668.5508 3337.73413085938 668.554077148438 5 22 1.1.1.4397.2 1 56.2608 1206.121 56.2041 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.000475239008665085 3337.73364257813 835.4407 3337.73413085938 835.440795898438 4 28 1.1.1.4397.4 1 56.2625 10108.23 56.2041 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.000475239008665085 3337.73364257813 835.4407 3337.73413085938 835.440795898438 4 22 1.1.1.4399.2 1 56.3108 10108.23 56.2041 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00882590003311634 3323.70971679688 831.9347 3323.71826171875 831.936889648438 4 22 1.1.1.4400.5 1 56.3379 23716.91 56.4051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00882590003311634 3323.70971679688 831.9347 3323.71826171875 831.936889648438 4 35 1.1.1.4400.6 1 56.3387 23716.91 56.4051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00145176996011287 3337.73266601563 835.4404 3337.73413085938 835.440795898438 4 37 1.1.1.4406.4 1 56.4835 19803.78 56.552 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00882590003311634 3323.70971679688 831.9347 3323.71826171875 831.936889648438 4 29 1.1.1.4407.6 1 56.5098 23716.91 56.4051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.01613499969244 3337.71752929688 668.5508 3337.73413085938 668.554077148438 5 29 1.1.1.4408.3 1 56.5319 2583.438 56.552 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0178238991647959 3324.71704101563 832.1865 3324.69897460938 832.182006835938 4 22 1.1.1.4408.6 1 56.5344 12004.17 56.3807 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00882590003311634 3323.70971679688 831.9347 3323.71826171875 831.936889648438 4 20 1.1.1.4409.3 1 56.5582 23716.91 56.4051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00145176996011287 3337.73266601563 835.4404 3337.73413085938 835.440795898438 4 21 1.1.1.4409.4 1 56.5598 19803.78 56.552 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00145176996011287 3337.73266601563 835.4404 3337.73413085938 835.440795898438 4 34 1.1.1.4413.4 1 56.656 19803.78 56.552 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.00712902983650565 3324.70922851563 832.1846 3324.70239257813 832.182861328125 4 29 1.1.1.4415.4 1 56.7079 6148.021 56.4538 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00882590003311634 3323.70971679688 831.9347 3323.71826171875 831.936889648438 4 29 1.1.1.4417.3 1 56.7572 929.0927 56.7988 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00145176996011287 3337.73266601563 835.4404 3337.73413085938 835.440795898438 4 28 1.1.1.4420.6 1 56.8305 17667.98 56.5766 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 -0.00784935988485813 3323.71044921875 831.9349 3323.71826171875 831.936889648438 4 30 1.1.1.4425.4 1 56.9545 1264.415 56.9963 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00706683984026313 3337.72705078125 835.439 3337.73413085938 835.440795898438 4 30 1.1.1.4427.5 1 57.0029 2731.684 57.0213 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00706683984026313 3337.72705078125 835.439 3337.73413085938 835.440795898438 4 23 1.1.1.4434.8 1 57.1811 2731.684 57.0213 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Arg-add@N-term; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0166209992021322 3492.86767578125 699.5808 3492.85107421875 699.577514648438 5 19 1.1.1.4283.3 1 53.4098 1425.325 53.4792 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 -0.00150189001578838 3323.71704101563 831.9365 3323.71826171875 831.936889648438 4 18 1.1.1.4305.6 1 53.9696 1381.948 54.0638 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Arg-add@N-term; Deamidated(N)@8; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 0.0278342999517918 3493.85986328125 874.4722 3493.83178710938 874.465209960938 4 19 1.1.1.4327.10 1 54.5321 1030.572 54.5715 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Methyl(K)@20 missed K-L@20 -0.00749523006379604 3305.70043945313 827.4324 3305.70776367188 827.434204101563 4 19 1.1.1.4381.7 1 55.8605 1920.994 55.7786 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00950818043202162 3337.724609375 835.4384 3337.73413085938 835.440795898438 4 18 1.1.1.4442.6 1 57.3806 852.2864 57.1227 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Cation:K(D)@15; Methyl(K)@20 missed K-L@20 0.0126898000016809 3361.68701171875 841.429 3361.67431640625 841.425842285156 4 19 1.1.1.4354.7 1 55.1998 183.7542 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Hex(N)@14; acrolein addition +76(K)@20 missed K-L@20 0.0500462017953396 3546.85327148438 710.3779 3546.802734375 710.367858886719 5 17 1.1.1.4359.5 1 55.3206 569.6262 55.3638 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0144530003890395 3324.71704101563 832.1865 3324.70239257813 832.182861328125 4 18 1.1.1.4408.7 1 56.5353 12004.17 56.3807 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.00186892994679511 3323.71704101563 831.9365 3323.71508789063 831.93603515625 4 16 1.1.1.4312.8 1 54.1501 1381.948 54.0638 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Hex(N)@14; MDA adduct +62(K)@20 missed K-L@20 0.0613091997802258 3532.8486328125 707.577 3532.787109375 707.564697265625 5 17 1.1.1.4353.3 1 55.172 568.5854 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0162102002650499 3352.72900390625 839.1895 3352.74487304688 839.193481445313 4 17 1.1.1.4359.12 1 55.3264 2856.341 55.339 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(M)@17 missed K-L@20 0.0293173007667065 3340.73779296875 836.1917 3340.70849609375 836.184387207031 4 16 1.1.1.4359.11 1 55.3256 2569.523 55.339 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Formyl(K)@20 missed K-L@20 0.0253884997218847 3353.71826171875 839.4368 3353.69262695313 839.430419921875 4 17 1.1.1.4406.5 1 56.4843 721.0148 56.5274 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Arg-add@N-term; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 0.0265269000083208 3492.87426757813 874.2258 3492.84765625 874.21923828125 4 17 1.1.1.4283.6 1 53.4123 2147.154 53.4792 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0046781599521637 3336.75537109375 1113.259 3336.75 1113.25732421875 3 16 1.1.1.4364.17 1 55.4531 17191.61 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 -0.00584146985784173 3352.7392578125 671.5551 3352.74487304688 671.556274414063 5 12 1.1.1.4311.5 1 54.1222 647.4022 54.2424 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0167004000395536 3338.73486328125 835.691 3338.71801757813 835.686767578125 4 15 1.1.1.4346.6 1 54.9993 4764.091 55.2165 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dicarbamidomethyl(D)@15; acrolein addition +112(K)@20 missed K-L@20 0.0677817985415459 3534.8818359375 884.7277 3534.81396484375 884.710815429688 4 16 1.1.1.4352.14 1 55.1564 400.1615 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0180002991110086 3319.70581054688 664.9484 3319.72338867188 664.951965332031 5 14 1.1.1.4384.4 1 55.9333 227.0316 55.9526 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@10; Methyl(K)@20 missed K-L@20 0.001269830041565 3324.70385742188 832.1832 3324.70239257813 832.182861328125 4 16 1.1.1.4433.3 1 57.1521 1132.018 56.9963 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR CHDH(D)@15 missed K-L@20 -0.0358474999666214 3602.8662109375 901.7238 3602.90185546875 901.732727050781 4 16 1.1.1.4352.15 1 55.1573 1334.888 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Glycerophospho(S)@22 missed K-L@20 0.0514498017728329 3616.873046875 905.2255 3616.8212890625 905.212585449219 4 16 1.1.1.4358.9 1 55.2991 1059.785 55.339 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0144530003890395 3324.71704101563 832.1865 3324.70239257813 832.182861328125 4 16 1.1.1.4398.8 1 56.291 12004.17 56.3807 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.00944255013018847 3323.72924804688 1108.917 3323.71826171875 1108.91345214844 3 15 1.1.1.4370.7 1 55.6001 1301.367 55.5833 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0305658001452684 3324.73291015625 832.1905 3324.70239257813 832.182861328125 4 18 1.1.1.4353.8 1 55.1762 16403.35 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.001269830041565 3324.70385742188 832.1832 3324.70239257813 832.182861328125 4 15 1.1.1.4428.9 1 57.0317 1132.018 56.9963 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0155795998871326 3363.76538085938 841.9486 3363.74975585938 841.944702148438 4 15 1.1.1.4590.5 1 60.8121 189.5994 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; CHDH(D)@15; Oxidation(M)@17 missed K-L@20 -0.0113600995391607 3619.86938476563 905.9746 3619.880859375 905.977478027344 4 15 1.1.1.4354.10 1 55.2023 553.7012 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Formyl(K)@20 missed K-L@20 0.0135837001726031 3352.72216796875 839.1878 3352.70849609375 839.184387207031 4 14 1.1.1.4374.6 1 55.6902 336.9842 55.7052 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0228017996996641 3352.72216796875 839.1878 3352.74487304688 839.193481445313 4 14 1.1.1.4395.7 1 56.2135 480.784 56.2302 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@14; GlnThrGlyGly(K)@20 missed K-L@20 0.0405535995960236 3634.8818359375 909.7277 3634.84130859375 909.717590332031 4 15 1.1.1.4364.14 1 55.4506 696.7476 55.4125 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@17; GlnThrGlyGly(K)@20 missed K-L@20 0.00142039998900145 3603.8662109375 901.9738 3603.86450195313 901.973388671875 4 14 1.1.1.4359.14 1 55.3281 1188.025 55.1921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; Deamidated(N)@28; Octanoyl(S)@29 missed K-L@20 0.00232205004431307 3547.86206054688 887.9728 3547.85961914063 887.97216796875 4 14 1.1.1.4360.9 1 55.3487 341.1253 55.3638 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 0.0156998001039028 3319.73583984375 830.9412 3319.71997070313 830.937316894531 4 14 1.1.1.4393.6 1 56.1611 635.7599 56.2302 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.00944255013018847 3323.72924804688 1108.917 3323.71826171875 1108.91345214844 3 12 1.1.1.4408.16 1 56.5428 6286.033 56.4051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.0179450996220112 3322.71655273438 831.6864 3322.734375 831.690856933594 4 13 1.1.1.4378.7 1 55.7866 2792.788 55.9526 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Formyl(K)@20 missed K-L@20 0.032956600189209 3353.72583007813 839.4387 3353.69262695313 839.430419921875 4 13 1.1.1.4392.7 1 56.1364 494.7729 56.2302 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.4399974346161 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dehydrated(D)@15 missed K-L@20 0.0158066004514694 3290.72412109375 823.6883 3290.70825195313 823.684326171875 4 12 1.1.1.4356.4 1 55.2501 375.1363 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@10; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 -0.000107147003291175 3338.71459960938 668.7502 3338.71459960938 668.750183105469 5 11 1.1.1.4428.4 1 57.0275 189.0301 57.0213 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.0039793998003006 3336.74609375 835.1938 3336.75 835.194763183594 4 11 1.1.1.4297.11 1 53.7698 229.7951 53.7832 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 94.6900010108948 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Met->Hcy(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 -0.00342889991588891 3353.72583007813 839.4387 3353.72900390625 839.439514160156 4 11 1.1.1.4347.6 1 55.0246 1315.921 55.1174 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 93.970000743866 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 -0.0081537701189518 3352.73706054688 839.1915 3352.74487304688 839.193481445313 4 10 1.1.1.4381.9 1 55.8622 322.1923 55.8033 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 84.8299980163574 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00700862007215619 3308.71166992188 828.1852 3308.71875 828.186950683594 4 13 1.1.1.4357.7 1 55.2729 857.7423 55.2652 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 84.8299980163574 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00700862007215619 3308.71166992188 828.1852 3308.71875 828.186950683594 4 13 1.1.1.4359.9 1 55.3239 857.7423 55.2652 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 52.6899993419647 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dehydrated(T)@11; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.028991499915719 3304.74926757813 827.1946 3304.72045898438 827.187377929688 4 12 1.1.1.4358.6 1 55.2966 317.7289 55.3881 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.0201917998492718 3308.69848632813 828.1819 3308.71875 828.186950683594 4 12 1.1.1.4382.8 1 55.8863 1055.106 55.7298 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.2100013494492 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(M)@17; MDA adduct +54(K)@20 missed K-L@20 0.00886602979153395 3394.72802734375 849.6893 3394.71899414063 849.687072753906 4 10 1.1.1.4353.13 1 55.1803 257.8926 55.1673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 31.1500012874603 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl@N-term; reduced HNE(H)@4; acrolein addition +112(K)@20 missed K-L@20 -0.00302582001313567 3635.919921875 728.1913 3635.92333984375 728.191955566406 5 10 1.1.1.4340.6 1 54.8502 3789.876 54.7199 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 20.2099993824959 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Methyl(K)@20 missed K-L@20 0.0171328000724316 3323.73510742188 1108.919 3323.71826171875 1108.91345214844 3 10 1.1.1.4385.12 1 55.9651 1632.808 56.0774 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IKLSSPATLNSR Delta:H(4)C(2)(K)@2 cleaved L-I@N-term; missed K-L@2 0.00114992004819214 1313.76782226563 657.8912 1313.76672363281 657.890625 2 18 1.1.1.3362.10 1 31.3415 1120.69 31.3465 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IKLSSPATLNSR Delta:H(4)C(2)(K)@2 cleaved L-I@N-term; missed K-L@2 0.00749729992821813 1313.77404785156 657.8943 1313.76672363281 657.890625 2 19 1.1.1.3370.5 1 31.5327 1291.686 31.5378 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IMLIKLSSPATLNSR Delta:H(4)C(2)(K)@5 cleaved D-I@N-term; missed K-L@5 0.00663521979004145 1670.98193359375 836.4982 1670.97534179688 836.494934082031 2 18 1.1.1.4060.16 1 47.9802 2080.457 48.0134 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IMLIKLSSPATLNSR MDA adduct +62(K)@5; Dehydrated(S)@7 cleaved D-I@N-term; missed K-L@5 0.0255842991173267 1686.97485351563 563.3322 1686.94909667969 563.323669433594 3 14 1.1.1.4062.3 1 48.0206 374.7771 48.0134 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.00773066002875566 2706.4013671875 677.6076 2706.40893554688 677.609497070313 4 26 1.1.1.4146.6 1 50.0634 17006.98 50.1529 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK Deamidated(N)@9 missed R-L@4 0.00944291986525059 2707.40209960938 677.8578 2707.39282226563 677.855529785156 4 22 1.1.1.4146.7 1 50.0651 7565.499 50.1529 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK Deamidated(N)@16; Deamidated(N)@21 missed R-L@4 0.0310108996927738 2708.408203125 678.1093 2708.376953125 678.101501464844 4 12 1.1.1.4153.12 1 50.2399 2593.237 50.1529 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 53.8399994373322 IQVRLGEHNIDVLEGNEQFINAAKII Deamidated(N)@16; Deamidated(N)@21; MDA adduct +62(K)@24 cleaved I-T@C-term; missed R-L@4; missed K-I@24 -0.0488982014358044 2996.51220703125 750.1353 2996.56079101563 750.1474609375 4 10 1.1.1.4148.7 1 50.1113 262.3409 50.1529 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@24; Oxidation(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 0.0158805996179581 6069.154296875 1012.533 6069.13818359375 1012.53033447266 6 19 1.1.1.4564.9 1 60.1771 2128.608 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@38; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00639765011146665 6054.13037109375 1010.029 6054.1240234375 1010.02795410156 6 21 1.1.1.4565.4 1 60.2037 384.333 60.16 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Met->Hcy(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00404960010200739 6069.13427734375 868.0264 6069.13818359375 868.027038574219 7 26 1.1.1.4568.10 1 60.268 1484.693 60.2575 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Met->Hcy(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0158805996179581 6069.154296875 1012.533 6069.13818359375 1012.53033447266 6 20 1.1.1.4571.8 1 60.3468 2128.608 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0408982001245022 6039.12255859375 863.7391 6039.1640625 863.744995117188 7 31 1.1.1.4582.3 1 60.6124 1996.35 60.6561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00677123991772532 6039.13671875 1007.53 6039.12744140625 1007.52856445313 6 34 1.1.1.4582.6 1 60.6174 2549.098 60.6561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0157469008117914 6053.1640625 1009.868 6053.1796875 1009.87054443359 6 36 1.1.1.4582.7 1 60.6191 26094.43 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.000755825021769851 6053.17822265625 1211.643 6053.1796875 1211.64318847656 5 23 1.1.1.4583.20 1 60.6502 9625.07 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0343127995729446 6053.14501953125 865.7423 6053.1796875 865.747253417969 7 35 1.1.1.4584.5 1 60.663 22908.22 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Deamidated(N)@32; Deamidated(N)@34; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0161830000579357 6089.11572265625 870.881 6089.1318359375 870.88330078125 7 21 1.1.1.4584.6 1 60.6638 211.9682 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dehydrated(T)@35; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0150333996862173 6069.1376953125 868.027 6069.1533203125 868.029174804688 7 26 1.1.1.4585.4 1 60.6894 1250.706 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0281576998531818 6035.10498046875 863.1651 6035.1328125 863.169067382813 7 17 1.1.1.4587.3 1 60.7357 861.2513 60.7558 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0244603995233774 6068.12939453125 867.8829 6068.154296875 867.886474609375 7 21 1.1.1.4587.4 1 60.7365 802.9981 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Formyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0570240989327431 6053.1640625 1009.868 6053.10693359375 1009.8583984375 6 28 1.1.1.4589.17 1 60.797 26094.43 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0343127995729446 6053.14501953125 865.7423 6053.1796875 865.747253417969 7 25 1.1.1.4591.7 1 60.8387 22908.22 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00646028015762568 6053.13427734375 1009.863 6053.14306640625 1009.86450195313 6 27 1.1.1.4610.6 1 61.3044 733.7891 61.3144 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; Delta:H(4)C(2)(H)@28; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0109454002231359 6054.1484375 1010.032 6054.16015625 1010.03399658203 6 23 1.1.1.4617.5 1 61.4775 924.271 61.4826 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dimethyl(N)@16; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.014241199940443 6054.1484375 1010.032 6054.16015625 1010.03399658203 6 23 1.1.1.4627.7 1 61.715 781.5768 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0124102002009749 6054.1484375 1010.032 6054.16015625 1010.03399658203 6 32 1.1.1.4634.4 1 61.886 875.1156 61.7708 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00672294991090894 6053.15234375 1009.866 6053.14306640625 1009.86450195313 6 24 1.1.1.4641.4 1 62.0549 750.4684 62.0118 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@32; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.000538436986971647 6054.12451171875 1010.028 6054.1240234375 1010.02795410156 6 24 1.1.1.4656.5 1 62.4146 505.1387 62.3987 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0243031997233629 6069.16015625 1012.534 6069.13818359375 1012.53033447266 6 17 1.1.1.4583.18 1 60.6485 1359.695 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0203758999705315 6053.12255859375 1009.861 6053.14306640625 1009.86450195313 6 14 1.1.1.4649.10 1 62.2435 529.6996 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR GlnThrGlyGly(K)@24; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0362615995109081 6369.2421875 910.899 6369.2783203125 910.904174804688 7 19 1.1.1.4583.8 1 60.6402 447.1796 60.6561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@28; Hex(N)@38; acrolein addition +112(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00994232017546892 6429.34375 919.4849 6429.35302734375 919.486267089844 7 17 1.1.1.4583.11 1 60.6427 1335.905 60.6814 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(P)@29; Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00995181966573 6042.13671875 1008.03 6042.12744140625 1008.02850341797 6 18 1.1.1.4587.11 1 60.7457 636.4667 60.6561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; reduced HNE(H)@28; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0981004014611244 6351.29638671875 908.3353 6351.39404296875 908.349304199219 7 16 1.1.1.4586.5 1 60.7126 324.6655 60.6561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0358471013605595 6054.12451171875 1010.028 6054.16015625 1010.03399658203 6 18 1.1.1.4664.13 1 62.6116 505.1387 62.3987 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@24; reduced HNE(H)@28; Cation:K(D)@39; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0356643982231617 6445.34228515625 1075.231 6445.3759765625 1075.23669433594 6 14 1.1.1.4568.17 1 60.2739 526.1691 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00880767032504082 6072.1484375 1013.032 6072.1376953125 1013.0302734375 6 14 1.1.1.4575.12 1 60.4473 443.4706 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0163410007953644 6025.12646484375 1005.195 6025.11181640625 1005.19262695313 6 14 1.1.1.4580.10 1 60.573 1234.797 60.6308 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; reduced HNE(H)@28; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0654041022062302 6351.32861328125 1059.562 6351.39404296875 1059.57299804688 6 13 1.1.1.4586.14 1 60.7226 264.1222 60.6814 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0598715990781784 6068.1640625 1012.368 6068.1064453125 1012.3583984375 6 13 1.1.1.4586.8 1 60.7151 1011.67 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; reduced HNE(H)@28; Phospho(T)@35; acrolein addition +112(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0223392006009817 6445.3173828125 921.7669 6445.33984375 921.770080566406 7 14 1.1.1.4571.4 1 60.3401 447.6656 60.2575 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0273196995258331 6011.10400390625 1002.858 6011.1328125 1002.86273193359 6 11 1.1.1.4583.17 1 60.6477 620.3488 60.606 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.4399974346161 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@24; Met->Hcy(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 -0.0132905999198556 6021.1064453125 1004.525 6021.1171875 1004.52679443359 6 13 1.1.1.4580.9 1 60.5714 270.5503 60.6814 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.4399974346161 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0256488993763924 6025.11865234375 1206.031 6025.14501953125 1206.03625488281 5 11 1.1.1.4584.16 1 60.6747 362.6096 60.6308 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.0199992656708 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Deamidated(N)@38; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0349965989589691 6061.138671875 1011.197 6061.1005859375 1011.19073486328 6 12 1.1.1.4585.7 1 60.6944 290.4202 60.6814 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00690486980602145 6071.146484375 1012.865 6071.15380859375 1012.86627197266 6 11 1.1.1.4583.19 1 60.6494 821.0014 60.6814 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 91.1899983882904 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.008225760422647 6090.1181640625 1016.027 6090.12744140625 1016.02850341797 6 11 1.1.1.4587.12 1 60.7474 239.82 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 84.8299980163574 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0036689699627459 6075.12353515625 868.8821 6075.12744140625 868.882629394531 7 14 1.1.1.4585.5 1 60.6911 550.6082 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 70.2899992465973 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; reduced HNE(H)@28; acrolein addition +94(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0913778021931648 6325.228515625 1055.212 6325.32080078125 1055.22741699219 6 11 1.1.1.4581.11 1 60.601 442.8764 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 70.2899992465973 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@28; Hex(N)@38; acrolein addition +112(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00228920998051763 6429.3525390625 1072.566 6429.35302734375 1072.56616210938 6 12 1.1.1.4584.14 1 60.6713 1450.926 60.6814 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 45.5900013446808 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0039118998683989 6036.1181640625 1208.231 6036.11669921875 1208.23059082031 5 13 1.1.1.4588.8 1 60.7753 510.9442 60.7558 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 39.7300004959106 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0363881997764111 6069.173828125 1214.842 6069.13818359375 1214.8349609375 5 10 1.1.1.4570.11 1 60.3267 575.1789 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.0500013828278 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0732705965638161 6105.06494140625 873.1594 6105.13818359375 873.169860839844 7 11 1.1.1.4584.7 1 60.6646 241.3725 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 21.8899995088577 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.022809399291873 6085.12646484375 1015.195 6085.1484375 1015.19866943359 6 9 1.1.1.4584.13 1 60.6696 526.5555 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 19.7200000286102 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.00491663021966815 6035.12841796875 1006.862 6035.1328125 1006.86273193359 6 11 1.1.1.4587.10 1 60.744 964.9744 60.7558 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 17.739999294281 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@24; Deamidated(N)@38; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.047486700117588 6108.08837890625 1019.022 6108.1376953125 1019.0302734375 6 8 1.1.1.4586.11 1 60.7176 278.2828 60.6814 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSG Carbamidomethyl(C)@7 cleaved G-S@C-term 0.0172035004943609 2170.05346679688 1086.034 2170.03637695313 1086.02551269531 2 10 1.1.1.4159.21 1 50.3982 1666.819 50.3027 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0278683993965387 4814.28271484375 1204.578 4814.2568359375 1204.57141113281 4 20 1.1.1.4278.8 1 53.3028 5165.061 53.1863 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; Carbamidomethyl(Y)@42; hexanoyl addition +98(K)@43 0.00206815009005368 4814.27001953125 963.8613 4814.26806640625 963.86083984375 5 26 1.1.1.4276.6 1 53.2441 15383.78 53.1863 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Dehydrated(S)@37; reduced HNE(H)@40; Carbamidomethyl(C)@41 -0.0228470005095005 4800.2548828125 961.0582 4800.27734375 961.062744140625 5 15 1.1.1.4247.5 1 52.5578 12789.81 52.4677 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Deamidated(Q)@33; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0192482993006706 4815.26025390625 964.0593 4815.24072265625 964.055419921875 5 14 1.1.1.4294.14 1 53.6958 4032.398 53.655 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Ser->Oxoalanine(S)@37; reduced HNE(H)@40; Carbamidomethyl(C)@41 -0.0384410992264748 4815.25 964.0573 4815.28857421875 964.06494140625 5 14 1.1.1.4260.4 1 52.8613 1192.469 52.8968 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Oxidation(P)@13; Deamidated(Q)@15; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0109786000102758 4830.2626953125 967.0598 4830.25146484375 967.0576171875 5 12 1.1.1.4276.7 1 53.2458 1107.462 53.1863 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 90.0200009346008 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Ammonia-loss(N)@31; reduced HNE(H)@40; Carbamidomethyl(C)@41 -0.00909905042499304 4800.2666015625 1201.074 4800.27734375 1201.07666015625 4 12 1.1.1.4248.3 1 52.5816 3339.314 52.4677 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 29.8099994659424 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 -0.00409896997734904 4814.25244140625 803.3827 4814.2568359375 803.383422851563 6 12 1.1.1.4272.8 1 53.146 1744.192 53.1863 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 29.1299998760223 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Dehydrated(S)@11; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.00649084011092782 4796.25244140625 960.2578 4796.24609375 960.256530761719 5 11 1.1.1.4269.11 1 53.0758 3621.314 53.0892 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKS Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43 cleaved S-R@C-term; missed K-S@43 0.0386907011270523 4800.2548828125 961.0582 4800.2158203125 961.050476074219 5 12 1.1.1.4240.11 1 52.3871 12789.81 52.4677 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 95.8700001239777 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKS Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; MDA adduct +54(K)@43 cleaved S-R@C-term; missed K-S@43 0.0524386018514633 4800.2666015625 1201.074 4800.2158203125 1201.06127929688 4 12 1.1.1.4248.3 1 52.5816 3339.314 52.4677 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.2899994850159 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKS Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; MDA adduct +54(K)@43 cleaved S-R@C-term; missed K-S@43 0.0400599017739296 4801.23974609375 961.2552 4801.19970703125 961.247253417969 5 11 1.1.1.4224.9 1 51.9933 539.6968 52.0479 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 KIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@1; Delta:H(2)C(2)(H)@5; Deamidated(N)@11 cleaved A-K@N-term; missed K-I@1; missed K-L@21 0.0124570000916719 3519.85205078125 880.9703 3519.83959960938 880.967163085938 4 15 1.1.1.4350.8 1 55.1014 184.5744 55.0673 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGN cleaved N-E@C-term 0.00792673043906689 1308.63891601563 655.3267 1308.63098144531 655.32275390625 2 15 1.1.1.3743.2 1 40.2209 1175.327 40.3326 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term 0.00340144010260701 1290.62390136719 646.3192 1290.62048339844 646.317504882813 2 13 1.1.1.3759.2 1 40.6125 1287.953 40.6414 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGN Deamidated(N)@12 cleaved N-E@C-term 0.00677883997559547 1309.62182617188 655.8182 1309.61499023438 655.814758300781 2 12 1.1.1.3804.11 1 41.6821 329.1778 41.6904 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 37.9900008440018 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term 0.000838070991449058 1290.62121582031 646.3179 1290.62048339844 646.317504882813 2 12 1.1.1.3773.7 1 40.9464 2850.455 40.8799 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.1699987649918 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term 0.000838070991449058 1290.62121582031 646.3179 1290.62048339844 646.317504882813 2 12 1.1.1.3766.7 1 40.7795 2850.455 40.8799 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00551711022853851 1565.73767089844 783.8761 1565.73217773438 783.873352050781 2 18 1.1.1.3744.8 1 40.2538 1304.508 40.3326 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.00551711022853851 1565.73767089844 783.8761 1565.73217773438 783.873352050781 2 18 1.1.1.3762.5 1 40.6805 485.1707 40.6651 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQ Delta:H(4)C(2)@N-term cleaved Q-F@C-term 1.17616000352427E-05 1593.76342773438 797.889 1593.76342773438 797.889038085938 2 19 1.1.1.3805.10 1 41.7092 388.0905 41.7142 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0116103002801538 1939.93933105469 970.9769 1939.92761230469 970.971069335938 2 19 1.1.1.4124.13 1 49.5233 16375.39 49.3622 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Delta:H(4)C(2)@N-term cleaved N-A@C-term 0.0138256000354886 1967.97290039063 984.9937 1967.95886230469 984.986694335938 2 18 1.1.1.4136.9 1 49.8262 524.8914 49.8808 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0114882001653314 1939.93908691406 970.9768 1939.92761230469 970.971069335938 2 15 1.1.1.4110.14 1 49.1832 16398.48 49.3622 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.00684966007247567 1939.93444824219 970.9745 1939.92761230469 970.971069335938 2 15 1.1.1.4144.16 1 50.0207 519.292 49.9303 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Deamidated(N)@17 cleaved N-A@C-term 0.000469822000013664 1940.91223144531 647.978 1940.91162109375 647.977783203125 3 15 1.1.1.4148.4 1 50.1088 541.1757 50.1281 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.995685994625092 1938.93188476563 970.4732 1939.92761230469 970.971069335938 2 15 1.1.1.4141.7 1 49.95 396.9228 49.8808 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0105117000639439 1939.93811035156 970.9763 1939.92761230469 970.971069335938 2 13 1.1.1.4135.11 1 49.7999 410.8338 49.7325 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.0101087996736169 1921.92712402344 961.9708 1921.9169921875 961.965759277344 2 15 1.1.1.4162.17 1 50.471 4052.345 50.4285 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term -0.00223842007108033 1939.92517089844 647.649 1939.92761230469 647.649780273438 3 13 1.1.1.4123.8 1 49.4969 3106.606 49.3622 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Deamidated(N)@17 cleaved N-A@C-term 0.0127964997664094 1940.92443847656 971.4695 1940.91162109375 971.463073730469 2 11 1.1.1.4155.15 1 50.2926 2563.639 50.1281 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0105117000639439 1939.93811035156 970.9763 1939.92761230469 970.971069335938 2 10 1.1.1.4131.11 1 49.7027 410.8338 49.7325 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.0101087996736169 1921.92712402344 961.9708 1921.9169921875 961.965759277344 2 11 1.1.1.4155.14 1 50.2918 4052.345 50.4285 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 75.2799987792969 LGEHNIDVLEGNEQFINA cleaved A-A@C-term 0.0137702999636531 2010.9794921875 1006.497 2010.96472167969 1006.48962402344 2 8 1.1.1.4159.19 1 50.3965 2214.955 50.3027 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.0199992656708 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.00650729984045029 2082.00830078125 695.0101 2082.00170898438 695.007873535156 3 10 1.1.1.4159.9 1 50.3882 1183.719 50.5051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.00150195998139679 2211.07934570313 1106.547 2211.08081054688 1106.54760742188 2 12 1.1.1.4016.20 1 46.8914 1743.302 47.0223 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.0108410995453596 2211.06982421875 738.0306 2211.08081054688 738.0341796875 3 20 1.1.1.4020.12 1 46.9847 5195.066 47.0223 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.0108410995453596 2211.06982421875 738.0306 2211.08081054688 738.0341796875 3 24 1.1.1.4023.11 1 47.0591 5195.066 47.0223 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 -0.0112073002383113 2211.06982421875 738.0305 2211.08081054688 738.0341796875 3 21 1.1.1.4031.5 1 47.2556 5369.279 46.9972 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000375773990526795 2210.09741210938 1106.056 2210.0966796875 1106.0556640625 2 24 1.1.1.4038.21 1 47.4403 52059.45 47.4945 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.0174681004136801 2211.09814453125 738.04 2211.08081054688 738.0341796875 3 21 1.1.1.4039.6 1 47.4524 39191.66 47.519 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00973476003855467 2210.08740234375 553.5291 2210.0966796875 553.531494140625 4 20 1.1.1.4041.6 1 47.5056 4079.579 47.4945 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000110562003101222 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 23 1.1.1.4041.8 1 47.509 53753.32 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(H)@4 -0.0195690002292395 2224.09301757813 742.3716 2224.1123046875 742.378051757813 3 21 1.1.1.4042.6 1 47.5262 1494.123 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000110562003101222 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 26 1.1.1.4043.8 1 47.5524 53753.32 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000110562003101222 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 23 1.1.1.4043.9 1 47.5533 53753.32 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0139314001426101 2210.111328125 1106.063 2210.0966796875 1106.0556640625 2 24 1.1.1.4046.20 1 47.6362 52059.45 47.4945 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000110562003101222 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 22 1.1.1.4048.9 1 47.6763 53753.32 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00235766009427607 2224.11010742188 742.3773 2224.1123046875 742.378051757813 3 25 1.1.1.4049.6 1 47.7025 23115.93 47.8398 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.000110562003101222 2210.0966796875 737.7062 2210.0966796875 737.706176757813 3 27 1.1.1.4050.5 1 47.7224 53753.32 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5; Deamidated(N)@17 0.0357411988079548 2212.10034179688 738.3741 2212.06469726563 738.362182617188 3 17 1.1.1.4051.8 1 47.7497 20676.59 47.4945 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00973476003855467 2210.08740234375 553.5291 2210.0966796875 553.531494140625 4 11 1.1.1.4052.8 1 47.7743 3886.931 47.519 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00656956993043423 2224.10620117188 557.0338 2224.1123046875 557.035400390625 4 21 1.1.1.4055.5 1 47.8461 1716.79 47.815 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00235766009427607 2224.11010742188 742.3773 2224.1123046875 742.378051757813 3 28 1.1.1.4056.11 1 47.876 23115.93 47.8398 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(K)@20 0.0150782996788621 2238.14331054688 1120.079 2238.12817382813 1120.0712890625 2 15 1.1.1.4056.20 1 47.8835 952.9282 47.9643 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.000255636987276375 2210.09643554688 737.7061 2210.0966796875 737.706176757813 3 28 1.1.1.4057.9 1 47.8992 42019.08 47.642 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(K)@20 0.001217280048877 2238.12939453125 747.0504 2238.12817382813 747.049987792969 3 23 1.1.1.4057.11 1 47.9009 2892.081 47.9393 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00656956993043423 2224.10620117188 557.0338 2224.1123046875 557.035400390625 4 19 1.1.1.4059.6 1 47.9467 1716.79 47.815 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 -0.00235766009427607 2224.11010742188 742.3773 2224.1123046875 742.378051757813 3 29 1.1.1.4063.3 1 48.0445 23115.93 47.8398 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.00208664010278881 2210.0947265625 737.7055 2210.0966796875 737.706176757813 3 25 1.1.1.4064.6 1 48.0718 10670.27 47.815 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term 0.000851079006679356 2238.12866210938 747.0502 2238.12817382813 747.049987792969 3 27 1.1.1.4064.7 1 48.0735 3914.31 48.1332 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.0206116996705532 2211.10131835938 1106.558 2211.08081054688 1106.54760742188 2 19 1.1.1.4070.14 1 48.2221 799.8988 48.1811 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.988484025001526 2211.08520507813 738.0357 2210.0966796875 737.706176757813 3 25 1.1.1.4071.4 1 48.236 2140.78 48.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term 0.00140038004610687 2238.12939453125 747.0504 2238.12817382813 747.049987792969 3 27 1.1.1.4071.5 1 48.2376 3781.034 48.1572 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14 0.019879300147295 2211.10131835938 1106.558 2211.08081054688 1106.54760742188 2 19 1.1.1.4078.5 1 48.4086 676.2629 48.2767 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00120915996376425 2210.09790039063 737.7066 2210.0966796875 737.706176757813 3 21 1.1.1.4079.5 1 48.4259 607.9144 48.3725 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00065986200934276 2210.09741210938 737.7064 2210.0966796875 737.706176757813 3 23 1.1.1.4107.5 1 49.1083 402.274 49.0924 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.0186586994677782 2211.09936523438 1106.557 2211.08081054688 1106.54760742188 2 13 1.1.1.4109.12 1 49.1587 293.5687 49.1899 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.00483421981334686 2211.08569335938 738.0358 2211.08081054688 738.0341796875 3 22 1.1.1.4110.7 1 49.1732 819.7557 49.1655 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.989216029644012 2211.0859375 738.0359 2210.0966796875 737.706176757813 3 23 1.1.1.4114.9 1 49.2807 848.0087 49.1899 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.015484900213778 2211.09545898438 1106.555 2211.08081054688 1106.54760742188 2 17 1.1.1.4120.17 1 49.4294 1095.972 49.5103 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5; Methyl(K)@20 0.00566184986382723 2225.10180664063 742.7079 2225.09643554688 742.706115722656 3 15 1.1.1.4121.11 1 49.4474 222.4257 49.4608 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 -0.000475678010843694 2211.08056640625 738.0341 2211.08081054688 738.0341796875 3 25 1.1.1.4127.9 1 49.5958 4364.652 49.5103 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Methyl(K)@20 -0.000380440993467346 2225.095703125 742.7059 2225.09643554688 742.706115722656 3 22 1.1.1.4133.8 1 49.7439 776.44 49.782 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -0.000255636987276375 2210.09643554688 737.7061 2210.0966796875 737.706176757813 3 17 1.1.1.4134.7 1 49.7652 255.9017 49.7325 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 0.00331797008402646 2236.11572265625 746.3792 2236.1123046875 746.378051757813 3 25 1.1.1.4139.10 1 49.8922 4529.869 50.0785 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term -0.00720532005652785 2238.12060546875 747.0475 2238.12817382813 747.049987792969 3 17 1.1.1.4140.14 1 49.9194 764.2371 50.0785 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0109134996309876 2210.107421875 737.7098 2210.0966796875 737.706176757813 3 21 1.1.1.4143.7 1 49.9926 284.2318 49.9056 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 0.00331797008402646 2236.11572265625 746.3792 2236.1123046875 746.378051757813 3 26 1.1.1.4146.8 1 50.0667 4527.694 50.0785 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Methyl(K)@20 0.000851346994750202 2250.12866210938 751.0502 2250.12817382813 751.049987792969 3 24 1.1.1.4150.7 1 50.1643 1218.409 50.2775 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.00391871994361281 2211.08471679688 738.0355 2211.08081054688 738.0341796875 3 22 1.1.1.4151.7 1 50.1908 809.7228 50.2524 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term; Methyl(K)@20 0.000851346994750202 2250.12866210938 751.0502 2250.12817382813 751.049987792969 3 23 1.1.1.4157.16 1 50.3435 1218.409 50.2775 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl@N-term 0.0153318997472525 2238.107421875 1120.061 2238.091796875 1120.05310058594 2 25 1.1.1.4258.4 1 52.8202 1216.765 52.8491 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@3 0.0135712996125221 2232.09130859375 1117.053 2232.07861328125 1117.04663085938 2 16 1.1.1.4317.9 1 54.2838 263.8015 54.2922 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Dioxidation(F)@15 0.00405411003157496 2242.09057617188 748.3708 2242.08666992188 748.369445800781 3 18 1.1.1.4045.7 1 47.6006 1491.894 47.47 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Methyl(K)@20 -0.00249061989597976 2225.09423828125 742.7053 2225.09643554688 742.706115722656 3 20 1.1.1.4028.10 1 47.1837 1410.033 47.1979 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Methyl(K)@20 -0.014058499597013 2225.08129882813 1113.548 2225.09643554688 1113.55554199219 2 16 1.1.1.4028.19 1 47.1929 206.4046 47.1979 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Methyl(K)@20 -0.00249061989597976 2225.09423828125 742.7053 2225.09643554688 742.706115722656 3 24 1.1.1.4031.6 1 47.2573 1410.033 47.1979 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Delta:H(4)C(2)(K)@20 -0.0131818996742368 2239.09887695313 747.3736 2239.11206054688 747.377990722656 3 18 1.1.1.4032.9 1 47.2854 330.1325 47.2724 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Deamidated(N)@17 0.0292086992412806 2212.09375 738.3719 2212.06469726563 738.362182617188 3 15 1.1.1.4033.11 1 47.3084 20198.12 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@10 -0.0016071000136435 2232.0771484375 745.033 2232.07861328125 745.033508300781 3 15 1.1.1.4036.10 1 47.3818 610.2278 47.4945 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(F)@15 -0.00443466985598207 2226.08740234375 743.0364 2226.091796875 743.037841796875 3 21 1.1.1.4038.5 1 47.427 2081.567 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Carboxy(E)@13; Deamidated(Q)@14 0.00369711010716856 2256.05810546875 753.0267 2256.0546875 753.025512695313 3 13 1.1.1.4038.6 1 47.4278 350.8914 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(E)@10; Carbamidomethyl(E)@13 -0.0422555990517139 2281.091796875 761.3712 2281.1337890625 761.38525390625 3 12 1.1.1.4038.7 1 47.4287 335.3596 47.4454 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(N)@17 -0.00235766009427607 2224.11010742188 742.3773 2224.1123046875 742.378051757813 3 15 1.1.1.4048.10 1 47.6771 23115.93 47.8398 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Methyl(N)@17 0.000851346994750202 2250.12866210938 751.0502 2250.12817382813 751.049987792969 3 16 1.1.1.4155.10 1 50.2885 1218.409 50.2775 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:K(E)@13 0.00559295993298292 2248.05810546875 750.36 2248.052734375 750.358154296875 3 15 1.1.1.4041.9 1 47.5115 265.0975 47.4945 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 0.00498097017407417 2232.08374023438 745.0352 2232.07861328125 745.033508300781 3 15 1.1.1.4043.10 1 47.5541 614.652 47.4945 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term; Delta:H(2)C(2)(H)@4 0.0156538002192974 2262.14331054688 1132.079 2262.12817382813 1132.0712890625 2 14 1.1.1.4279.14 1 53.3255 537.4984 53.4055 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl(K)@20 -0.00395466014742851 2238.08740234375 1120.051 2238.091796875 1120.05310058594 2 13 1.1.1.4114.10 1 49.2832 753.1522 49.3622 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl@N-term; Delta:H(2)C(2)(H)@4 0.0165606997907162 2264.12329101563 1133.069 2264.107421875 1133.06091308594 2 11 1.1.1.4346.16 1 55.0077 289.8711 55.0169 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@12 -0.0240052994340658 2240.08325195313 747.7017 2240.107421875 747.709716796875 3 14 1.1.1.4040.4 1 47.4753 562.044 47.47 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5; Deamidated(N)@12; Methyl(N)@17 0.030892800539732 2226.111328125 743.0444 2226.08032226563 743.034118652344 3 14 1.1.1.4052.10 1 47.7768 4899.271 47.815 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 0.021179499104619 2209.08544921875 1105.55 2209.06518554688 1105.53979492188 2 14 1.1.1.4356.7 1 55.2576 320.9868 55.2652 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 0.00534716993570328 2232.083984375 745.0353 2232.07861328125 745.033508300781 3 13 1.1.1.4050.6 1 47.7241 616.2466 47.47 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Methyl(N)@17 0.0199641995131969 2225.115234375 1113.565 2225.09643554688 1113.55554199219 2 10 1.1.1.4135.12 1 49.8016 165.1409 49.8067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12; Methyl(Q)@14 0.0160984992980957 2225.11254882813 742.7114 2225.09643554688 742.706115722656 3 20 1.1.1.4047.5 1 47.6482 12390.75 47.815 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Dehydrated(D)@7 0.000973984017036855 2192.08715820313 731.703 2192.08618164063 731.702697753906 3 12 1.1.1.4127.8 1 49.5941 183.3741 49.5598 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.8900005817413 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@17; acrolein addition +56(K)@20 0.0192735008895397 2296.1533203125 1149.084 2296.13354492188 1149.07409667969 2 12 1.1.1.4390.9 1 56.0937 1235.986 56.2041 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 LGEHNIDVLEGNEQFINAAK Dimethyl(N)@12; Cation:Na(E)@13 -0.013684400357306 2260.09619140625 754.3727 2260.11010742188 754.377258300781 3 14 1.1.1.4045.9 1 47.6023 809.0805 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 95.3199982643127 LGEHNIDVLEGNEQFINAAK Carbamidomethyl@N-term; Methyl(H)@4 -0.0358111001551151 2281.09814453125 761.3733 2281.1337890625 761.38525390625 3 13 1.1.1.4045.10 1 47.6039 378.6039 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 93.970000743866 LGEHNIDVLEGNEQFINAAK Cation:K(E)@3; Methyl(H)@4; Deamidated(N)@5 -0.000170704995980486 2263.05126953125 1132.533 2263.05224609375 1132.53344726563 2 11 1.1.1.4046.21 1 47.637 196.2173 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 91.1899983882904 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@12 -0.0240052994340658 2240.08325195313 747.7017 2240.107421875 747.709716796875 3 12 1.1.1.4047.6 1 47.649 562.044 47.47 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 62.4899983406067 LGEHNIDVLEGNEQFINAAK Formyl@N-term; Deamidated(N)@5 0.00223746988922358 2239.07739257813 1120.546 2239.07568359375 1120.54516601563 2 9 1.1.1.4040.14 1 47.4895 130.1577 47.47 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.2899994850159 LGEHNIDVLEGNEQFINAAK Formyl(K)@20 0.0377858988940716 2238.12939453125 747.0504 2238.091796875 747.037841796875 3 10 1.1.1.4050.7 1 47.7257 2921.068 47.9643 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 19.030000269413 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.019879300147295 2211.10131835938 1106.558 2211.08081054688 1106.54760742188 2 9 1.1.1.4153.20 1 50.2474 171.5023 50.2273 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 16.9300004839897 LGEHNIDVLEGNEQFINAAK Methyl(H)@4 -0.0108855003491044 2224.10131835938 1113.058 2224.1123046875 1113.0634765625 2 7 1.1.1.4040.13 1 47.4878 541.5298 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 16.9300004839897 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14; Deamidated(N)@17; hexanoyl addition +98(K)@20 0.0269338991492987 2310.16528320313 1156.09 2310.13793945313 1156.07629394531 2 9 1.1.1.4476.8 1 58.2276 282.4918 58.2377 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 25.8300006389618 LGEHNIDVLEGNEQFINAAKIIT Deamidated(N)@17 cleaved T-H@C-term; missed K-I@20 -0.0437114983797073 2538.2529296875 847.0916 2538.29663085938 847.106140136719 3 10 1.1.1.4051.10 1 47.7514 297.0881 47.7902 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +62(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0220461003482342 2895.47973632813 724.8772 2895.50170898438 724.882751464844 4 16 1.1.1.4327.2 1 54.5254 4230.133 54.495 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; acrolein addition +94(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0304682999849319 2927.49755859375 976.8398 2927.52807617188 976.849975585938 3 11 1.1.1.4622.3 1 61.5915 526.0479 61.4826 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0136944996193051 2886.4990234375 963.1736 2886.5126953125 963.178161621094 3 11 1.1.1.4654.4 1 62.3653 175.7097 62.3019 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.4399974346161 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +62(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0220461003482342 2895.47973632813 724.8772 2895.50170898438 724.882751464844 4 12 1.1.1.4320.4 1 54.3478 4230.133 54.495 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 LGEHNIDVLEGNEQFINAAKIITH MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0296243000775576 2886.48291015625 963.1683 2886.5126953125 963.178161621094 3 11 1.1.1.4572.5 1 60.3694 138.0942 60.382 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 LGEHNIDVLEGNEQFINAAKIITH reduced acrolein addition +96(K)@20; Delta:H(2)C(2)(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0397435016930103 2796.40502929688 933.1423 2796.44458007813 933.155517578125 3 12 1.1.1.4609.2 1 61.2769 497.0224 61.2177 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 94.6900010108948 LGEHNIDVLEGNEQFINAAKIITH Deamidated(Q)@14; Deamidated(N)@17; MDA adduct +62(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.00912578962743282 2896.47680664063 966.4995 2896.48583984375 966.502563476563 3 11 1.1.1.4610.5 1 61.3019 307.5018 61.3385 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 62.4899983406067 LGEHNIDVLEGNEQFINAAKIITH MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 -0.0125959003344178 2886.50024414063 963.174 2886.5126953125 963.178161621094 3 9 1.1.1.4624.9 1 61.6371 297.6871 61.6024 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 17.739999294281 LGEHNIDVLEGNEQFINAAKIITHP Deamidated(Q)@14; Deamidated(N)@17; ONE addition +154(K)@20 cleaved P-N@C-term; missed K-I@20 0.00445243017747998 2927.49609375 976.8393 2927.49169921875 976.837829589844 3 10 1.1.1.4588.4 1 60.7653 537.7144 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 17.739999294281 LGEHNIDVLEGNEQFINAAKIITHP acrolein addition +112(K)@20 cleaved P-N@C-term; missed K-I@20 0.0136523004621267 2883.490234375 962.1707 2883.4765625 962.166137695313 3 9 1.1.1.4647.3 1 62.1849 129.8151 62.1564 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Deamidated(N)@17; reduced HNE(H)@24; Oxidation(P)@25 cleaved N-F@C-term; missed K-I@20 -0.0163506995886564 3060.560546875 766.1474 3060.57666015625 766.151489257813 4 13 1.1.1.4435.4 1 57.2025 370.0115 57.2464 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Formyl(K)@20 cleaved N-F@C-term; missed K-I@20 0.0442406982183456 2913.50634765625 972.176 2913.46215820313 972.161315917969 3 14 1.1.1.4296.13 1 53.7462 3882.791 53.8342 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN acrolein addition +112(K)@20; reduced HNE(H)@24; Deamidated(N)@26 cleaved N-F@C-term; missed K-I@20 -0.0248537994921207 3156.60815429688 1053.21 3156.63427734375 1053.21875 3 13 1.1.1.4412.15 1 56.6437 2606.118 56.552 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(K)@20 cleaved N-F@C-term; missed K-I@20 -0.00533063989132643 2913.49340820313 729.3806 2913.49853515625 729.381896972656 4 14 1.1.1.4318.6 1 54.2994 681.4552 54.3418 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 75.2799987792969 LGEHNIDVLEGNEQFINAAKIITHPN MDA adduct +62(K)@20; Oxidation(P)@25; Deamidated(N)@26 cleaved N-F@C-term; missed K-I@20 0.0153144998475909 2964.47705078125 989.1663 2964.46166992188 989.161193847656 3 11 1.1.1.4626.7 1 61.6934 188.3028 61.6985 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 65.1000022888184 LGEHNIDVLEGNEQFINAAKIITHPN MDA adduct +62(K)@20; Deamidated(N)@26 cleaved N-F@C-term; missed K-I@20 0.00506165996193886 2948.4716796875 983.8312 2948.466796875 983.829528808594 3 10 1.1.1.4646.9 1 62.1706 227.3301 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.4700008630753 LGEHNIDVLEGNEQFINAAKIITHPN Deamidated(N)@17; acrolein addition +112(K)@20; reduced HNE(H)@24; Deamidated(N)@26 cleaved N-F@C-term; missed K-I@20 -0.0232066009193659 3157.59545898438 790.4061 3157.61840820313 790.411865234375 4 9 1.1.1.4437.4 1 57.2521 161.5073 57.2714 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 16.9300004839897 LGEHNIDVLEGNEQFINAAKIITHPN Deamidated(N)@26 cleaved N-F@C-term; missed K-I@20 0.0304485000669956 2886.4814453125 963.1678 2886.451171875 963.157653808594 3 9 1.1.1.4638.11 1 61.9742 287.3553 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +112(K)@20; Oxidation(P)@25; Deamidated(N)@26 cleaved F-N@C-term; missed K-I@20 0.00802141986787319 3161.57495117188 791.401 3161.56689453125 791.398986816406 4 20 1.1.1.4403.3 1 56.4127 456.9937 56.4295 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.030485799536109 3156.59423828125 790.1558 3156.62451171875 790.163391113281 4 18 1.1.1.4427.3 1 57.0012 696.8933 57.0213 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 -0.0353684015572071 3156.5888671875 790.1545 3156.62451171875 790.163391113281 4 16 1.1.1.4411.2 1 56.6047 5180.419 56.552 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +38(K)@20; Hex(N)@26 cleaved F-N@C-term; missed K-I@20 0.020788200199604 3232.625 809.1635 3232.60400390625 809.158264160156 4 16 1.1.1.4397.3 1 56.2616 354.7187 56.256 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +56(K)@20; Oxidation(P)@25 cleaved F-N@C-term; missed K-I@20 -0.0192047990858555 3104.53735351563 1035.853 3104.556640625 1035.85949707031 3 13 1.1.1.4045.15 1 47.6123 232.6843 47.5929 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 52.6899993419647 LGEHNIDVLEGNEQFINAAKIITHPNF acrolein addition +56(K)@20; Phospho(T)@23; reduced HNE(H)@24 cleaved F-N@C-term; missed K-I@20 0.0255066994577646 3326.68408203125 832.6783 3326.65869140625 832.671997070313 4 12 1.1.1.4371.7 1 55.6203 2072.594 55.6321 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 0.00862384960055351 3175.60131835938 1059.541 3175.59375 1059.53857421875 3 22 1.1.1.4401.6 1 56.3673 6290.738 56.4295 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 -0.0073186899535358 3175.58642578125 794.9039 3175.59375 794.90576171875 4 27 1.1.1.4408.4 1 56.5328 13042.44 56.4538 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@26 cleaved N-G@C-term; missed K-I@20 -0.0070745600387454 3175.5869140625 794.904 3175.59375 794.90576171875 4 24 1.1.1.4415.3 1 56.7062 12186.61 56.4538 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@26 cleaved N-G@C-term; missed K-I@20 -0.00609803013503551 3175.58764648438 794.9042 3175.59375 794.90576171875 4 17 1.1.1.4422.3 1 56.8774 790.7535 56.9712 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@26 cleaved N-G@C-term; missed K-I@20 -0.00609803013503551 3175.58764648438 794.9042 3175.59375 794.90576171875 4 15 1.1.1.4429.5 1 57.0538 790.7535 56.9712 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 0.00862384960055351 3175.60131835938 1059.541 3175.59375 1059.53857421875 3 15 1.1.1.4408.12 1 56.5394 6290.738 56.4295 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN ONE addition +154(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@26; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 -0.0139357000589371 3328.64770507813 833.1692 3328.66162109375 833.172668457031 4 14 1.1.1.4391.9 1 56.1124 1972.027 56.1787 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 65.1000022888184 LGEHNIDVLEGNEQFINAAKIITHPNFN Deamidated(N)@17; Delta:H(4)C(2)(K)@20 cleaved N-G@C-term; missed K-I@20 0.00854996964335442 3175.6025390625 794.9079 3175.59375 794.90576171875 4 11 1.1.1.4398.4 1 56.2876 1948.424 56.2302 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20 cleaved N-T@C-term; missed K-I@20 0.00553796999156475 3345.68017578125 1116.234 3345.67431640625 1116.23205566406 3 16 1.1.1.4368.8 1 55.5489 1493.109 55.5833 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Formyl(K)@20 cleaved N-T@C-term; missed K-I@20 0.0259198006242514 3345.66381835938 837.4232 3345.6376953125 837.416748046875 4 15 1.1.1.4366.3 1 55.4925 2848.343 55.5833 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIML Delta:H(4)C(2)(H)@24 cleaved L-I@C-term; missed K-I@20 -0.013327999971807 4261.09814453125 853.2269 4261.111328125 853.229553222656 5 13 1.1.1.4589.7 1 60.7886 676.4976 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24 missed K-I@20 -0.0104460995644331 4488.2646484375 898.6602 4488.27490234375 898.662231445313 5 25 1.1.1.4568.11 1 60.2688 945.4741 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24 missed K-I@20 -0.012827499769628 4502.27783203125 901.4628 4502.29052734375 901.46533203125 5 28 1.1.1.4568.12 1 60.2697 1531.192 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(K)@20 missed K-I@20 0.00641024019569159 4502.294921875 1126.581 4502.29052734375 1126.57983398438 4 25 1.1.1.4569.6 1 60.2987 779.9352 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20 -0.00605357997119427 4516.2998046875 904.2673 4516.30615234375 904.268493652344 5 29 1.1.1.4570.6 1 60.3183 626.402 60.3317 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(K)@20; Deamidated(N)@30 missed K-I@20 -0.0139001999050379 4503.2607421875 901.6594 4503.2744140625 901.662170410156 5 19 1.1.1.4575.5 1 60.4389 1161.525 60.5568 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK hexanoyl addition +98(K)@20; PhosphoUridine(H)@24 missed K-I@20 0.117205999791622 4878.474609375 976.7022 4878.357421875 976.678771972656 5 18 1.1.1.4569.5 1 60.2954 424.7414 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24; Deamidated(N)@28 missed K-I@20 -0.0179273001849651 4489.2412109375 898.8555 4489.2587890625 898.859008789063 5 16 1.1.1.4582.4 1 60.6141 649.2806 60.5568 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Deamidated(N)@28; Deamidated(N)@30 missed K-I@20 0.0499676987528801 4503.27490234375 1126.826 4503.2265625 1126.81396484375 4 16 1.1.1.4578.12 1 60.5269 495.79 60.5568 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Formyl(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20 0.0262215994298458 4517.2763671875 904.4626 4517.25048828125 904.457336425781 5 15 1.1.1.4583.7 1 60.6394 334.7622 60.6308 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24; Deamidated(N)@28 missed K-I@20 0.00323897995986044 4489.2626953125 1123.323 4489.2587890625 1123.32202148438 4 13 1.1.1.4578.11 1 60.5252 258.4948 60.5568 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; Formyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0196612998843193 5557.83154296875 927.3125 5557.8115234375 927.309265136719 6 35 1.1.1.4551.2 1 59.8522 1800.035 59.9179 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0150908995419741 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 25 1.1.1.4551.4 1 59.8605 524.2458 59.8938 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0162905007600784 5557.83154296875 927.3125 5557.81494140625 927.309814453125 6 20 1.1.1.4560.5 1 60.072 1800.035 59.9179 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.034341998398304 5556.8330078125 927.1461 5556.86767578125 927.15185546875 6 27 1.1.1.4568.14 1 60.2714 2865.524 60.3317 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@28; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0246876999735832 5542.82861328125 924.8121 5542.80419921875 924.807983398438 6 22 1.1.1.4569.3 1 60.2904 582.6212 60.3568 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00553158018738031 5572.83544921875 929.8132 5572.84130859375 929.814147949219 6 26 1.1.1.4569.4 1 60.2929 23036.67 60.4574 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; Cation:K(D)@35; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0303652994334698 5949.03369140625 992.5129 5949.06396484375 992.517944335938 6 19 1.1.1.4570.8 1 60.3217 3589.313 60.4324 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126496003940701 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 27 1.1.1.4570.10 1 60.325 1471.713 60.3317 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0333104990422726 5586.8447265625 932.1481 5586.8779296875 932.153625488281 6 19 1.1.1.4571.5 1 60.3417 718.3324 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0275353994220495 5572.853515625 1115.578 5572.826171875 1115.57250976563 5 29 1.1.1.4571.9 1 60.3484 12100.39 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0377194993197918 5557.810546875 794.9802 5557.84814453125 794.985595703125 7 27 1.1.1.4572.2 1 60.3619 1579.986 60.3568 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0162979997694492 5587.84521484375 799.2709 5587.8623046875 799.273315429688 7 21 1.1.1.4572.3 1 60.3644 320.3544 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0812830999493599 5870.9951171875 979.5065 5871.07666015625 979.520080566406 6 19 1.1.1.4572.6 1 60.3719 469.4266 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Deamidated(N)@30; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00664454977959394 5601.84814453125 934.6486 5601.84130859375 934.647521972656 6 21 1.1.1.4573.5 1 60.3921 678.4946 60.4574 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; MDA adduct +62(K)@40; Dehydrated(S)@42 missed K-I@20; missed K-L@40 -0.0268530994653702 5572.814453125 797.1236 5572.84130859375 797.12744140625 7 26 1.1.1.4574.3 1 60.4122 6252.23 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0104569001123309 5572.8369140625 929.8134 5572.826171875 929.811645507813 6 17 1.1.1.4574.4 1 60.4139 23194.16 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +94(K)@20; reduced HNE(H)@24; Carbamidomethyl(D)@35; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0516850985586643 5837.978515625 974.0037 5838.0302734375 974.012329101563 6 20 1.1.1.4574.8 1 60.4206 262.5595 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0255130007863045 5557.822265625 927.311 5557.84814453125 927.315307617188 6 30 1.1.1.4575.6 1 60.4398 6353.28 60.382 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@20; reduced HNE(H)@24; Hex(N)@26; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.018410699442029 5935.01708984375 990.1768 5935.03515625 990.179809570313 6 20 1.1.1.4575.10 1 60.4439 949.9965 60.382 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0236731003969908 5543.8232421875 924.9778 5543.79931640625 924.973876953125 6 25 1.1.1.4576.3 1 60.4646 989.8893 60.3568 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0255130007863045 5557.822265625 927.311 5557.84814453125 927.315307617188 6 28 1.1.1.4576.4 1 60.4671 6353.28 60.382 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Oxidation(D)@35; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0225577000528574 5572.8369140625 929.8134 5572.85888671875 929.817138671875 6 38 1.1.1.4576.5 1 60.4696 23194.16 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; Cation:K(D)@35; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0303652994334698 5949.03369140625 992.5129 5949.06396484375 992.517944335938 6 19 1.1.1.4577.3 1 60.5017 3589.313 60.4324 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; MDA adduct +62(K)@40; Dehydrated(S)@42 missed K-I@20; missed K-L@40 0.0122792003676295 5572.853515625 1115.578 5572.84130859375 1115.57556152344 5 29 1.1.1.4578.10 1 60.5235 12100.39 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@20; Hex(N)@30; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.0278734005987644 5870.9951171875 979.5065 5870.9677734375 979.501892089844 6 20 1.1.1.4579.3 1 60.5383 469.4266 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.00684096990153193 5557.80859375 794.9799 5557.81494140625 794.980895996094 7 18 1.1.1.4581.3 1 60.5876 633.2269 60.606 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0115970000624657 5572.814453125 797.1236 5572.826171875 797.125305175781 7 26 1.1.1.4581.4 1 60.5893 6252.23 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.00170728005468845 5538.8369140625 924.1467 5538.83837890625 924.14697265625 6 20 1.1.1.4582.5 1 60.6157 1829.26 60.6561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.00107213004957885 5538.8193359375 792.2672 5538.8203125 792.267333984375 7 16 1.1.1.4583.6 1 60.6385 422.2905 60.6561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0112386997789145 5557.82275390625 927.3111 5557.8115234375 927.309265136719 6 27 1.1.1.4583.12 1 60.6435 2599.524 60.6308 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; MDA adduct +62(K)@40; Dehydrated(S)@42 missed K-I@20; missed K-L@40 -0.00479918019846082 5572.8369140625 929.8134 5572.84130859375 929.814147949219 6 25 1.1.1.4583.13 1 60.6444 23194.16 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0355077013373375 5586.8427734375 932.1477 5586.8779296875 932.153625488281 6 19 1.1.1.4585.6 1 60.6928 660.8527 60.4324 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Formyl(K)@40 missed K-I@20; missed K-L@40 0.0237358994781971 5556.85400390625 1112.378 5556.8310546875 1112.37353515625 5 21 1.1.1.4586.15 1 60.7243 35209.89 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-I@20; missed K-L@40 -0.000696826027706265 5514.818359375 1103.971 5514.8203125 1103.97143554688 5 32 1.1.1.4588.6 1 60.7703 2065.474 60.7804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24 missed K-I@20; missed K-L@40 -0.0306432992219925 5528.8056640625 790.8367 5528.83642578125 790.841003417969 7 29 1.1.1.4589.2 1 60.7845 1495.274 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0313323996961117 5542.82080078125 792.8388 5542.85205078125 792.84326171875 7 26 1.1.1.4589.3 1 60.7853 3160.597 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00332582998089492 5556.82763671875 794.8398 5556.8310546875 794.840270996094 7 27 1.1.1.4589.4 1 60.7861 16937.62 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@26; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00677879014983773 5541.82666015625 924.6451 5541.8203125 924.643981933594 6 26 1.1.1.4589.8 1 60.7895 9577.388 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; Deamidated(N)@30; Methyl(I)@39 missed K-I@20; missed K-L@40 -0.0632670000195503 5827.97119140625 972.3358 5828.03466796875 972.346374511719 6 24 1.1.1.4589.13 1 60.7937 315.1444 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Methyl(L)@38 missed K-I@20; missed K-L@40 -0.00427446980029345 5528.833984375 1106.774 5528.83642578125 1106.77453613281 5 28 1.1.1.4589.19 1 60.7987 4614.151 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0313323996961117 5542.82080078125 792.8388 5542.85205078125 792.84326171875 7 30 1.1.1.4590.4 1 60.8113 3160.597 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0332433991134167 5556.833984375 927.1463 5556.86767578125 927.15185546875 6 44 1.1.1.4590.6 1 60.8138 76518.38 61.0013 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00695944018661976 5573.8291015625 929.9788 5573.82177734375 929.977600097656 6 21 1.1.1.4590.7 1 60.8154 7951.708 60.7558 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0223676990717649 5603.83447265625 934.9797 5603.85693359375 934.983459472656 6 21 1.1.1.4590.8 1 60.8171 425.3467 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; hexanoyl addition +98(K)@20; Deamidated(N)@26; Formyl(K)@40 missed K-I@20; missed K-L@40 0.00694396998733282 5628.84814453125 939.1486 5628.8408203125 939.1474609375 6 22 1.1.1.4590.9 1 60.8188 308.16 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00414542993530631 5769.9892578125 962.6721 5769.99267578125 962.672729492188 6 19 1.1.1.4590.10 1 60.8204 292.6939 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HexNAc(N)@17; acrolein addition +112(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0221641007810831 5843.9423828125 974.9977 5843.96484375 975.001403808594 6 20 1.1.1.4590.11 1 60.8221 416.3854 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0360575988888741 5632.82568359375 939.8116 5632.8623046875 939.817687988281 6 14 1.1.1.4591.10 1 60.8412 266.4337 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0514990985393524 5750.91015625 959.4923 5750.9619140625 959.500915527344 6 16 1.1.1.4591.12 1 60.8429 189.6413 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; reduced HNE(H)@24; Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0199804995208979 5759.93115234375 960.9958 5759.95068359375 960.999084472656 6 19 1.1.1.4591.13 1 60.8437 191.7098 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00785182975232601 5542.84375 1109.576 5542.85205078125 1109.57763671875 5 36 1.1.1.4591.18 1 60.8479 8335.028 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0133509999141097 5528.82275390625 922.4777 5528.83642578125 922.47998046875 6 19 1.1.1.4592.4 1 60.8611 8372.495 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00589777994900942 5572.83544921875 929.8132 5572.84130859375 929.814147949219 6 27 1.1.1.4592.6 1 60.8628 4642.846 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Deamidated(N)@28; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.022027900442481 5588.82470703125 932.478 5588.84619140625 932.481628417969 6 23 1.1.1.4592.7 1 60.8636 960.2493 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0414070002734661 5792.966796875 966.5018 5793.0087890625 966.508728027344 6 15 1.1.1.4592.12 1 60.8678 295.5652 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Carbamidomethyl(T)@23; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0219459999352694 5797.97705078125 967.3368 5797.9990234375 967.340454101563 6 22 1.1.1.4592.13 1 60.8686 288.8465 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; reduced HNE(H)@24; Carbamidomethyl(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0433464013040066 5855.9970703125 977.0068 5856.041015625 977.014099121094 6 25 1.1.1.4592.15 1 60.8703 814.8529 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0133509999141097 5528.82275390625 922.4777 5528.83642578125 922.47998046875 6 26 1.1.1.4593.2 1 60.8839 8372.495 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0426502004265785 5783.9658203125 965.0016 5784.00830078125 965.008666992188 6 24 1.1.1.4593.8 1 60.8889 388.9661 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@20; Hex(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0631564036011696 5787.0068359375 965.5084 5786.943359375 965.497802734375 6 20 1.1.1.4593.9 1 60.8898 276.1675 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Cation:K(E)@13; reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00884385965764523 5820.9716796875 971.1692 5820.98046875 971.170654296875 6 22 1.1.1.4593.11 1 60.8914 437.7973 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00927873980253935 5556.85400390625 1112.378 5556.8642578125 1112.38012695313 5 40 1.1.1.4593.15 1 60.8948 42320.41 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0223472993820906 5587.83837890625 1118.575 5587.8623046875 1118.57971191406 5 19 1.1.1.4593.16 1 60.8956 553.5516 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0146497003734112 5573.83642578125 929.98 5573.82177734375 929.977600097656 6 22 1.1.1.4594.5 1 60.914 7951.708 60.7558 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0233407001942396 5584.8388671875 931.8138 5584.8623046875 931.817687988281 6 26 1.1.1.4594.6 1 60.9165 871.7704 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; GlnThrGlyGly(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00728528015315533 5872.95849609375 979.8337 5872.9658203125 979.8349609375 6 25 1.1.1.4594.8 1 60.9215 1241.175 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0245884004980326 5601.8662109375 934.6516 5601.84130859375 934.647521972656 6 25 1.1.1.4595.2 1 60.9357 489.1031 60.9773 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00848211999982595 5572.83251953125 797.1262 5572.84130859375 797.12744140625 7 28 1.1.1.4596.2 1 60.958 1369.707 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.00396728981286287 5575.82177734375 797.5532 5575.82568359375 797.553833007813 7 18 1.1.1.4596.3 1 60.9605 1032.372 61.0494 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0203677993267775 5542.83154296875 924.8125 5542.85205078125 924.81591796875 6 36 1.1.1.4596.4 1 60.963 15986.05 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0259194001555443 5556.84130859375 927.1475 5556.86767578125 927.15185546875 6 49 1.1.1.4597.2 1 60.9878 78814.41 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@14; Phospho(T)@23; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0219585001468658 5609.76171875 935.9675 5609.783203125 935.971130371094 6 25 1.1.1.4597.3 1 60.9962 898.8864 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0203200001269579 5541.80029296875 924.6406 5541.8203125 924.643981933594 6 24 1.1.1.4598.4 1 61.0086 4189.658 61.0013 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; reduced HNE(H)@24; GlyGly(T)@31; Formyl(K)@40 missed K-I@20; missed K-L@40 -0.039750698953867 5838.94970703125 974.1655 5838.9892578125 974.172119140625 6 22 1.1.1.4598.5 1 61.0102 339.4746 61.0013 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0127344997599721 5542.83837890625 1109.575 5542.85205078125 1109.57763671875 5 27 1.1.1.4598.9 1 61.0203 3218.498 61.0013 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0397113002836704 5556.82763671875 794.8398 5556.86767578125 794.845520019531 7 33 1.1.1.4599.3 1 61.0318 16833 61.0013 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.010466099716723 5556.84130859375 927.1475 5556.8310546875 927.145812988281 6 15 1.1.1.4599.4 1 61.0343 78814.41 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00589777994900942 5572.83544921875 929.8132 5572.84130859375 929.814147949219 6 26 1.1.1.4599.5 1 61.0368 5129.002 61.0738 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; Phospho(T)@31; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.000643456005491316 5933.033203125 989.8461 5933.03271484375 989.846069335938 6 19 1.1.1.4599.7 1 61.0418 2284.243 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.0126970000565052 5527.8173828125 922.3102 5527.8046875 922.308044433594 6 21 1.1.1.4600.3 1 61.0566 1364.481 61.0738 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0821048989892006 5626.8271484375 938.8118 5626.9091796875 938.825500488281 6 21 1.1.1.4600.5 1 61.0616 432.3105 61.0494 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126496003940701 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 50 1.1.1.4600.7 1 61.0683 42320.41 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0204934999346733 5586.857421875 932.1502 5586.8779296875 932.153625488281 6 22 1.1.1.4601.2 1 61.081 1464.988 61.0978 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0210711993277073 5595.8095703125 933.6422 5595.83056640625 933.645751953125 6 15 1.1.1.4601.3 1 61.0868 670.6503 61.0494 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; GlnThrGlyGly(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00765147991478443 5872.95849609375 979.8337 5872.9658203125 979.8349609375 6 28 1.1.1.4601.4 1 61.0927 999.5349 61.0978 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0119636002928019 5557.8359375 927.3133 5557.84814453125 927.315307617188 6 24 1.1.1.4603.3 1 61.129 58748.82 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00589777994900942 5572.83544921875 929.8132 5572.84130859375 929.814147949219 6 28 1.1.1.4603.4 1 61.1315 5129.002 61.0738 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.024762200191617 5542.8271484375 924.8118 5542.85205078125 924.81591796875 6 31 1.1.1.4604.2 1 61.1498 8151.987 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0309711992740631 5556.8330078125 927.1461 5556.8642578125 927.151306152344 6 42 1.1.1.4604.3 1 61.1514 76813.86 61.1217 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0239473003894091 5561.833984375 927.9796 5561.81005859375 927.975646972656 6 25 1.1.1.4604.4 1 61.1531 3113.924 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Formyl(K)@40 missed K-I@20; missed K-L@40 -0.0730450004339218 5610.7685546875 936.1354 5610.841796875 936.147583007813 6 21 1.1.1.4604.5 1 61.1548 737.2393 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.04444669932127 5782.97998046875 964.8373 5783.0244140625 964.844665527344 6 28 1.1.1.4604.6 1 61.1573 387.3052 61.1217 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0201929993927479 5578.79541015625 797.978 5578.8154296875 797.980895996094 7 20 1.1.1.4605.2 1 61.1746 953.3691 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00640443013980985 5541.8134765625 924.6429 5541.8203125 924.643981933594 6 24 1.1.1.4605.4 1 61.1796 3975.368 61.1217 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00968283042311668 5542.84375 1109.576 5542.85205078125 1109.57763671875 5 28 1.1.1.4605.7 1 61.1888 2978.885 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0350588001310825 5556.8291015625 794.84 5556.8642578125 794.845031738281 7 31 1.1.1.4606.2 1 61.2002 14767.61 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00589777994900942 5572.83544921875 929.8132 5572.84130859375 929.814147949219 6 26 1.1.1.4606.4 1 61.2085 5129.002 61.0738 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0265341997146606 5528.8095703125 922.4755 5528.83642578125 922.47998046875 6 26 1.1.1.4607.3 1 61.2267 1551.407 61.2663 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(F)@15; acrolein addition +56(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.000301193009363487 5774.9833984375 963.5045 5774.98291015625 963.504455566406 6 28 1.1.1.4607.4 1 61.23 942.013 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.013259899802506 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 53 1.1.1.4607.6 1 61.2367 36321.35 61.2663 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00632603000849485 5576.81494140625 797.6951 5576.82080078125 797.695983886719 7 26 1.1.1.4608.4 1 61.2471 888.3397 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00299095991067588 5585.849609375 931.9822 5585.8466796875 931.981689453125 6 20 1.1.1.4608.5 1 61.2479 1718.917 61.3385 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; Carbamidomethyl(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0642018020153046 5932.00732421875 989.6752 5932.072265625 989.685974121094 6 19 1.1.1.4608.11 1 61.2562 1080.85 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Oxidation(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0254873000085354 5572.833984375 929.8129 5572.85888671875 929.817138671875 6 31 1.1.1.4610.3 1 61.2969 4072.707 61.2421 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0302387997508049 5556.83349609375 927.1462 5556.8642578125 927.151306152344 6 44 1.1.1.4611.2 1 61.3217 69196.68 61.3144 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00999103020876646 5571.85400390625 1115.378 5571.841796875 1115.37573242188 5 24 1.1.1.4611.3 1 61.3276 1371.008 61.3625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00128577998839319 5541.82177734375 924.6442 5541.8203125 924.643981933594 6 23 1.1.1.4612.4 1 61.3508 5294.068 61.3625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +94(K)@20; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0486404001712799 5574.82666015625 930.145 5574.87451171875 930.153076171875 6 21 1.1.1.4612.5 1 61.3541 2677.192 61.3385 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0136775001883507 5571.828125 929.6453 5571.841796875 929.647583007813 6 26 1.1.1.4613.2 1 61.3697 2936.42 61.3385 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0363405011594296 5556.82763671875 794.8398 5556.8642578125 794.845031738281 7 32 1.1.1.4614.3 1 61.3921 13426.93 61.3865 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@14; Deamidated(N)@17; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0028737299144268 5588.84912109375 932.4821 5588.84619140625 932.481628417969 6 21 1.1.1.4614.6 1 61.3979 1177.899 61.3625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Hex(N)@17; MDA adduct +54(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.00869784969836473 5933.03173828125 989.8459 5933.041015625 989.847412109375 6 19 1.1.1.4614.7 1 61.4004 1034.207 61.2663 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126496003940701 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 53 1.1.1.4614.9 1 61.4055 36250.25 61.3625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(P)@25; Delta:H(4)C(2)(K)@40; Deamidated(N)@48 missed K-I@20; missed K-L@40 0.0228486992418766 5561.83251953125 927.9794 5561.81005859375 927.975646972656 6 21 1.1.1.4615.2 1 61.4163 2902.292 61.3385 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00299095991067588 5585.849609375 931.9822 5585.8466796875 931.981689453125 6 22 1.1.1.4615.3 1 61.4196 1718.917 61.3385 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +94(K)@20; Hex(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0176216997206211 5854.990234375 976.839 5854.97265625 976.836059570313 6 22 1.1.1.4615.5 1 61.4263 942.4909 61.3625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.012329800054431 5557.83544921875 927.3132 5557.84814453125 927.315307617188 6 25 1.1.1.4616.2 1 61.4419 49243.67 61.2903 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; MDA adduct +62(K)@40; Dehydrated(S)@42 missed K-I@20; missed K-L@40 -0.0077287801541388 5572.833984375 929.8129 5572.84130859375 929.814147949219 6 30 1.1.1.4617.2 1 61.465 4219.896 61.3625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@28; Oxidation(M)@37 missed K-I@20; missed K-L@40 -0.0122338999062777 5773.97509765625 963.3365 5773.98779296875 963.338562011719 6 19 1.1.1.4617.4 1 61.4734 831.3313 61.3865 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0336095988750458 5556.83349609375 927.1462 5556.86767578125 927.15185546875 6 48 1.1.1.4618.2 1 61.4881 69044.9 61.2421 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00129319995176047 5572.84375 1115.576 5572.84130859375 1115.57556152344 5 21 1.1.1.4618.6 1 61.5015 2017.488 61.3625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00128577998839319 5541.82177734375 924.6442 5541.8203125 924.643981933594 6 24 1.1.1.4619.2 1 61.5112 5294.068 61.3625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0027759000658989 5556.83349609375 927.1462 5556.8310546875 927.145812988281 6 22 1.1.1.4619.3 1 61.5137 69196.68 61.3144 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00270720990374684 5583.83349609375 931.6462 5583.83056640625 931.645751953125 6 25 1.1.1.4619.4 1 61.5162 1248.08 61.4586 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(F)@15; Deamidated(N)@17; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0309293996542692 5573.8408203125 929.9808 5573.81005859375 929.975646972656 6 20 1.1.1.4620.4 1 61.5426 2555.631 61.5304 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126496003940701 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 45 1.1.1.4621.13 1 61.5717 36250.25 61.3625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0108027998358011 5582.8583984375 1117.579 5582.8466796875 1117.57666015625 5 20 1.1.1.4621.14 1 61.5734 555.3889 61.4347 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0448851995170116 5556.8193359375 794.8386 5556.8642578125 794.845031738281 7 31 1.1.1.4622.2 1 61.5857 10623.54 61.5785 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.00508686993271112 5540.82861328125 1109.173 5540.83642578125 1109.17456054688 5 23 1.1.1.4622.4 1 61.5974 1640.125 61.6263 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00493824994191527 5544.82666015625 925.145 5544.8310546875 925.145812988281 6 21 1.1.1.4623.3 1 61.6212 1815.527 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0178813003003597 5572.8232421875 797.1249 5572.84130859375 797.12744140625 7 22 1.1.1.4624.3 1 61.6304 852.7759 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0168837998062372 5572.82421875 929.8113 5572.84130859375 929.814147949219 6 25 1.1.1.4624.5 1 61.6321 3089.189 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0317035987973213 5556.83251953125 927.146 5556.8642578125 927.151306152344 6 40 1.1.1.4625.2 1 61.6577 52266.66 61.6024 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00312420004047453 5572.84375 1115.576 5572.84130859375 1115.57556152344 5 25 1.1.1.4625.4 1 61.6694 1621.507 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0350744016468525 5556.83251953125 927.146 5556.86767578125 927.15185546875 6 24 1.1.1.4626.3 1 61.6817 52266.66 61.6024 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0140594001859426 5583.8447265625 931.6481 5583.83056640625 931.645751953125 6 25 1.1.1.4626.5 1 61.6867 1226.172 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Deamidated(N)@30; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0107551999390125 5599.8369140625 934.3134 5599.82568359375 934.311584472656 6 24 1.1.1.4626.6 1 61.6901 608.4538 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00758621003478765 5541.82470703125 924.6447 5541.81689453125 924.643432617188 6 19 1.1.1.4627.3 1 61.7049 4201.07 61.6745 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00758621003478765 5541.82470703125 924.6447 5541.81689453125 924.643432617188 6 23 1.1.1.4627.4 1 61.7074 4201.07 61.6745 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0936089009046555 5610.78125 936.1375 5610.87451171875 936.153076171875 6 21 1.1.1.4627.5 1 61.7099 592.3647 61.6263 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0181900002062321 5527.82275390625 922.3111 5527.8046875 922.308044433594 6 19 1.1.1.4628.4 1 61.7323 879.6315 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; reduced acrolein addition +58(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00921089015901089 5588.8369140625 932.4801 5588.84619140625 932.481628417969 6 22 1.1.1.4628.5 1 61.7348 783.824 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; Phospho(T)@23; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00623892014846206 5609.78955078125 935.9722 5609.783203125 935.971130371094 6 22 1.1.1.4628.6 1 61.7382 547.5836 61.7468 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126496003940701 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 46 1.1.1.4628.7 1 61.7415 25281.61 61.7708 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0350588001310825 5556.8291015625 794.84 5556.8642578125 794.845031738281 7 31 1.1.1.4629.2 1 61.7541 9231.824 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Phospho(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0135749997571111 5854.9716796875 976.8359 5854.98583984375 976.838195800781 6 19 1.1.1.4629.3 1 61.7599 766.3731 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00165137997828424 5543.8310546875 924.9791 5543.83251953125 924.979370117188 6 24 1.1.1.4630.4 1 61.7781 2848.427 61.7708 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0141751002520323 5577.8349609375 930.6464 5577.8203125 930.643981933594 6 16 1.1.1.4630.5 1 61.7798 1021.303 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Dehydrated(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00663017993792892 5572.83447265625 929.813 5572.84130859375 929.814147949219 6 29 1.1.1.4631.3 1 61.8006 2938.594 61.7708 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0152102997526526 5598.82666015625 934.145 5598.841796875 934.147583007813 6 24 1.1.1.4631.4 1 61.8023 591.4418 61.7226 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(F)@15; acrolein addition +56(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.011417199857533 5774.97119140625 963.5025 5774.98291015625 963.504455566406 6 28 1.1.1.4631.5 1 61.8039 518.8889 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0302387997508049 5556.83349609375 927.1462 5556.8642578125 927.151306152344 6 43 1.1.1.4632.2 1 61.8263 46250.86 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00449057016521692 5584.86669921875 931.8184 5584.8623046875 931.817687988281 6 23 1.1.1.4632.3 1 61.8321 1456.878 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(D)@33; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00591871980577707 5572.8349609375 797.1266 5572.84130859375 797.12744140625 7 29 1.1.1.4633.2 1 61.8536 748.0133 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0171597003936768 5572.84375 1115.576 5572.826171875 1115.57250976563 5 22 1.1.1.4633.3 1 61.862 1323.288 61.7708 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.000919580983463675 5541.82080078125 924.6441 5541.8203125 924.643981933594 6 26 1.1.1.4634.3 1 61.8801 4365.744 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Lys->Allysine(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0215607993304729 5527.82275390625 922.3111 5527.80126953125 922.307495117188 6 21 1.1.1.4635.2 1 61.8974 879.6315 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; Phospho(T)@23; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00804289989173412 5609.77490234375 935.9698 5609.783203125 935.971130371094 6 23 1.1.1.4635.3 1 61.9015 561.1508 61.819 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0138702001422644 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 50 1.1.1.4635.5 1 61.9099 26629.19 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0359132997691631 5556.82861328125 794.8399 5556.8642578125 794.845031738281 7 30 1.1.1.4636.2 1 61.92 9077.929 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00265955994836986 5584.865234375 931.8181 5584.8623046875 931.817687988281 6 21 1.1.1.4636.3 1 61.9225 1305.615 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.113507002592087 5854.96826171875 976.8353 5855.08203125 976.854248046875 6 19 1.1.1.4636.6 1 61.9309 721.9053 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0236962996423244 5577.84375 930.6479 5577.8203125 930.643981933594 6 16 1.1.1.4637.2 1 61.9449 914.6836 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR GlnThrGlyGly(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0212415996938944 5871.96435546875 979.668 5871.9853515625 979.671508789063 6 29 1.1.1.4637.6 1 61.9582 408.3616 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0122803002595901 5577.80810546875 797.837 5577.8203125 797.838745117188 7 15 1.1.1.4638.5 1 61.9692 619.6021 61.7226 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00479918019846082 5572.8369140625 929.8134 5572.84130859375 929.814147949219 6 24 1.1.1.4638.7 1 61.9708 2556.942 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0240298006683588 5542.82763671875 924.8119 5542.85205078125 924.81591796875 6 25 1.1.1.4639.3 1 61.9917 4000.346 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0336095988750458 5556.83349609375 927.1462 5556.86767578125 927.15185546875 6 42 1.1.1.4639.4 1 61.9926 42260.61 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.016906600445509 5585.86328125 931.9845 5585.8466796875 931.981689453125 6 25 1.1.1.4639.5 1 61.9934 1288.036 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.00665481016039848 5755.970703125 960.3357 5755.97705078125 960.336791992188 6 20 1.1.1.4639.7 1 61.9967 325.7109 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Formyl(K)@40 missed K-I@20; missed K-L@40 0.0132753001525998 5542.82861328125 1109.573 5542.8154296875 1109.5703125 5 22 1.1.1.4639.13 1 62.0067 2029.687 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.00277589005418122 5556.83349609375 927.1462 5556.8310546875 927.145812988281 6 15 1.1.1.4640.2 1 62.0167 42260.61 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0027759000658989 5556.83349609375 927.1462 5556.8310546875 927.145812988281 6 26 1.1.1.4640.3 1 62.0192 42260.61 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0172131005674601 5573.83935546875 929.9805 5573.82177734375 929.977600097656 6 26 1.1.1.4640.4 1 62.0217 2254.429 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0173556003719568 5540.81884765625 924.4771 5540.83642578125 924.47998046875 6 24 1.1.1.4641.2 1 62.0432 2886.654 62.0118 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0628407001495361 5608.79931640625 935.8072 5608.8623046875 935.817687988281 6 25 1.1.1.4641.3 1 62.0491 439.0496 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Lys->Allysine(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00654658023267984 5527.80810546875 922.3086 5527.80126953125 922.307495117188 6 21 1.1.1.4642.2 1 62.0672 678.6681 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.013259899802506 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 48 1.1.1.4642.4 1 62.0789 22308.86 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0359132997691631 5556.82861328125 794.8399 5556.8642578125 794.845031738281 7 30 1.1.1.4643.2 1 62.0899 9077.929 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0140594001859426 5583.8447265625 931.6481 5583.83056640625 931.645751953125 6 23 1.1.1.4643.4 1 62.0966 1195.469 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0628407001495361 5608.79931640625 935.8072 5608.8623046875 935.817687988281 6 25 1.1.1.4643.5 1 62.0999 439.0496 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; ONE addition +154(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0655167028307915 5841.98486328125 974.6714 5842.05029296875 974.682312011719 6 29 1.1.1.4644.3 1 62.119 371.0038 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +94(K)@20; Hex(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0220161005854607 5854.99462890625 976.8397 5854.97265625 976.836059570313 6 20 1.1.1.4644.4 1 62.1232 622.2186 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR GlnThrGlyGly(K)@20; Deamidated(N)@26; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00728528015315533 5872.95849609375 979.8337 5872.9658203125 979.8349609375 6 25 1.1.1.4644.5 1 62.1273 425.1007 62.0118 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00736257992684841 5572.833984375 929.8129 5572.84130859375 929.814147949219 6 26 1.1.1.4645.4 1 62.1414 2153.601 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00129468995146453 5598.83984375 934.1473 5598.841796875 934.147583007813 6 19 1.1.1.4645.5 1 62.1439 461.5906 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR GlnThrGlyGly(K)@20; Deamidated(N)@34; Oxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.0229927003383636 5973.0087890625 996.5087 5972.9853515625 996.504821777344 6 20 1.1.1.4645.8 1 62.1514 581.3431 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0332433991134167 5556.833984375 927.1463 5556.86767578125 927.15185546875 6 39 1.1.1.4646.2 1 62.1597 32990.34 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(P)@25; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0228486992418766 5561.83251953125 927.9794 5561.81005859375 927.975646972656 6 21 1.1.1.4646.3 1 62.1605 1779.923 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00372336991131306 5585.85009765625 931.9823 5585.8466796875 931.981689453125 6 21 1.1.1.4646.4 1 62.1622 1053.828 62.1564 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0295413993299007 5596.83251953125 933.8127 5596.8623046875 933.817687988281 6 17 1.1.1.4646.5 1 62.1639 374.6233 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; reduced HNE(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00364514999091625 5772.9638671875 963.1679 5772.96728515625 963.168518066406 6 26 1.1.1.4647.4 1 62.1858 405.8589 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.00760135985910892 5539.8154296875 924.3098 5539.822265625 924.310974121094 6 25 1.1.1.4648.2 1 62.2157 1801.969 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00736257992684841 5572.833984375 929.8129 5572.84130859375 929.814147949219 6 30 1.1.1.4648.3 1 62.2241 2153.601 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.012177400290966 5528.82080078125 922.4774 5528.8330078125 922.479431152344 6 21 1.1.1.4649.3 1 62.2335 802.2322 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00314210006035864 5556.833984375 927.1463 5556.8310546875 927.145812988281 6 22 1.1.1.4649.4 1 62.2343 32990.34 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0103936996310949 5799.00927734375 967.5088 5799.01953125 967.510498046875 6 20 1.1.1.4649.5 1 62.2352 216.89 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126496003940701 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 45 1.1.1.4649.12 1 62.2469 16525.13 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)@N-term; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.00942504964768887 5584.85302734375 931.8161 5584.8623046875 931.817687988281 6 27 1.1.1.4650.3 1 62.2667 1124.968 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0384295992553234 5556.8291015625 794.84 5556.86767578125 794.845520019531 7 35 1.1.1.4652.4 1 62.3119 6570.128 62.1564 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0312956012785435 5573.8408203125 929.9808 5573.81005859375 929.975646972656 6 18 1.1.1.4652.5 1 62.3144 1320.93 62.3019 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0148208001628518 5607.8154296875 935.6432 5607.83056640625 935.645751953125 6 21 1.1.1.4652.6 1 62.3177 272.6913 62.3019 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0206588990986347 5542.82763671875 924.8119 5542.8486328125 924.815368652344 6 24 1.1.1.4653.3 1 62.3319 2689.052 62.3745 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0332433991134167 5556.833984375 927.1463 5556.86767578125 927.15185546875 6 44 1.1.1.4653.4 1 62.3336 32990.34 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0115483002737164 5598.830078125 934.1456 5598.841796875 934.147583007813 6 24 1.1.1.4653.5 1 62.3352 324.9814 62.3745 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@24; Phosphoadenosine(T)@31; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.027208000421524 5988.99951171875 999.1738 5988.97216796875 999.169311523438 6 20 1.1.1.4653.8 1 62.3427 357.843 62.3261 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0139498002827168 5541.806640625 792.6939 5541.8203125 792.695861816406 7 24 1.1.1.4654.3 1 62.3611 469.3052 62.3987 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Oxidation(D)@35; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0251211002469063 5572.833984375 929.8129 5572.85888671875 929.817138671875 6 34 1.1.1.4655.4 1 62.3845 2153.601 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.021993100643158 5587.84033203125 932.314 5587.8623046875 932.317626953125 6 19 1.1.1.4655.5 1 62.387 528.495 62.3987 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0122806997969747 5598.82958984375 934.1455 5598.841796875 934.147583007813 6 21 1.1.1.4656.3 1 62.4079 324.378 62.3987 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0126496003940701 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 47 1.1.1.4656.6 1 62.4179 16790.68 62.1564 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.018580099567771 5584.84375 931.8146 5584.8623046875 931.817687988281 6 19 1.1.1.4657.7 1 62.4374 1129.503 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0170479007065296 5529.80322265625 922.6411 5529.8203125 922.643981933594 6 28 1.1.1.4658.3 1 62.4585 859.9214 62.4475 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0384295992553234 5556.8291015625 794.84 5556.86767578125 794.845520019531 7 35 1.1.1.4659.3 1 62.4854 5111.333 62.3019 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0302387997508049 5556.83349609375 927.1462 5556.8642578125 927.151306152344 6 31 1.1.1.4660.2 1 62.503 28004.73 62.2536 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Deamidated(N)@34; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0118538001552224 5599.83740234375 934.3135 5599.82568359375 934.311584472656 6 22 1.1.1.4660.3 1 62.5071 333.3735 62.3987 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0240298006683588 5542.82763671875 924.8119 5542.85205078125 924.81591796875 6 30 1.1.1.4662.3 1 62.5559 2567.716 62.4963 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00663017993792892 5572.83447265625 929.813 5572.84130859375 929.814147949219 6 27 1.1.1.4662.4 1 62.5601 1156.179 62.4719 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Deamidated(N)@28; Methyl(K)@40 missed K-I@20; missed K-L@40 0.012687100097537 5543.8125 924.976 5543.79931640625 924.973876953125 6 32 1.1.1.4663.3 1 62.5761 2722.715 62.4475 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0204934999346733 5586.857421875 932.1502 5586.8779296875 932.153625488281 6 20 1.1.1.4663.4 1 62.5786 592.6028 62.6668 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0138702001422644 5556.85400390625 1112.378 5556.86767578125 1112.38073730469 5 38 1.1.1.4663.8 1 62.5886 10345.81 62.5937 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; reduced acrolein addition +96(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0534026995301247 5853.99658203125 976.6734 5854.05029296875 976.682312011719 6 18 1.1.1.4665.2 1 62.6258 374.4276 62.6183 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0176394991576672 5557.83056640625 794.9831 5557.84814453125 794.985595703125 7 29 1.1.1.4666.2 1 62.6492 4585.409 62.5937 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0239707995206118 5528.8125 922.476 5528.83642578125 922.47998046875 6 26 1.1.1.4666.3 1 62.6534 694.8505 62.4475 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0119636002928019 5557.8359375 927.3133 5557.84814453125 927.315307617188 6 38 1.1.1.4667.3 1 62.6778 21556.26 62.6912 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@12; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0371305011212826 5561.84716796875 927.9818 5561.81005859375 927.975646972656 6 22 1.1.1.4667.4 1 62.6819 1753.632 62.6668 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0116689000278711 5572.853515625 1115.578 5572.84130859375 1115.57556152344 5 20 1.1.1.4667.5 1 62.6861 622.3797 62.6668 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.126932993531227 5610.74755859375 936.1319 5610.87451171875 936.153076171875 6 24 1.1.1.4668.4 1 62.7004 378.7503 62.6668 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; Carbamidomethyl(T)@23; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0583606995642185 5855.98193359375 977.0043 5856.041015625 977.014099121094 6 25 1.1.1.4668.5 1 62.7029 450.2538 62.6912 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; HexNAc(N)@34; Oxidation(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0808229967951775 5989.9814453125 999.3375 5990.0625 999.351013183594 6 20 1.1.1.4668.8 1 62.7104 544.1522 62.6668 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.010890900157392 5542.82568359375 924.8116 5542.8154296875 924.809875488281 6 26 1.1.1.4669.3 1 62.729 2150.883 62.6912 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00545442989096045 5572.84716796875 929.8151 5572.84130859375 929.814147949219 6 28 1.1.1.4669.4 1 62.7348 1219.767 62.6668 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Cation:K(E)@13; HexNAc(N)@30; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0284311007708311 5895.9111328125 983.6591 5895.939453125 983.663879394531 6 20 1.1.1.4670.4 1 62.7548 343.5842 62.6183 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0230253003537655 5556.84326171875 1112.376 5556.86767578125 1112.38073730469 5 35 1.1.1.4670.5 1 62.7589 8319.684 62.7398 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0023410099092871 5583.8330078125 931.6461 5583.83056640625 931.645751953125 6 22 1.1.1.4671.4 1 62.7741 612.0594 62.6912 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00445576990023255 5585.85107421875 931.9824 5585.8466796875 931.981689453125 6 22 1.1.1.4671.5 1 62.7766 708.2565 62.6668 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; reduced HNE(H)@24; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0149812996387482 5771.0029296875 962.8411 5770.98779296875 962.838623046875 6 18 1.1.1.4671.6 1 62.7799 313.9282 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; HexNAc(N)@30; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.0435057990252972 5835.9853515625 973.6715 5835.94189453125 973.664245605469 6 19 1.1.1.4671.7 1 62.7833 225.7778 62.6912 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Ammonia-loss(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.0237787999212742 5579.81201171875 798.1233 5579.8359375 798.126708984375 7 21 1.1.1.4672.3 1 62.7992 309.1441 62.7883 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0119636002928019 5557.8359375 927.3133 5557.84814453125 927.315307617188 6 41 1.1.1.4674.3 1 62.8501 21556.26 62.6912 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0208205003291368 5601.8203125 934.644 5601.84130859375 934.647521972656 6 26 1.1.1.4674.4 1 62.856 236.1641 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@26; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0278930999338627 5557.8203125 794.9816 5557.84814453125 794.985595703125 7 30 1.1.1.4675.2 1 62.866 3961.686 62.7883 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0137171996757388 5528.82275390625 922.4777 5528.83642578125 922.47998046875 6 21 1.1.1.4675.3 1 62.8685 410.6631 62.8367 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Deamidated(N)@28; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0313633009791374 5543.8310546875 924.9791 5543.79931640625 924.973876953125 6 31 1.1.1.4675.4 1 62.871 1799.112 62.861 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0376325994729996 5597.80859375 933.9754 5597.8466796875 933.981689453125 6 16 1.1.1.4675.5 1 62.8735 224.6333 62.861 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0240298006683588 5542.82763671875 924.8119 5542.85205078125 924.81591796875 6 22 1.1.1.4676.7 1 62.8929 1602.554 62.8367 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0720779970288277 5872.984375 979.838 5873.05615234375 979.849975585938 6 22 1.1.1.4676.11 1 62.8996 168.3787 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00643457006663084 5557.853515625 1112.578 5557.84814453125 1112.57690429688 5 32 1.1.1.4677.10 1 62.9274 10032.2 62.9097 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0152736995369196 5577.83544921875 930.6465 5577.8203125 930.643981933594 6 16 1.1.1.4678.3 1 62.9451 431.2008 62.861 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0363629013299942 5584.85107421875 931.8158 5584.81494140625 931.809753417969 6 21 1.1.1.4678.4 1 62.9493 657.5419 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; HexNAc(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0258082002401352 5843.990234375 975.0057 5843.96484375 975.001403808594 6 21 1.1.1.4678.5 1 62.9534 157.1415 62.9097 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0255046002566814 5580.841796875 931.1476 5580.86767578125 931.15185546875 6 20 1.1.1.4679.3 1 62.9679 443.9346 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@20; reduced HNE(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0281738992780447 5794.9599609375 966.8339 5794.98779296875 966.838623046875 6 27 1.1.1.4679.4 1 62.9712 190.3568 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Carbamidomethyl(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0327293984591961 5801.9970703125 968.0068 5802.0302734375 968.012329101563 6 21 1.1.1.4679.5 1 62.9746 139.1731 62.9097 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0152986999601126 5573.8369140625 797.2697 5573.82177734375 797.267578125 7 22 1.1.1.4680.2 1 62.9939 351.4368 62.861 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00479918019846082 5572.8369140625 929.8134 5572.84130859375 929.814147949219 6 28 1.1.1.4680.3 1 63.0022 894.4768 62.983 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0112311998382211 5557.8369140625 927.3134 5557.84814453125 927.315307617188 6 39 1.1.1.4681.2 1 63.0183 19882.64 62.861 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0240298006683588 5542.82763671875 924.8119 5542.85205078125 924.81591796875 6 23 1.1.1.4683.6 1 63.0705 1596.603 62.8367 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@12; Deamidated(N)@17; acrolein addition +38(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0352731011807919 5568.85498046875 929.1498 5568.81982421875 929.143920898438 6 23 1.1.1.4684.3 1 63.0941 296.5905 63.0806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00643457006663084 5557.853515625 1112.578 5557.84814453125 1112.57690429688 5 40 1.1.1.4684.4 1 63.0999 9929.341 62.9342 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0146150998771191 5771.0029296875 962.8411 5770.98779296875 962.838623046875 6 17 1.1.1.4685.5 1 63.1245 332.7184 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; Oxidation(P)@25; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00865131989121437 5545.82080078125 925.3107 5545.8115234375 925.309265136719 6 20 1.1.1.4686.5 1 63.1423 424.4197 63.0806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0270386002957821 5557.82177734375 794.9818 5557.84814453125 794.985595703125 7 29 1.1.1.4687.2 1 63.1734 3666.018 62.9097 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0119636002928019 5557.8359375 927.3133 5557.84814453125 927.315307617188 6 38 1.1.1.4688.6 1 63.1985 17583.18 62.9342 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0320862010121346 5542.8193359375 924.8105 5542.85205078125 924.81591796875 6 28 1.1.1.4689.3 1 63.2177 1301.211 62.9585 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0173899997025728 5582.8642578125 931.4846 5582.8466796875 931.481750488281 6 21 1.1.1.4689.4 1 63.2235 2770.197 63.3788 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0413195006549358 5582.88818359375 1117.585 5582.8466796875 1117.57666015625 5 20 1.1.1.4690.4 1 63.2482 2529.192 63.4044 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00955978967249393 5572.83203125 929.8126 5572.84130859375 929.814147949219 6 21 1.1.1.4691.6 1 63.2681 875.1285 63.0073 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00704490020871162 5557.853515625 1112.578 5557.84814453125 1112.57690429688 5 27 1.1.1.4691.8 1 63.2731 8028.443 63.0073 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0291747990995646 5557.81884765625 794.9814 5557.84814453125 794.985595703125 7 30 1.1.1.4694.2 1 63.348 2447.234 63.0806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0089323902502656 5582.85595703125 798.5581 5582.8466796875 798.556823730469 7 22 1.1.1.4695.3 1 63.3675 538.3562 63.3788 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0130621995776892 5557.8349609375 927.3131 5557.84814453125 927.315307617188 6 33 1.1.1.4695.4 1 63.3733 11717.86 63.1051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0225744992494583 5543.82177734375 924.9776 5543.79931640625 924.973876953125 6 27 1.1.1.4696.3 1 63.3932 883.4005 63.1296 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0173899997025728 5582.8642578125 931.4846 5582.8466796875 931.481750488281 6 20 1.1.1.4696.4 1 63.3991 2770.197 63.3788 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.031913798302412 5558.81494140625 795.1237 5558.8466796875 795.128234863281 7 16 1.1.1.4697.6 1 63.4216 1261.827 63.154 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0413195006549358 5582.88818359375 1117.585 5582.8466796875 1117.57666015625 5 19 1.1.1.4697.7 1 63.4249 2529.192 63.4044 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00704490020871162 5557.853515625 1112.578 5557.84814453125 1112.57690429688 5 27 1.1.1.4698.5 1 63.4501 4989.039 63.179 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0194102991372347 5573.8408203125 929.9808 5573.82177734375 929.977600097656 6 22 1.1.1.4700.5 1 63.5012 391.1992 63.3031 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.01379460003227 5557.83447265625 927.313 5557.84814453125 927.315307617188 6 35 1.1.1.4702.2 1 63.5522 6535.331 63.2781 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0155589999631047 5582.8623046875 931.4843 5582.8466796875 931.481750488281 6 19 1.1.1.4703.3 1 63.5783 2853.032 63.5063 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0413195006549358 5582.88818359375 1117.585 5582.8466796875 1117.57666015625 5 18 1.1.1.4704.4 1 63.6044 2529.192 63.4044 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0102140996605158 5582.85693359375 798.5583 5582.8466796875 798.556823730469 7 21 1.1.1.4707.3 1 63.6816 496.0486 63.6609 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0119636002928019 5557.8359375 927.3133 5557.84814453125 927.315307617188 6 35 1.1.1.4709.3 1 63.733 4128.825 63.4552 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0177561994642019 5582.8642578125 931.4847 5582.8466796875 931.481750488281 6 19 1.1.1.4710.2 1 63.7586 2642.606 63.635 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0419299006462097 5582.88818359375 1117.585 5582.8466796875 1117.57666015625 5 19 1.1.1.4712.5 1 63.8097 1854.256 63.8147 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00207618996500969 5557.845703125 927.3149 5557.84814453125 927.315307617188 6 30 1.1.1.4716.4 1 63.9118 2383.466 63.635 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0173899997025728 5582.8642578125 931.4846 5582.8466796875 931.481750488281 6 18 1.1.1.4717.2 1 63.9374 2520.918 63.6609 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0419299006462097 5582.88818359375 1117.585 5582.8466796875 1117.57666015625 5 19 1.1.1.4720.3 1 64.0148 1854.256 63.8147 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0152995996177197 5556.85205078125 927.1493 5556.86767578125 927.15185546875 6 36 1.1.1.4723.4 1 64.092 1011.726 64.1488 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0159252006560564 5582.86279296875 931.4844 5582.8466796875 931.481750488281 6 19 1.1.1.4724.3 1 64.118 1733.437 63.8405 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0152995996177197 5556.85205078125 927.1493 5556.86767578125 927.15185546875 6 42 1.1.1.4731.2 1 64.2624 1010.526 64.1488 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0250802002847195 5582.87158203125 931.4859 5582.8466796875 931.481750488281 6 19 1.1.1.4733.3 1 64.3086 995.5319 64.0714 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0145672000944614 5556.85302734375 927.1494 5556.86767578125 927.15185546875 6 36 1.1.1.4739.2 1 64.4527 823.7626 64.458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0173551999032497 5583.84814453125 931.6486 5583.83056640625 931.645751953125 6 19 1.1.1.4742.4 1 64.5308 620.3525 64.4043 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.024820800870657 5556.8427734375 927.1477 5556.86767578125 927.15185546875 6 32 1.1.1.4747.3 1 64.6428 748.0975 64.5946 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0163982007652521 5556.85107421875 927.1491 5556.86767578125 927.15185546875 6 38 1.1.1.4754.2 1 64.8242 566.8961 64.8037 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0336095988750458 5556.83349609375 927.1462 5556.86767578125 927.15185546875 6 29 1.1.1.4768.5 1 65.1159 473.1292 65.1288 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.034341998398304 5556.8330078125 927.1461 5556.86767578125 927.15185546875 6 30 1.1.1.4778.3 1 65.3222 346.2843 65.2744 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0259194001555443 5556.84130859375 927.1475 5556.86767578125 927.15185546875 6 33 1.1.1.4788.3 1 65.5634 334.4987 65.5355 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0361730009317398 5556.8310546875 927.1458 5556.86767578125 927.15185546875 6 35 1.1.1.4800.3 1 65.8058 323.7234 65.7583 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0111985001713037 5556.841796875 927.1476 5556.8310546875 927.145812988281 6 28 1.1.1.4811.4 1 66.0578 404.7314 66.0364 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0138347996398807 5556.85302734375 927.1495 5556.86767578125 927.15185546875 6 35 1.1.1.4821.2 1 66.2839 327.1836 66.3152 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0266517996788025 5556.8408203125 927.1474 5556.86767578125 927.15185546875 6 31 1.1.1.5081.3 1 69.9511 210.0007 69.9561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0376050993800163 5557.84912109375 927.3155 5557.8115234375 927.309265136719 6 26 1.1.1.5092.6 1 70.2192 191.254 70.1994 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00863511022180319 5556.83984375 927.1472 5556.8310546875 927.145812988281 6 29 1.1.1.5162.4 1 71.3442 298.0607 71.3232 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0115646999329329 5556.8427734375 927.1477 5556.8310546875 927.145812988281 6 28 1.1.1.5172.4 1 71.5439 290.4225 71.524 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0380039997398853 5556.82958984375 927.1455 5556.86767578125 927.15185546875 6 28 1.1.1.5185.5 1 71.7684 289.5237 71.7734 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0259194001555443 5556.84130859375 927.1475 5556.86767578125 927.15185546875 6 32 1.1.1.5204.7 1 72.108 387.5795 72.1865 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0270179994404316 5556.83984375 927.1473 5556.86767578125 927.15185546875 6 33 1.1.1.5223.3 1 72.4117 398.4072 72.4168 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0237221997231245 5556.84375 927.1479 5556.86767578125 927.15185546875 6 33 1.1.1.5240.3 1 72.7398 423.0074 72.7448 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0259194001555443 5556.84130859375 927.1475 5556.86767578125 927.15185546875 6 33 1.1.1.5256.2 1 73.1181 419.4746 73.1307 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.024820800870657 5556.8427734375 927.1477 5556.86767578125 927.15185546875 6 37 1.1.1.5266.2 1 73.3197 461.9153 73.3764 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0259194001555443 5556.84130859375 927.1475 5556.86767578125 927.15185546875 6 41 1.1.1.5279.2 1 73.5981 426.9899 73.6296 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.036905400454998 5556.83056640625 927.1457 5556.86767578125 927.15185546875 6 38 1.1.1.5287.2 1 73.8009 523.14 73.8313 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00131109997164458 5556.83251953125 927.146 5556.8310546875 927.145812988281 6 33 1.1.1.5297.5 1 74.0389 495.3863 74.044 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.024820800870657 5556.8427734375 927.1477 5556.86767578125 927.15185546875 6 29 1.1.1.5304.4 1 74.2198 480.7265 74.2249 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0266517996788025 5556.8408203125 927.1474 5556.86767578125 927.15185546875 6 30 1.1.1.5313.5 1 74.415 573.4019 74.5046 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00973371043801308 5556.8408203125 927.1474 5556.8310546875 927.145812988281 6 32 1.1.1.5322.4 1 74.5917 499.0312 74.5968 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0266517996788025 5556.8408203125 927.1474 5556.86767578125 927.15185546875 6 28 1.1.1.5334.5 1 74.7853 651.9727 74.7698 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.036905400454998 5556.83056640625 927.1457 5556.86767578125 927.15185546875 6 30 1.1.1.5343.7 1 74.9864 652.7346 75.0203 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0027759000658989 5556.83349609375 927.1462 5556.8310546875 927.145812988281 6 23 1.1.1.5351.12 1 75.154 578.398 75.1909 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0354406014084816 5556.83154296875 927.1459 5556.86767578125 927.15185546875 6 31 1.1.1.5359.7 1 75.3467 577.4063 75.3022 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0259194001555443 5556.84130859375 927.1475 5556.86767578125 927.15185546875 6 22 1.1.1.5369.8 1 75.5726 524.0094 75.4917 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0115646999329329 5556.8427734375 927.1477 5556.8310546875 927.145812988281 6 28 1.1.1.5379.6 1 75.7791 415.4805 75.7575 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0266517996788025 5556.8408203125 927.1474 5556.86767578125 927.15185546875 6 34 1.1.1.5390.2 1 75.9728 351.7496 76.0058 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.000212494996958412 5556.8310546875 927.1458 5556.8310546875 927.145812988281 6 28 1.1.1.5398.4 1 76.148 453.7956 76.1002 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0163982007652521 5556.85107421875 927.1491 5556.86767578125 927.15185546875 6 29 1.1.1.5405.6 1 76.3316 433.943 76.363 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0266517996788025 5556.8408203125 927.1474 5556.86767578125 927.15185546875 6 28 1.1.1.5414.5 1 76.5664 470.1434 76.4931 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0266517996788025 5556.8408203125 927.1474 5556.86767578125 927.15185546875 6 29 1.1.1.5421.7 1 76.7501 418.7608 76.6764 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0127362003549933 5556.8544921875 927.1497 5556.86767578125 927.15185546875 6 36 1.1.1.5447.2 1 77.1633 337.9214 77.1522 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0145672000944614 5556.85302734375 927.1494 5556.86767578125 927.15185546875 6 26 1.1.1.5466.11 1 77.6241 403.6507 77.6029 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0398349985480309 5556.82763671875 927.1452 5556.86767578125 927.15185546875 6 23 1.1.1.5535.6 1 78.8118 207.7996 78.6625 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.10402899980545 5625.77392578125 938.6362 5625.8779296875 938.653564453125 6 19 1.1.1.4576.6 1 60.4721 315.6999 60.4324 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0333104990422726 5586.8447265625 932.1481 5586.8779296875 932.153625488281 6 18 1.1.1.4578.2 1 60.511 718.3324 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Deamidated(N)@30; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0202402994036675 5588.8251953125 799.4109 5588.84619140625 799.413879394531 7 19 1.1.1.4589.6 1 60.7878 259.3907 60.9291 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@12; Formyl(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0342928990721703 5543.833984375 924.9796 5543.79931640625 924.973876953125 6 20 1.1.1.4594.4 1 60.9124 10858.46 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00312420004047453 5572.84375 1115.576 5572.84130859375 1115.57556152344 5 19 1.1.1.4603.7 1 61.1407 2476.198 61.0738 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.00204349006526172 5556.8330078125 927.1461 5556.8310546875 927.145812988281 6 14 1.1.1.4606.3 1 61.2043 76813.86 61.1217 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00230120006017387 5541.814453125 924.643 5541.81689453125 924.643432617188 6 19 1.1.1.4620.3 1 61.5393 4261.662 61.5544 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0235127992928028 5540.81201171875 792.5519 5540.78857421875 792.548522949219 7 17 1.1.1.4624.2 1 61.6296 594.6427 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.010601400397718 5571.85400390625 1115.378 5571.841796875 1115.37573242188 5 19 1.1.1.4640.6 1 62.0275 976.9259 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0816493034362793 5870.9951171875 979.5065 5871.07666015625 979.520080566406 6 17 1.1.1.4653.7 1 62.3402 297.625 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0309957005083561 5540.8193359375 924.4772 5540.78857421875 924.472045898438 6 17 1.1.1.4655.2 1 62.3795 2214.004 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0119885001331568 5584.8505859375 931.8157 5584.8623046875 931.817687988281 6 18 1.1.1.4664.8 1 62.6032 735.2101 62.5937 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0164806991815567 5573.837890625 929.9803 5573.82177734375 929.977600097656 6 19 1.1.1.4671.3 1 62.7716 1391.904 62.6668 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0077287801541388 5572.833984375 929.8129 5572.84130859375 929.814147949219 6 19 1.1.1.4676.8 1 62.8946 958.9401 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0251382999122143 5568.8564453125 929.15 5568.8310546875 929.145812988281 6 18 1.1.1.4693.5 1 63.323 317.5873 63.2781 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0320091992616653 5583.86376953125 1117.78 5583.83056640625 1117.7734375 5 18 1.1.1.4743.3 1 64.5567 610.6071 64.4314 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0140594001859426 5583.8447265625 931.6481 5583.83056640625 931.645751953125 6 18 1.1.1.4753.4 1 64.7986 573.9531 64.5694 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Met->Hcy(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.00178368005435914 5588.837890625 932.4803 5588.83642578125 932.47998046875 6 19 1.1.1.4574.5 1 60.4156 868.8683 60.4324 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; Cation:K(D)@35; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0581279993057251 5949.00537109375 850.8652 5949.06396484375 850.87353515625 7 18 1.1.1.4575.4 1 60.4381 588.1745 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0166418999433517 5529.80322265625 790.9792 5529.8203125 790.981567382813 7 18 1.1.1.4590.3 1 60.8104 1002.184 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@14; Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.00677879014983773 5541.82666015625 924.6451 5541.8203125 924.643981933594 6 19 1.1.1.4591.8 1 60.8396 9577.388 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@14; hexanoyl addition +98(K)@20; reduced HNE(H)@24; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0658534988760948 5853.984375 976.6713 5854.05029296875 976.682312011719 6 17 1.1.1.4595.3 1 60.9398 796.0791 61.0013 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; reduced acrolein addition +96(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0497406981885433 5854.00048828125 976.674 5854.05029296875 976.682312011719 6 17 1.1.1.4651.2 1 62.2967 472.0964 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0441493988037109 5542.80810546875 792.837 5542.85205078125 792.84326171875 7 18 1.1.1.4661.4 1 62.5259 530.0274 62.4719 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; PhosphoUridine(H)@24 missed K-I@20; missed K-L@40 0.0939076021313667 5904.99755859375 985.1735 5904.9033203125 985.157836914063 6 18 1.1.1.4589.15 1 60.7953 497.9939 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@20; Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0135925998911262 5746.96484375 958.8348 5746.95166015625 958.83251953125 6 16 1.1.1.4592.11 1 60.867 165.3784 61.0013 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; reduced HNE(H)@24; GlnThrGlyGly(K)@40 missed K-I@20; missed K-L@40 0.0258671995252371 6060.154296875 1011.033 6060.12646484375 1011.02838134766 6 17 1.1.1.4592.19 1 60.8736 382.6017 60.7062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0320957005023956 5543.83154296875 924.9792 5543.79931640625 924.973876953125 6 17 1.1.1.4642.3 1 62.0731 2792.679 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@34; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0209614001214504 5835.982421875 973.671 5836.00341796875 973.674499511719 6 17 1.1.1.4655.6 1 62.3903 281.3761 62.423 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; reduced acrolein addition +96(K)@20; HexNAc(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0537292994558811 5894.9140625 983.4929 5894.9677734375 983.501892089844 6 18 1.1.1.4663.6 1 62.5836 326.9323 62.3261 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; reduced HNE(H)@24; Dioxidation(M)@37; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0645622983574867 5896.955078125 983.8331 5897.01953125 983.843872070313 6 17 1.1.1.4592.16 1 60.8711 440.1429 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; Dethiomethyl(M)@37; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0724518969655037 5804.990234375 968.5057 5805.06298828125 968.517761230469 6 17 1.1.1.4593.10 1 60.8906 289.16 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; HexNAc(N)@30; Oxidation(M)@37; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0837251022458076 5925.8896484375 988.6556 5925.9736328125 988.669494628906 6 18 1.1.1.4594.9 1 60.924 412.8358 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(T)@23; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0116689000278711 5572.853515625 1115.578 5572.84130859375 1115.57556152344 5 18 1.1.1.4596.7 1 60.9722 2331.701 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0783516019582748 5855.00341796875 976.8412 5855.08203125 976.854248046875 6 16 1.1.1.4598.6 1 61.0127 903.4818 61.0013 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0158532001078129 5773.982421875 963.3377 5773.96630859375 963.335021972656 6 16 1.1.1.4599.6 1 61.0393 669.9899 61.0494 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00889544002711773 5773.97509765625 963.3365 5773.96630859375 963.335021972656 6 16 1.1.1.4610.4 1 61.2994 831.3313 61.3865 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(P)@25; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0360319018363953 5561.84619140625 927.9816 5561.81005859375 927.975646972656 6 19 1.1.1.4626.4 1 61.6842 2600.923 61.6263 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0935522988438606 5610.74853515625 936.132 5610.841796875 936.147583007813 6 16 1.1.1.4686.6 1 63.1456 291.9182 63.0073 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0391317009925842 5572.86328125 1115.58 5572.826171875 1115.57250976563 5 13 1.1.1.4676.14 1 62.9046 527.2635 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Hex(1)HexNAc(1)NeuAc(1)(T)@31; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.11837700009346 6325.228515625 1055.212 6325.111328125 1055.19250488281 6 18 1.1.1.4573.10 1 60.4021 442.8764 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Phosphoadenosine(T)@31; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.002107759937644 5941.908203125 991.3253 5941.90966796875 991.325561523438 6 17 1.1.1.4576.7 1 60.4746 247.3979 60.4324 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@20; reduced HNE(H)@24; Hex(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0638877004384995 5990.99755859375 999.5069 5991.0615234375 999.517517089844 6 17 1.1.1.4576.8 1 60.4771 294.0854 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.00454061990603805 5573.814453125 797.2665 5573.81005859375 797.265869140625 7 16 1.1.1.4589.5 1 60.787 1715.651 60.7804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@34; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0210021007806063 5541.83837890625 1109.375 5541.8203125 1109.37133789063 5 18 1.1.1.4589.20 1 60.7995 4513.066 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0258002001792192 5527.82861328125 1106.573 5527.8046875 1106.56823730469 5 16 1.1.1.4596.6 1 60.9689 755.6636 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0666258037090302 5989.00048828125 999.174 5989.06689453125 999.185119628906 6 17 1.1.1.4608.12 1 61.2579 902.298 61.4107 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0430683009326458 5541.81640625 792.6953 5541.7724609375 792.689086914063 7 16 1.1.1.4639.2 1 61.9909 677.7328 62.0118 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.00284748990088701 5540.8388671875 1109.175 5540.83642578125 1109.17456054688 5 16 1.1.1.4643.6 1 62.1033 1484.064 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@20; Deamidated(N)@26; Deamidated(N)@28; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.0338803008198738 5579.82275390625 930.9777 5579.7880859375 930.971984863281 6 16 1.1.1.4657.6 1 62.4349 497.3053 62.6183 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0119134001433849 5528.84375 1106.776 5528.8330078125 1106.77380371094 5 15 1.1.1.4661.12 1 62.5384 425.3008 62.4475 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0188887007534504 5556.85009765625 927.1489 5556.8310546875 927.145812988281 6 18 1.1.1.4673.2 1 62.8233 19861.54 62.5693 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@30; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.064022496342659 5853.98583984375 976.6716 5854.05029296875 976.682312011719 6 16 1.1.1.4675.6 1 62.8769 281.6885 62.9097 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0992249995470047 5854.982421875 976.8377 5855.08203125 976.854248046875 6 16 1.1.1.4683.7 1 63.073 307.8366 63.056 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; Formyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.044651098549366 5557.8583984375 1112.579 5557.8115234375 1112.56958007813 5 18 1.1.1.4738.2 1 64.4263 387.6633 64.3791 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; Carbamidomethyl(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0264830999076366 5932.04541015625 989.6815 5932.072265625 989.685974121094 6 16 1.1.1.4568.15 1 60.2722 372.1074 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@12; acrolein addition +56(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0210792999714613 5611.80419921875 936.308 5611.82568359375 936.311584472656 6 15 1.1.1.4573.6 1 60.3937 223.7099 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.044105801731348 5580.81982421875 931.1439 5580.8642578125 931.151306152344 6 17 1.1.1.4593.4 1 60.8856 959.1578 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.0115579003468156 5759.939453125 960.9972 5759.95068359375 960.999084472656 6 15 1.1.1.4593.7 1 60.8881 191.7098 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24 missed K-I@20; missed K-L@40 0.00980225019156933 5526.83056640625 922.1457 5526.8203125 922.14404296875 6 15 1.1.1.4614.4 1 61.3938 855.6456 61.4107 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.00804528966546059 5543.81884765625 924.9771 5543.810546875 924.975708007813 6 16 1.1.1.4614.5 1 61.3954 4125.322 61.3865 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@12; MDA adduct +54(K)@20; reduced HNE(H)@24; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0382413007318974 5775.984375 963.6713 5775.94580078125 963.664916992188 6 15 1.1.1.4627.6 1 61.7124 514.15 61.6505 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@24; Oxidation(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0559426993131638 5846.984375 975.5047 5847.04052734375 975.514038085938 6 15 1.1.1.4580.6 1 60.5663 172.4267 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(E)@13; reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Formyl(K)@40 missed K-I@20; missed K-L@40 -0.0369870997965336 5839.97216796875 974.336 5840.00927734375 974.342163085938 6 17 1.1.1.4589.14 1 60.7945 440.0291 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; reduced HNE(H)@24; HexNAc(N)@34 missed K-I@20; missed K-L@40 -0.0301974005997181 5918.0087890625 1184.609 5918.041015625 1184.61547851563 5 16 1.1.1.4590.13 1 60.8254 280.6908 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Oxidation(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0335753001272678 5571.828125 929.6453 5571.79443359375 929.6396484375 6 15 1.1.1.4621.4 1 61.5592 3015.738 61.3144 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(P)@25; Deamidated(N)@34; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0232149008661509 5561.83349609375 927.9795 5561.81005859375 927.975646972656 6 17 1.1.1.4638.6 1 61.97 2230.833 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; reduced HNE(H)@24; HexNAc(N)@34 missed K-I@20; missed K-L@40 -0.0496967993676662 5974.017578125 996.6769 5974.0673828125 996.685180664063 6 16 1.1.1.4638.16 1 61.9783 398.6116 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0497406981885433 5854.00048828125 976.674 5854.05029296875 976.682312011719 6 15 1.1.1.4645.7 1 62.1489 472.0964 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; HexNAc(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.00713016977533698 5789.9609375 966.0008 5789.9541015625 965.999633789063 6 17 1.1.1.4647.5 1 62.1866 198.7726 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@20; Iodo(H)@24; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0456686988472939 5894.9140625 983.493 5894.869140625 983.485473632813 6 16 1.1.1.4662.5 1 62.5642 327.1995 62.3019 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR GlnThrGlyGly(K)@20; Oxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.00150850997306406 5972 996.3406 5972.00146484375 996.3408203125 6 16 1.1.1.4663.7 1 62.5861 326.8683 62.5937 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@24; Phosphoguanosine(K)@40 missed K-I@20; missed K-L@40 -0.0185317005962133 6003.96435546875 1001.668 6003.98291015625 1001.67114257813 6 16 1.1.1.4573.9 1 60.3996 244.1787 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@20; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 -0.0268971994519234 5591.8095703125 932.9755 5591.8359375 932.979919433594 6 16 1.1.1.4589.9 1 60.7903 646.6442 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; Phospho(T)@31; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0675370022654533 6004.984375 1001.838 6005.0537109375 1001.84954833984 6 16 1.1.1.4580.8 1 60.5697 217.5127 60.532 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.00119622994679958 5644.84814453125 941.8153 5644.84716796875 941.815124511719 6 13 1.1.1.4593.6 1 60.8873 171.9044 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.00528883002698421 5540.84375 1109.176 5540.83642578125 1109.17456054688 5 15 1.1.1.4629.4 1 61.7658 1488.055 61.7708 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0150541998445988 5540.8486328125 1109.177 5540.83642578125 1109.17456054688 5 15 1.1.1.4650.4 1 62.2726 1173.692 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR GlnThrGlyGly(K)@20; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0479990988969803 5900.02783203125 984.3453 5899.98046875 984.337341308594 6 15 1.1.1.4574.9 1 60.4222 181.4865 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.00842989981174469 5779.96875 964.3354 5779.97705078125 964.336791992188 6 14 1.1.1.4594.7 1 60.919 289.6134 60.9291 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Formyl(K)@40 missed K-I@20; missed K-L@40 0.0505268014967442 5584.87890625 1117.983 5584.826171875 1117.97253417969 5 15 1.1.1.4653.9 1 62.3453 360.0614 62.3261 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0291047003120184 5540.81884765625 1109.171 5540.78857421875 1109.1650390625 5 14 1.1.1.4615.6 1 61.4296 1744.228 61.3385 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0504663996398449 5540.8388671875 1109.175 5540.78857421875 1109.1650390625 5 14 1.1.1.4636.7 1 61.9342 1484.064 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@14; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0632833987474442 5540.853515625 1109.178 5540.78857421875 1109.1650390625 5 14 1.1.1.4658.5 1 62.4669 853.3669 62.423 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0632833987474442 5540.853515625 1109.178 5540.78857421875 1109.1650390625 5 14 1.1.1.4665.4 1 62.6375 853.3669 62.423 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; Hex(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.071668803691864 5836.99755859375 973.8402 5836.92578125 973.828247070313 6 15 1.1.1.4681.3 1 63.0266 200.7392 62.9342 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0750484019517899 5988.9921875 999.1726 5989.06689453125 999.185119628906 6 15 1.1.1.4593.14 1 60.8939 308.634 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0797690972685814 5853.97021484375 976.669 5854.05029296875 976.682312011719 6 14 1.1.1.4636.5 1 61.9276 556.8007 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.129448994994164 5888.9375 982.4968 5889.06640625 982.518310546875 6 14 1.1.1.4578.6 1 60.5169 356.4701 60.5568 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; reduced HNE(H)@24; HexNAc(N)@26; Oxidation(M)@37 missed K-I@20; missed K-L@40 -0.0389266014099121 5931.98095703125 989.6708 5932.0205078125 989.677368164063 6 15 1.1.1.4581.8 1 60.596 268.9568 60.532 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0730450004339218 5610.7685546875 936.1354 5610.841796875 936.147583007813 6 13 1.1.1.4589.10 1 60.7912 710.9753 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; Deamidated(N)@30; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00734535977244377 5568.8134765625 1114.77 5568.81982421875 1114.77124023438 5 14 1.1.1.4592.20 1 60.8745 428.7301 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@20; reduced HNE(H)@24; Phospho(T)@31; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0752815008163452 5910.916015625 986.1599 5910.99072265625 986.172424316406 6 15 1.1.1.4593.13 1 60.8931 332.1493 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; HexNAc(N)@28; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.0116732995957136 5873.966796875 980.0018 5873.978515625 980.003723144531 6 15 1.1.1.4646.8 1 62.1689 415.7847 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0582453012466431 5541.82861328125 1109.373 5541.7724609375 1109.36181640625 5 14 1.1.1.4672.5 1 62.8076 589.3181 62.7641 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0267027001827955 5542.84375 1109.576 5542.8154296875 1109.5703125 5 14 1.1.1.4679.6 1 62.9779 845.1789 62.8367 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0825750008225441 5888.98388671875 982.5046 5889.06640625 982.518310546875 6 13 1.1.1.4587.8 1 60.7407 261.7367 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; Cation:K(D)@35; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0138189001008868 5949.048828125 1190.817 5949.06396484375 1190.82006835938 5 14 1.1.1.4571.11 1 60.3518 1892.466 60.4324 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Oxidation(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0357724986970425 5571.830078125 929.6456 5571.79443359375 929.6396484375 6 13 1.1.1.4631.2 1 61.7989 2007.664 61.7708 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.00688938982784748 5515.80859375 920.3087 5515.80126953125 920.307495117188 6 12 1.1.1.4661.5 1 62.5267 246.9972 62.423 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@24; Phosphoadenosine(K)@40 missed K-I@20; missed K-L@40 -0.0174343008548021 5987.970703125 999.0024 5987.98828125 999.005310058594 6 15 1.1.1.4646.12 1 62.1756 353.7169 62.1564 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; Phospho(T)@31; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0270943008363247 5969.005859375 995.8416 5969.03271484375 995.846069335938 6 17 1.1.1.4605.6 1 61.1855 699.9085 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0576350018382072 5541.82861328125 1109.373 5541.7724609375 1109.36181640625 5 13 1.1.1.4608.14 1 61.2612 2533.4 61.3385 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0416688993573189 5527.8486328125 1106.577 5527.8046875 1106.56823730469 5 13 1.1.1.4619.7 1 61.5254 770.7881 61.3865 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0779780000448227 5988.9892578125 999.1721 5989.06689453125 999.185119628906 6 16 1.1.1.4631.7 1 61.8073 817.1556 61.7708 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Deamidated(N)@34; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0309622008353472 5544.814453125 925.143 5544.78369140625 925.137878417969 6 14 1.1.1.4655.3 1 62.382 1699.602 62.4475 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0644285976886749 5989.00244140625 999.1744 5989.06689453125 999.185119628906 6 17 1.1.1.4661.11 1 62.5367 443.5173 62.5937 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0191284995526075 5575.84521484375 930.3148 5575.82568359375 930.311584472656 6 12 1.1.1.4664.6 1 62.6007 761.1595 62.6912 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR GlnThrGlyGly(K)@20; Oxidation(P)@25; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.00590291991829872 5971.9951171875 996.3398 5972.00146484375 996.3408203125 6 17 1.1.1.4655.7 1 62.3937 420.7402 62.3019 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0246590003371239 5609.78515625 935.9715 5609.81005859375 935.975646972656 6 12 1.1.1.4677.8 1 62.9241 252.8936 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.7600028514862 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; HexNAc(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.00917971041053534 6054.1181640625 1010.027 6054.1298828125 1010.02893066406 6 12 1.1.1.4575.11 1 60.4456 352.8158 60.2088 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.7600028514862 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0262883007526398 5815.95068359375 970.3324 5815.97705078125 970.336791992188 6 12 1.1.1.4592.14 1 60.8695 243.4895 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.7600028514862 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0123308002948761 5527.81689453125 922.3101 5527.8046875 922.308044433594 6 14 1.1.1.4621.3 1 61.5584 1032.811 61.5304 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.6100018024445 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0226860009133816 5584.8837890625 1117.984 5584.8623046875 1117.97973632813 5 13 1.1.1.4682.3 1 63.051 747.3063 63.2533 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.4399974346161 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.119001999497414 5870.95751953125 979.5002 5871.07666015625 979.520080566406 6 12 1.1.1.4587.7 1 60.739 552.4595 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.0199992656708 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Cation:K(E)@13; hexanoyl addition +98(K)@20; reduced HNE(H)@24; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0138189001008868 5949.048828125 1190.817 5949.06396484375 1190.82006835938 5 13 1.1.1.4575.15 1 60.4523 1892.466 60.4324 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.0199992656708 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0460589006543159 5541.81884765625 792.6957 5541.7724609375 792.689086914063 7 11 1.1.1.4592.2 1 60.8595 1957.503 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 97.7699995040894 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Deamidated(N)@34; Formyl(K)@40 missed K-I@20; missed K-L@40 0.0024418099783361 5587.82861328125 1118.573 5587.82568359375 1118.57238769531 5 13 1.1.1.4571.10 1 60.3501 317.7905 60.382 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 97.3699986934662 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.00814248993992805 5597.85400390625 933.983 5597.8466796875 933.981689453125 6 14 1.1.1.4600.4 1 61.0591 645.7764 61.0494 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Cation:K(E)@13; HPNE addition +172(K)@20; reduced HNE(H)@24; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0620115995407104 5930.955078125 989.4998 5931.01708984375 989.510131835938 6 13 1.1.1.4589.16 1 60.7962 793.5296 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; reduced HNE(H)@24; Dicarbamidomethyl(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0115847997367382 5933.0537109375 1187.618 5933.0673828125 1187.62072753906 5 13 1.1.1.4591.20 1 60.8496 1204.425 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0194789990782738 5585.86376953125 1118.18 5585.8466796875 1118.17651367188 5 13 1.1.1.4638.19 1 61.9825 518.2351 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; reduced HNE(H)@24; Phospho(T)@31; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0462189987301826 5894.9130859375 983.4928 5894.95947265625 983.50048828125 6 16 1.1.1.4654.5 1 62.3694 319.9742 62.3503 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(E)@13; ONE addition +154(K)@20; reduced HNE(H)@24; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0679953023791313 5964.0302734375 995.0123 5964.09814453125 995.023681640625 6 13 1.1.1.4579.4 1 60.54 250.7608 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; reduced HNE(H)@24; ONE addition +154(K)@40; Dehydrated(S)@42 missed K-I@20; missed K-L@40 -0.101485997438431 5949.0224609375 992.511 5949.1240234375 992.527893066406 6 13 1.1.1.4586.7 1 60.7143 359.7561 60.7558 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(E)@13; ONE addition +154(K)@20; reduced HNE(H)@24; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.0829283967614174 5946.0048828125 992.0081 5946.087890625 992.021911621094 6 13 1.1.1.4592.17 1 60.872 233.2392 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@20; HexNAc(N)@30; Deamidated(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0305387992411852 5933.03369140625 1187.614 5933.00439453125 1187.60815429688 5 13 1.1.1.4610.8 1 61.3094 813.6042 61.1217 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR GlnThrGlyGly(K)@20; Oxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.0069141099229455 5972.00830078125 996.342 5972.00146484375 996.3408203125 6 13 1.1.1.4647.14 1 62.1966 454.4389 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 95.3199982643127 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@20; reduced HNE(H)@24; Oxidation(M)@37; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.1058109998703 5940.97607421875 991.17 5941.08251953125 991.187683105469 6 11 1.1.1.4591.16 1 60.8462 248.6698 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 94.6900010108948 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +94(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37 missed K-I@20; missed K-L@40 0.0158434994518757 5547.84375 1110.576 5547.82763671875 1110.57275390625 5 12 1.1.1.4588.7 1 60.7728 597.3768 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 93.970000743866 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@40 missed K-I@20; missed K-L@40 0.0333316996693611 5528.833984375 1106.774 5528.7998046875 1106.76721191406 5 11 1.1.1.4649.11 1 62.2452 428.2497 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 91.1899983882904 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@24; Hex(N)@30; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.00759924994781613 5933.033203125 989.8461 5933.041015625 989.847412109375 6 17 1.1.1.4596.5 1 60.9655 2284.243 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 90.0200009346008 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@24; Hex(N)@30; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0134584996849298 5933.02783203125 989.8452 5933.041015625 989.847412109375 6 18 1.1.1.4606.5 1 61.2127 1704.99 61.1217 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 87.2500002384186 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@20; reduced HNE(H)@24; Dioxidation(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.061064101755619 5916.98486328125 987.1714 5917.0458984375 987.181579589844 6 12 1.1.1.4587.9 1 60.7424 441.2892 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 87.2500002384186 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Phospho(T)@31; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.0591154992580414 5988.99951171875 999.1739 5989.05859375 999.183715820313 6 17 1.1.1.4618.5 1 61.4982 999.9643 61.5544 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 87.2500002384186 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@14; ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0695895999670029 5989.9814453125 999.3375 5990.05126953125 999.34912109375 6 13 1.1.1.4676.13 1 62.903 297.5182 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 70.2899992465973 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Oxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0587833002209663 5882.9814453125 981.5042 5883.04052734375 981.514038085938 6 11 1.1.1.4591.15 1 60.8454 287.8217 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 70.2899992465973 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@14; HPNE addition +172(K)@20; HexNAc(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 -0.0199823006987572 5989.00830078125 1198.809 5989.03076171875 1198.81335449219 5 12 1.1.1.4631.9 1 61.8114 463.9696 61.7949 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 62.4899983406067 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 -0.0118236001580954 5580.8193359375 931.1438 5580.8310546875 931.145812988281 6 11 1.1.1.4664.7 1 62.6016 498.0276 62.6426 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 55.0100028514862 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00459078978747129 5604.8583984375 1121.979 5604.8642578125 1121.98010253906 5 10 1.1.1.4593.18 1 60.8981 309.7755 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 52.6899993419647 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; Oxidation(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0569996014237404 5571.85400390625 1115.378 5571.79443359375 1115.3662109375 5 9 1.1.1.4647.15 1 62.1983 739.7972 62.1806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0452880002558231 5596.81689453125 933.8101 5596.8623046875 933.817687988281 6 13 1.1.1.4572.4 1 60.3669 398.7715 60.4071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0233121998608112 5538.84375 1108.776 5538.8203125 1108.77136230469 5 13 1.1.1.4582.9 1 60.6232 756.9836 60.6561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@20; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 -0.00426359008997679 5766.95263671875 962.166 5766.95654296875 962.166748046875 6 13 1.1.1.4591.14 1 60.8446 223.5751 60.8305 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.010466099716723 5556.84130859375 927.1475 5556.8310546875 927.145812988281 6 13 1.1.1.4592.5 1 60.862 78814.41 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 48.6000001430511 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00481264013797045 5578.810546875 797.9802 5578.8154296875 797.980895996094 7 13 1.1.1.4664.4 1 62.5991 382.1136 62.5937 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 47.8300005197525 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0186978001147509 5557.83349609375 1112.574 5557.81494140625 1112.5703125 5 13 1.1.1.4579.8 1 60.5492 1218.149 60.6308 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 46.3299989700317 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0275353994220495 5572.853515625 1115.578 5572.826171875 1115.57250976563 5 13 1.1.1.4585.9 1 60.6978 12100.39 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 44.5899993181229 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@20; Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0141671998426318 5615.85009765625 936.9823 5615.8359375 936.979919433594 6 8 1.1.1.4578.3 1 60.5119 177.9754 60.5568 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 44.5899993181229 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0156266000121832 5527.82080078125 922.3107 5527.8046875 922.308044433594 6 11 1.1.1.4586.6 1 60.7135 4594.543 60.8054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 44.5899993181229 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0812738016247749 5988.98583984375 999.1716 5989.06689453125 999.185119628906 6 12 1.1.1.4638.17 1 61.9792 567.5651 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 44.1500008106232 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0554914996027946 5620.806640625 937.8084 5620.8623046875 937.817687988281 6 12 1.1.1.4592.9 1 60.8653 247.9955 60.8555 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 42.8700000047684 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@20; HexNAc(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0706216990947723 5895.92822265625 983.662 5895.99951171875 983.673828125 6 12 1.1.1.4593.12 1 60.8923 447.9384 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 37.5499993562698 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.00719405990093946 5558.83935546875 927.4805 5558.8466796875 927.481750488281 6 12 1.1.1.4593.3 1 60.8848 31854.69 61.0253 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 37.5499993562698 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0603954009711742 5624.77587890625 938.4699 5624.83642578125 938.47998046875 6 12 1.1.1.4593.5 1 60.8864 248.4724 60.8804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.2100013494492 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@20; Deamidated(N)@34; Delta:H(2)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0115785002708435 5581.82666015625 931.3117 5581.81494140625 931.309814453125 6 11 1.1.1.4603.5 1 61.134 1109.495 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.2100013494492 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Deamidated(N)@34; Formyl(K)@40 missed K-I@20; missed K-L@40 0.0384181998670101 5591.837890625 932.9803 5591.79931640625 932.973876953125 6 10 1.1.1.4676.9 1 62.8963 245.2491 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 31.1500012874603 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 -0.0100137004628778 5569.8583984375 1114.979 5569.869140625 1114.98107910156 5 11 1.1.1.4686.7 1 63.1489 308.0494 63.179 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.3099989891052 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; reduced HNE(H)@24; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.00011508799798321 5782.966796875 964.8351 5782.966796875 964.835083007813 6 12 1.1.1.4676.10 1 62.898 130.6317 62.8853 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.3499985933304 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 -0.0292099993675947 5597.8173828125 933.9768 5597.8466796875 933.981689453125 6 12 1.1.1.4638.8 1 61.9717 628.6765 61.9876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.3499985933304 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0287560001015663 5572.853515625 1115.578 5572.826171875 1115.57250976563 5 12 1.1.1.4660.5 1 62.5155 548.3256 62.4719 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.4100005626678 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0270952004939318 5599.8349609375 934.3131 5599.8623046875 934.317626953125 6 12 1.1.1.4638.9 1 61.9725 597.7183 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 21.8899995088577 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR HexNAc(N)@17; MDA adduct +54(K)@20; reduced HNE(H)@24; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 -0.0525451004505157 5971.99951171875 996.3405 5972.0517578125 996.349243164063 6 18 1.1.1.4673.3 1 62.8317 192.0834 62.7641 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 17.739999294281 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Hex(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.0461385995149612 5973.02392578125 1195.612 5973.072265625 1195.62170410156 5 11 1.1.1.4649.13 1 62.2485 276.3096 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LSSPATLNSR -0.000477872003102675 1044.55590820313 523.2852 1044.55639648438 523.285461425781 2 16 1.1.1.3140.4 1 26.3334 59475.86 26.5139 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LSSPATLNSR -0.000477872003102675 1044.55590820313 523.2852 1044.55639648438 523.285461425781 2 17 1.1.1.3147.2 1 26.5004 59828.64 26.5139 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LSSPATLNSR -0.000477872003102675 1044.55590820313 523.2852 1044.55639648438 523.285461425781 2 13 1.1.1.3155.4 1 26.6941 59828.64 26.5139 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 -4.02356017730199E-05 1045.54052734375 523.7775 1045.54040527344 523.777465820313 2 15 1.1.1.3173.5 1 27.0838 4505.745 27.1395 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 -4.02356017730199E-05 1045.54052734375 523.7775 1045.54040527344 523.777465820313 2 14 1.1.1.3181.5 1 27.2547 4505.745 27.1395 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LSSPATLNSR Oxidation(P)@4 -0.00574762979522347 1060.54553222656 531.28 1060.55126953125 531.282897949219 2 10 1.1.1.3138.12 1 26.2863 1358.806 26.5139 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LSSPATLNSR Dioxidation(P)@4 -0.00540091982111335 1076.54064941406 539.2776 1076.54614257813 539.280395507813 2 12 1.1.1.3141.4 1 26.3598 1645.648 26.4191 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LSSPATLNSR Oxidation(P)@4 -0.00391665985807776 1060.54724121094 531.2809 1060.55126953125 531.282897949219 2 12 1.1.1.3145.4 1 26.4522 1418.917 26.5139 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 -0.00223740004003048 1045.53833007813 523.7764 1045.54040527344 523.777465820313 2 12 1.1.1.3189.6 1 27.4405 1371.784 27.4771 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 92.5499975681305 LSSPATLNSR Dioxidation(P)@4 0.000580264022573829 1076.54663085938 539.2806 1076.54614257813 539.280395507813 2 12 1.1.1.3149.3 1 26.5462 2426.572 26.5376 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 63.4800016880035 LSSPATLNSR 0.00550330989062786 1044.56188964844 523.2882 1044.55639648438 523.285461425781 2 8 1.1.1.3123.8 1 25.9751 79.9339 25.9367 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 47.5600004196167 LSSPATLNSR Deamidated(N)@8 -4.02356017730199E-05 1045.54052734375 523.7775 1045.54040527344 523.777465820313 2 11 1.1.1.3181.6 1 27.2581 4505.745 27.1395 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.3099988698959 LSSPATLNSR Formyl@N-term -0.00322903995402157 1072.54809570313 537.2813 1072.55126953125 537.282897949219 2 10 1.1.1.3187.5 1 27.3969 284.2045 27.4053 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.2899994850159 NFNGNTLDNDIMLIKLSSPATLNSR HPNE addition +172(K)@15 cleaved P-N@N-term; missed K-L@15 -0.0171706005930901 2919.48388671875 974.1686 2919.50122070313 974.17431640625 3 9 1.1.1.4636.4 1 61.925 213.0202 61.9152 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 74.0700006484985 NGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@3; Dethiomethyl(M)@10; acrolein addition +76(K)@13 cleaved F-N@N-term; missed K-L@13 0.00962617993354797 2515.30151367188 839.4411 2515.29174804688 839.437866210938 3 10 1.1.1.4422.4 1 56.8783 186.989 56.7988 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.00767495017498732 1773.8974609375 887.956 1773.88977050781 887.9521484375 2 24 1.1.1.4109.8 1 49.152 1131.72 49.239 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 92.6500022411346 NKPGVYTK -0.000771370017901063 905.496276855469 453.7554 905.4970703125 453.755798339844 2 10 1.1.1.2714.2 1 17.0778 118.0589 16.9623 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 73.9199995994568 NKPGVYTK -0.00138169003184885 905.495666503906 453.7551 905.4970703125 453.755798339844 2 11 1.1.1.2699.3 1 16.7142 3414.95 16.6366 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 66.5899991989136 NKPGVYTK -0.00113756000064313 905.495849609375 453.7552 905.4970703125 453.755798339844 2 11 1.1.1.2687.2 1 16.5383 3393.269 16.6366 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.4899978637695 NTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@8; acrolein addition +76(K)@11 cleaved G-N@N-term; missed K-L@11 0.00772937014698982 2343.25122070313 782.091 2343.24340820313 782.088439941406 3 11 1.1.1.4333.5 1 54.677 1229.747 54.5463 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 NYVNWIQQTIAAN Dioxidation(W)@5 cleaved C-N@N-term 0.00743192015215755 1565.7548828125 783.8847 1565.74743652344 783.880981445313 2 10 1.1.1.4218.8 1 51.8357 185.2547 51.899 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 39.7300004959106 PNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@13; acrolein addition +56(K)@16 cleaved H-P@N-term; missed K-L@16 0.0326973013579845 2916.49780273438 973.1732 2916.46508789063 973.162292480469 3 10 1.1.1.4578.5 1 60.5152 108.6129 60.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 17.739999294281 PNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; acrolein addition +76(K)@16 cleaved H-P@N-term; missed K-L@16 0.0351357981562614 2921.494140625 974.8387 2921.45922851563 974.827026367188 3 9 1.1.1.4637.5 1 61.9549 294.6771 61.9633 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 70.2899992465973 QVRLGEHNIDVLEGNEQFINAAK Gln->pyro-Glu@N-term; Dehydrated(E)@6 cleaved I-Q@N-term; missed R-L@3 -0.0471213012933731 2558.24072265625 853.7542 2558.28784179688 853.769836425781 3 12 1.1.1.4045.11 1 47.6056 519.1265 47.5438 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 23.2500001788139 QVRLGEHNIDVLEGNEQFINAAK Gln->pyro-Glu@N-term; Dehydrated(D)@10 cleaved I-Q@N-term; missed R-L@3 -0.0584449991583824 2558.2294921875 853.7504 2558.28784179688 853.769836425781 3 12 1.1.1.4038.13 1 47.4337 521.8331 47.519 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0201701000332832 5933.033203125 989.8461 5933.05322265625 989.849487304688 6 19 1.1.1.4596.5 1 60.9655 2284.243 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0260292999446392 5933.02783203125 989.8452 5933.05322265625 989.849487304688 6 20 1.1.1.4606.5 1 61.2127 1704.99 61.1217 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +94(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0799290016293526 5988.99951171875 999.1739 5989.07958984375 999.187194824219 6 19 1.1.1.4618.5 1 61.4982 999.9643 61.5544 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.124546997249126 5894.9130859375 983.4928 5895.03759765625 983.513549804688 6 18 1.1.1.4654.5 1 62.3694 319.9742 62.3503 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; Deamidated(N)@20; acrolein addition +76(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0575446002185345 5971.9951171875 996.3398 5972.05322265625 996.349426269531 6 18 1.1.1.4655.7 1 62.3937 420.7402 62.3019 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@23; Deamidated(N)@29; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0690371990203857 5969.005859375 995.8416 5969.07470703125 995.85302734375 6 18 1.1.1.4605.6 1 61.1855 699.9085 61.1458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +94(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0905489027500153 5988.9892578125 999.1721 5989.07958984375 999.187194824219 6 17 1.1.1.4631.7 1 61.8073 817.1556 61.7708 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +94(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0769994035363197 5989.00244140625 999.1744 5989.07958984375 999.187194824219 6 18 1.1.1.4661.11 1 62.5367 443.5173 62.5937 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.124938003718853 5987.970703125 999.0024 5988.095703125 999.023193359375 6 16 1.1.1.4646.12 1 62.1756 353.7169 62.1564 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +76(K)@23; Deamidated(N)@33; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0447275005280972 5972.00830078125 996.342 5972.05322265625 996.349426269531 6 15 1.1.1.4647.14 1 62.1966 454.4389 62.205 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 97.7699995040894 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; Deamidated(N)@33; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0930885002017021 5895.92822265625 983.662 5896.02197265625 983.677551269531 6 14 1.1.1.4593.12 1 60.8923 447.9384 60.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 33.3099991083145 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@23; Deamidated(N)@37; acrolein addition +38(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.00205721007660031 6021.1064453125 1004.525 6021.10595703125 1004.52490234375 6 10 1.1.1.4580.9 1 60.5714 270.5503 60.6814 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term 0.0236763004213572 3807.826171875 952.9638 3807.80249023438 952.957885742188 4 12 1.1.1.4192.10 1 51.2049 10344.41 51.2839 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 17.739999294281 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Deamidated(N)@9; Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term 0.00747381011024117 3808.79418945313 762.7661 3808.78662109375 762.764587402344 5 10 1.1.1.4222.11 1 51.9371 700.6257 51.899 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 SRIQVRLGEHNIDVLEGNEQFINAAK Formyl@N-term; Delta:H(2)C(2)(H)@10; Deamidated(N)@11 missed R-I@2; missed R-L@6 0.0155942998826504 3004.55322265625 1002.525 3004.53662109375 1002.51947021484 3 14 1.1.1.4149.18 1 50.1453 324.7921 50.1529 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 SSGSSYPSLLQCLK Phospho(S)@8; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +38(K)@14 0.0185426995158196 1644.72924804688 823.3719 1644.71069335938 823.362609863281 2 11 1.1.1.4559.6 1 60.0502 1077.548 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 85.6299996376038 SSGSSYPSLLQCLK Phospho(S)@8; Deamidated(Q)@11; Carbamidomethyl(C)@12; acrolein addition +38(K)@14 0.0182984992861748 1644.72912597656 823.3718 1644.71069335938 823.362609863281 2 11 1.1.1.4573.3 1 60.3887 1112.571 60.2822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 SSPATLNSR Deamidated(N)@7 cleaved L-S@N-term -0.00263399002142251 932.453674316406 467.2341 932.456298828125 467.235443115234 2 9 1.1.1.2847.3 1 19.8909 206.7295 19.9044 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 16.3699999451637 SSPATLNSR cleaved L-S@N-term -0.00136198999825865 931.470886230469 466.7427 931.472290039063 466.743438720703 2 8 1.1.1.2830.2 1 19.4828 3791.228 19.594 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIK Methyl(K)@10 cleaved N-T@N-term 0.00867168977856636 1188.65112304688 595.3328 1188.64245605469 595.328491210938 2 11 1.1.1.4070.3 1 48.2088 747.6801 48.2289 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 22.7500006556511 TLDNDIMLIKL Dethiomethyl(M)@7; acrolein addition +76(K)@10 cleaved N-T@N-term; cleaved L-S@C-term; missed K-L@10 0.00905042979866266 1315.74792480469 658.8812 1315.73876953125 658.876647949219 2 7 1.1.1.4426.6 1 56.9787 169.237 57.0213 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00130004005040973 2245.197265625 749.4064 2245.19873046875 749.406860351563 3 23 1.1.1.4202.4 1 51.4503 1805.505 51.5039 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00130004005040973 2245.197265625 749.4064 2245.19873046875 749.406860351563 3 22 1.1.1.4209.5 1 51.6142 1805.505 51.5039 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00350210000760853 2229.20751953125 744.0764 2229.20385742188 744.075256347656 3 22 1.1.1.4291.4 1 53.6101 17396.8 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00350210000760853 2229.20751953125 744.0764 2229.20385742188 744.075256347656 3 20 1.1.1.4295.9 1 53.7171 17396.8 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.00350210000760853 2229.20751953125 744.0764 2229.20385742188 744.075256347656 3 25 1.1.1.4298.7 1 53.7919 17396.8 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10; Deamidated(N)@18 cleaved N-T@N-term; missed K-L@10 0.00712723983451724 2230.19482421875 744.4056 2230.18798828125 744.403259277344 3 18 1.1.1.4307.8 1 54.0223 1494.227 54.0382 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10; Deamidated(N)@18 cleaved N-T@N-term; missed K-L@10 0.00712723983451724 2230.19482421875 744.4056 2230.18798828125 744.403259277344 3 15 1.1.1.4314.8 1 54.2014 1494.227 54.0382 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Met->Hcy(M)@7; reduced acrolein addition +58(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00953952968120575 2245.18920898438 749.4037 2245.19873046875 749.406860351563 3 16 1.1.1.4216.5 1 51.7911 163.6018 51.8243 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Methyl(K)@10 cleaved N-T@N-term; missed K-L@10 0.00633620982989669 2215.19482421875 739.4055 2215.18823242188 739.4033203125 3 15 1.1.1.4292.9 1 53.64 1217.476 53.655 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.00640138005837798 2229.197265625 558.3066 2229.20385742188 558.308227539063 4 13 1.1.1.4293.3 1 53.6608 612.9154 53.7067 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000895466015208513 823.492492675781 412.7535 823.491577148438 412.753082275391 2 9 1.1.1.3323.5 1 30.4131 25035.87 30.5755 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.0017532299971208 857.495300292969 429.7549 857.4970703125 429.755798339844 2 12 1.1.1.3324.6 1 30.4389 9839.029 30.5275 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.000402384990593418 873.492492675781 437.7535 873.492004394531 437.753265380859 2 13 1.1.1.3329.3 1 30.5646 17580.91 30.5275 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000895466015208513 823.492492675781 412.7535 823.491577148438 412.753082275391 2 11 1.1.1.3330.2 1 30.5802 25035.87 30.5755 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0232005994766951 842.509460449219 422.262 842.486145019531 422.250366210938 2 11 1.1.1.3330.3 1 30.5827 180364.8 30.5755 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0232005994766951 842.509460449219 422.262 842.486145019531 422.250366210938 2 11 1.1.1.3330.4 1 30.5852 180364.8 30.5755 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 0.000199806003365666 857.497253417969 429.7559 857.4970703125 429.755798339844 2 11 1.1.1.3331.7 1 30.6066 9268.858 30.6714 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 -2.48414999077795E-05 873.492065429688 437.7533 873.492004394531 437.753265380859 2 13 1.1.1.3336.3 1 30.7263 15748.75 30.6474 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000895466015208513 823.492492675781 412.7535 823.491577148438 412.753082275391 2 12 1.1.1.3337.3 1 30.7536 24094.92 30.8148 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 0.000199806003365666 857.497253417969 429.7559 857.4970703125 429.755798339844 2 12 1.1.1.3338.4 1 30.7767 9268.858 30.6714 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.000402384990593418 873.492492675781 437.7535 873.492004394531 437.753265380859 2 13 1.1.1.3343.7 1 30.9031 16172.04 30.8867 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000895466015208513 823.492492675781 412.7535 823.491577148438 412.753082275391 2 12 1.1.1.3344.2 1 30.9161 24094.92 30.8148 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0234446991235018 842.509643554688 422.2621 842.486145019531 422.250366210938 2 12 1.1.1.3345.2 1 30.9383 168876.2 30.8867 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 0.000627033005002886 857.497680664063 429.7561 857.4970703125 429.755798339844 2 11 1.1.1.3345.5 1 30.9433 9695.108 31.0836 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.000402384990593418 873.492492675781 437.7535 873.492004394531 437.753265380859 2 13 1.1.1.3351.5 1 31.0719 16203.01 31.0836 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000651335984002799 823.492248535156 412.7534 823.491577148438 412.753082275391 2 12 1.1.1.3352.3 1 31.0941 23803.04 31.1554 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 0.000627033005002886 857.497680664063 429.7561 857.4970703125 429.755798339844 2 12 1.1.1.3353.5 1 31.1164 9647.52 31.0836 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Pro->pyro-Glu(P)@7 0.000561435997951776 855.482055664063 428.7483 855.4814453125 428.747985839844 2 12 1.1.1.3354.3 1 31.137 16286.29 31.0836 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0232005994766951 842.509460449219 422.262 842.486145019531 422.250366210938 2 11 1.1.1.3355.4 1 31.1641 167642.5 31.1315 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.000768579018767923 873.492858886719 437.7537 873.492004394531 437.753265380859 2 13 1.1.1.3358.5 1 31.2426 15505.14 31.251 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.0017532299971208 857.495300292969 429.7549 857.4970703125 429.755798339844 2 11 1.1.1.3360.4 1 31.2804 8812.169 31.2749 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0234446991235018 842.509643554688 422.2621 842.486145019531 422.250366210938 2 11 1.1.1.3362.4 1 31.3298 171238.2 31.3705 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 -0.000207938996027224 873.491882324219 437.7532 873.492004394531 437.753265380859 2 13 1.1.1.3365.5 1 31.4057 15413.32 31.3705 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.00199736002832651 857.495056152344 429.7548 857.4970703125 429.755798339844 2 11 1.1.1.3367.4 1 31.4476 9336.036 31.5617 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.000768579018767923 873.492858886719 437.7537 873.492004394531 437.753265380859 2 13 1.1.1.3372.4 1 31.5739 17504.33 31.5856 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.00199736002832651 857.495056152344 429.7548 857.4970703125 429.755798339844 2 12 1.1.1.3374.3 1 31.6159 9336.036 31.5617 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0230174995958805 842.50927734375 422.2619 842.486145019531 422.250366210938 2 11 1.1.1.3376.3 1 31.6664 150144.9 31.6096 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.000402384990593418 873.492492675781 437.7535 873.492004394531 437.753265380859 2 13 1.1.1.3379.6 1 31.7406 15449.86 31.7293 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000651335984002799 823.492248535156 412.7534 823.491577148438 412.753082275391 2 12 1.1.1.3380.3 1 31.762 21059.07 31.7532 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 0.000627033005002886 857.497680664063 429.7561 857.4970703125 429.755798339844 2 11 1.1.1.3381.4 1 31.7843 8742.003 31.7054 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Pro->pyro-Glu(P)@7 0.000561435997951776 855.482055664063 428.7483 855.4814453125 428.747985839844 2 12 1.1.1.3382.2 1 31.8058 15394.41 31.6575 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0232005994766951 842.509460449219 422.262 842.486145019531 422.250366210938 2 11 1.1.1.3383.5 1 31.8304 146760 31.7532 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0230174995958805 842.50927734375 422.2619 842.486145019531 422.250366210938 2 11 1.1.1.3384.2 1 31.8535 148686.3 31.8966 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.000402384990593418 873.492492675781 437.7535 873.492004394531 437.753265380859 2 13 1.1.1.3386.5 1 31.9054 15449.86 31.7293 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.00266540003940463 823.494262695313 412.7544 823.491577148438 412.753082275391 2 11 1.1.1.3387.2 1 31.9267 19806.28 31.8966 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.00218045990914106 857.494873046875 429.7547 857.4970703125 429.755798339844 2 12 1.1.1.3388.2 1 31.9515 8196.088 31.9683 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0230174995958805 842.50927734375 422.2619 842.486145019531 422.250366210938 2 11 1.1.1.3391.3 1 32.0223 148686.3 31.8966 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.000158256007125601 873.492248535156 437.7534 873.492004394531 437.753265380859 2 13 1.1.1.3393.5 1 32.0826 11588.22 32.0638 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.00218045990914106 857.494873046875 429.7547 857.4970703125 429.755798339844 2 12 1.1.1.3395.2 1 32.1161 8196.088 31.9683 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0232005994766951 842.509460449219 422.262 842.486145019531 422.250366210938 2 11 1.1.1.3398.2 1 32.1877 148124.1 32.1353 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.00235542003065348 873.494445800781 437.7545 873.492004394531 437.753265380859 2 13 1.1.1.3400.5 1 32.2463 12545.65 32.2308 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000468239013571292 823.492065429688 412.7533 823.491577148438 412.753082275391 2 11 1.1.1.3401.2 1 32.2601 18746.34 32.3024 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0230174995958805 842.50927734375 422.2619 842.486145019531 422.250366210938 2 11 1.1.1.3401.4 1 32.2668 137831.9 32.2785 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 0.000443936005467549 857.497497558594 429.756 857.4970703125 429.755798339844 2 11 1.1.1.3402.3 1 32.284 7646.547 32.3024 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Pro->pyro-Glu(P)@7 0.00117176002822816 855.482666015625 428.7486 855.4814453125 428.747985839844 2 12 1.1.1.3403.3 1 32.3113 13093.24 32.3264 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000468239013571292 823.492065429688 412.7533 823.491577148438 412.753082275391 2 10 1.1.1.3408.3 1 32.4274 18746.34 32.3024 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 0.000443936005467549 857.497497558594 429.756 857.4970703125 429.755798339844 2 11 1.1.1.3409.4 1 32.453 7646.547 32.3024 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.000402384990593418 873.492492675781 437.7535 873.492004394531 437.753265380859 2 13 1.1.1.3414.6 1 32.579 11075.62 32.5175 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.000468239013571292 823.492065429688 412.7533 823.491577148438 412.753082275391 2 10 1.1.1.3415.2 1 32.5936 17263.41 32.4936 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 0.000443936005467549 857.497497558594 429.756 857.4970703125 429.755798339844 2 11 1.1.1.3416.2 1 32.6175 7100.851 32.5652 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00427841022610664 869.537902832031 435.7762 869.533447265625 435.774017333984 2 11 1.1.1.3465.8 1 33.7911 174916.5 33.9751 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.0040953098796308 869.537658691406 435.7761 869.533447265625 435.774017333984 2 13 1.1.1.3472.5 1 33.9601 183976.7 34.0706 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.00185810995753855 885.5302734375 443.7724 885.528381347656 443.771453857422 2 12 1.1.1.3474.3 1 34.0094 3804.476 34.1183 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.0040953098796308 869.537658691406 435.7761 869.533447265625 435.774017333984 2 11 1.1.1.3477.3 1 34.0794 183976.7 34.0706 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.0040953098796308 869.537658691406 435.7761 869.533447265625 435.774017333984 2 13 1.1.1.3479.5 1 34.1254 183976.7 34.0706 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.0040953098796308 869.537658691406 435.7761 869.533447265625 435.774017333984 2 12 1.1.1.3486.4 1 34.2972 185484.2 34.166 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.000677496020216495 869.534301757813 435.7744 869.533447265625 435.774017333984 2 10 1.1.1.3500.7 1 34.6333 8530.65 34.3806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00366808008402586 869.537048339844 435.7758 869.533447265625 435.774017333984 2 9 1.1.1.3507.8 1 34.798 5311.736 34.5486 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.0040953098796308 869.537658691406 435.7761 869.533447265625 435.774017333984 2 11 1.1.1.3525.5 1 35.2418 2296.742 35.0584 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term 0.00525016011670232 867.523071289063 434.7688 867.517822265625 434.766174316406 2 12 1.1.1.3726.4 1 39.8223 20145.99 39.9053 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term 0.00525016011670232 867.523071289063 434.7688 867.517822265625 434.766174316406 2 11 1.1.1.3729.2 1 39.8886 20145.99 39.9053 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term 0.00525016011670232 867.523071289063 434.7688 867.517822265625 434.766174316406 2 12 1.1.1.3734.2 1 40.0073 20145.99 39.9053 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term 0.00482294009998441 867.522644042969 434.7686 867.517822265625 434.766174316406 2 12 1.1.1.3750.2 1 40.3871 11820.84 40.4039 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term 0.00482294009998441 867.522644042969 434.7686 867.517822265625 434.766174316406 2 11 1.1.1.3758.2 1 40.5738 11820.84 40.4039 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Formyl@N-term 0.00770644005388021 869.5048828125 435.7597 869.4970703125 435.755798339844 2 10 1.1.1.3920.5 1 44.4846 1408.865 44.627 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Formyl@N-term 0.00770644005388021 869.5048828125 435.7597 869.4970703125 435.755798339844 2 9 1.1.1.3924.5 1 44.5839 1408.865 44.627 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.00185810995753855 885.5302734375 443.7724 885.528381347656 443.771453857422 2 12 1.1.1.3481.6 1 34.1798 3804.476 34.1183 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 93.2699978351593 VATVSLPR 0.00426169019192457 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.4342.2 1 54.8963 714.0012 54.9173 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 92.5499975681305 VATVSLPR Dehydrated(T)@3 0.000468239013571292 823.492065429688 412.7533 823.491577148438 412.753082275391 2 10 1.1.1.3394.3 1 32.0931 20486.07 32.1353 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 92.5499975681305 VATVSLPR Pro->pyro-Glu(P)@7 0.000744533026590943 855.482299804688 428.7484 855.4814453125 428.747985839844 2 12 1.1.1.3396.3 1 32.1416 12495.07 32.1592 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 84.8299980163574 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 9 1.1.1.4157.3 1 50.3327 1700.037 50.3027 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 84.8299980163574 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 8 1.1.1.4456.2 1 57.7146 652.363 57.6866 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 84.8299980163574 VATVSLPR 0.00401755981147289 841.506286621094 421.7604 841.502136230469 421.758361816406 2 8 1.1.1.4478.2 1 58.2667 453.2092 58.2127 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 63.4800016880035 VATVSLPR 0.00427155010402203 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.3925.2 1 44.6061 1723.622 44.6765 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 61.7699980735779 VATVSLPR 0.00224760989658535 841.504455566406 421.7595 841.502136230469 421.758361816406 2 9 1.1.1.4079.2 1 48.4234 2229.36 48.4203 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 61.7699980735779 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.4561.2 1 60.0915 650.5129 60.0144 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 61.7699980735779 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 7 1.1.1.4676.2 1 62.8888 368.1184 62.861 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 60.4200005531311 VATVSLPR 0.00427155010402203 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.3978.2 1 45.9223 2180.809 46.0689 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 52.7199983596802 VATVSLPR 0.00189128995407373 841.504089355469 421.7593 841.502136230469 421.758361816406 2 10 1.1.1.3591.2 1 36.6978 1901.494 36.5506 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 52.7199983596802 VATVSLPR 0.00427155010402203 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.3985.3 1 46.0994 2180.809 46.0689 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 52.3400008678436 VATVSLPR 0.00427155010402203 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.4034.2 1 47.3256 2152.564 47.3218 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 51.5900015830994 VATVSLPR 0.00408846000209451 841.506286621094 421.7604 841.502136230469 421.758361816406 2 8 1.1.1.4006.4 1 46.6294 2339.777 46.6238 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 8 1.1.1.4150.2 1 50.1568 2263.795 50.0043 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 VATVSLPR 0.00206451001577079 841.504272460938 421.7594 841.502136230469 421.758361816406 2 8 1.1.1.4164.3 1 50.5101 1310.415 50.5051 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 8 1.1.1.4282.2 1 53.3846 1190.897 53.3078 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.4289.3 1 53.5585 1021.759 53.4792 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 VATVSLPR 0.00401755981147289 841.506286621094 421.7604 841.502136230469 421.758361816406 2 8 1.1.1.4302.3 1 53.8907 612.7646 53.8342 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 VATVSLPR 0.00444479007273912 841.506652832031 421.7606 841.502136230469 421.758361816406 2 8 1.1.1.4309.3 1 54.0694 677.4745 54.0638 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 8 1.1.1.4325.2 1 54.4741 866.1848 54.2922 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 50.3400027751923 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.4388.2 1 56.0323 414.2622 55.9776 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 49.7399985790253 VATVSLPR 0.00646871980279684 841.508666992188 421.7616 841.502136230469 421.758361816406 2 9 1.1.1.3683.4 1 38.8835 1344.288 38.8411 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 48.6000001430511 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 8 1.1.1.4317.2 1 54.2721 866.1848 54.2922 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 48.6000001430511 VATVSLPR 0.00444479007273912 841.506652832031 421.7606 841.502136230469 421.758361816406 2 8 1.1.1.4463.2 1 57.8882 638.1235 57.9332 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 48.6000001430511 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 7 1.1.1.4568.2 1 60.2613 646.0723 60.0144 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 48.6000001430511 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.5243.2 1 72.8042 513.0563 72.7197 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 48.6000001430511 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 8 1.1.1.5415.2 1 76.5791 393.2207 76.5714 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 48.3799993991852 VATVSLPR Dehydrated(T)@3 0.000651335984002799 823.492248535156 412.7534 823.491577148438 412.753082275391 2 10 1.1.1.3359.2 1 31.2548 23803.04 31.1554 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 48.3799993991852 VATVSLPR Dehydrated(T)@3 0.000468239013571292 823.492065429688 412.7533 823.491577148438 412.753082275391 2 10 1.1.1.3373.4 1 31.5911 22038.56 31.5617 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 46.3299989700317 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 9 1.1.1.4228.2 1 52.0774 1943.443 51.874 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 46.3299989700317 VATVSLPR 0.00426169019192457 841.506469726563 421.7605 841.502136230469 421.758361816406 2 9 1.1.1.4423.3 1 56.9052 524.1483 56.8975 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 46.3299989700317 VATVSLPR 0.00365136004984379 841.505859375 421.7602 841.502136230469 421.758361816406 2 7 1.1.1.4691.2 1 63.2581 391.528 63.0806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 46.3299989700317 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.5204.2 1 72.0938 411.4142 72.0602 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 46.3299989700317 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.5233.2 1 72.6217 511.8937 72.5288 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 46.3299989700317 VATVSLPR 0.00102694996166974 841.503295898438 421.7589 841.502136230469 421.758361816406 2 7 1.1.1.5531.2 1 78.6936 271.5639 78.7394 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 46.1199998855591 VATVSLPR 0.00445464998483658 841.506652832031 421.7606 841.502136230469 421.758361816406 2 8 1.1.1.4013.3 1 46.8022 2196.563 46.7478 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 45.5900013446808 VATVSLPR 0.00365136004984379 841.505859375 421.7602 841.502136230469 421.758361816406 2 8 1.1.1.4094.2 1 48.7823 2321.181 48.7553 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 45.5900013446808 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 8 1.1.1.4235.2 1 52.2513 1479.515 52.198 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 45.5900013446808 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 7 1.1.1.4653.2 1 62.3302 349.1532 62.2536 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 44.1500008106232 VATVSLPR 0.00102694996166974 841.503295898438 421.7589 841.502136230469 421.758361816406 2 8 1.1.1.4122.3 1 49.4655 2211.192 49.5351 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 44.1500008106232 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.4221.2 1 51.9029 1952.962 51.899 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 44.1500008106232 VATVSLPR 0.00444479007273912 841.506652832031 421.7606 841.502136230469 421.758361816406 2 8 1.1.1.4470.2 1 58.0673 638.1235 57.9332 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 43.299999833107 VATVSLPR 0.00427155010402203 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.4020.2 1 46.9763 2261.886 46.9722 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 42.7500009536743 VATVSLPR 0.00102694996166974 841.503295898438 421.7589 841.502136230469 421.758361816406 2 7 1.1.1.4434.2 1 57.1761 298.8906 57.1474 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 42.2600001096725 VATVSLPR 0.00646871980279684 841.508666992188 421.7616 841.502136230469 421.758361816406 2 8 1.1.1.4027.2 1 47.1521 2678.112 47.173 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 42.0700013637543 VATVSLPR 0.00206451001577079 841.504272460938 421.7594 841.502136230469 421.758361816406 2 8 1.1.1.4726.2 1 64.1571 459.5236 64.1747 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 41.9099986553192 VATVSLPR 0.00408846000209451 841.506286621094 421.7604 841.502136230469 421.758361816406 2 8 1.1.1.3971.3 1 45.7466 1837.886 45.7172 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 41.4000004529953 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.4214.4 1 51.7305 1742.252 51.7001 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 41.4000004529953 VATVSLPR -0.00117023999337107 841.501098632813 421.7578 841.502136230469 421.758361816406 2 9 1.1.1.5073.2 1 69.8026 328.0005 69.7671 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 41.4000004529953 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 7 1.1.1.5521.3 1 78.4458 367.4093 78.5617 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 40.7299995422363 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 8 1.1.1.4108.2 1 49.1202 2267.646 49.0681 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 40.2099996805191 VATVSLPR 0.00488187978044152 841.507080078125 421.7608 841.502136230469 421.758361816406 2 8 1.1.1.3909.3 1 44.2101 1557.299 44.28 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 40.0799989700317 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 9 1.1.1.4143.3 1 49.9859 2263.795 50.0043 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 40.0799989700317 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 8 1.1.1.4449.2 1 57.545 587.7052 57.4912 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 40.0799989700317 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 9 1.1.1.4503.2 1 58.8812 920.8847 58.8032 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 40.0799989700317 VATVSLPR 0.00365136004984379 841.505859375 421.7602 841.502136230469 421.758361816406 2 7 1.1.1.4683.2 1 63.0605 391.528 63.0806 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 40.0799989700317 VATVSLPR 0.00346825993619859 841.505676269531 421.7601 841.502136230469 421.758361816406 2 8 1.1.1.5083.2 1 69.9878 344.2225 69.9804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 40.0799989700317 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 8 1.1.1.5109.2 1 70.517 318.1782 70.5071 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 40.0799989700317 VATVSLPR 0.00725230015814304 841.509460449219 421.762 841.502136230469 421.758361816406 2 8 1.1.1.5487.2 1 78.0617 280.2116 78.0667 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 39.3700003623962 VATVSLPR 0.00646871980279684 841.508666992188 421.7616 841.502136230469 421.758361816406 2 8 1.1.1.3839.2 1 42.5061 1794.084 42.5749 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 38.8599991798401 VATVSLPR 0.00408846000209451 841.506286621094 421.7604 841.502136230469 421.758361816406 2 8 1.1.1.3933.6 1 44.8076 1867.366 44.8251 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 38.8000011444092 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 9 1.1.1.5267.2 1 73.3337 499.5547 73.3249 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 38.5300010442734 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 10 1.1.1.3350.2 1 31.0421 627228.5 31.1315 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 37.5499993562698 VATVSLPR 0.00102694996166974 841.503295898438 421.7589 841.502136230469 421.758361816406 2 9 1.1.1.5090.2 1 70.1614 414.0062 70.2243 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 37.5499993562698 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.5215.2 1 72.2681 487.3218 72.2607 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 37.2099995613098 VATVSLPR 0.00408846000209451 841.506286621094 421.7604 841.502136230469 421.758361816406 2 8 1.1.1.3992.6 1 46.2797 2504.455 46.3729 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 36.3400012254715 VATVSLPR 0.00426169019192457 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.4552.2 1 59.8754 708.6611 59.7687 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 36.3400012254715 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 8 1.1.1.4742.2 1 64.5191 450.2794 64.4043 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 36.3400012254715 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.4843.2 1 66.6796 345.0451 66.6964 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 36.3400012254715 VATVSLPR 0.00084385002264753 841.503051757813 421.7588 841.502136230469 421.758361816406 2 8 1.1.1.4850.2 1 66.8621 400.4972 66.9048 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 35.1700007915497 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.4048.2 1 47.6704 2213.323 47.642 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 35.1700007915497 VATVSLPR 0.00365136004984379 841.505859375 421.7602 841.502136230469 421.758361816406 2 8 1.1.1.4667.2 1 62.6736 363.7872 62.6668 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 35.1700007915497 VATVSLPR 0.0032241300214082 841.505493164063 421.76 841.502136230469 421.758361816406 2 8 1.1.1.4791.2 1 65.6129 412.7484 65.6822 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 35.1700007915497 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.5259.2 1 73.1467 541.6224 73.0976 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.9500000476837 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 8 1.1.1.3319.2 1 30.3155 620319.6 30.5036 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.3100011348724 VATVSLPR 0.00305091007612646 841.505249023438 421.7599 841.502136230469 421.758361816406 2 9 1.1.1.3568.3 1 36.1713 1637.022 36.1881 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.1699987649918 VATVSLPR Pro->pyro-Glu(P)@7 0.000988662010058761 855.482482910156 428.7485 855.4814453125 428.747985839844 2 11 1.1.1.3325.3 1 30.4612 16290.56 30.4796 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.1699987649918 VATVSLPR Pro->pyro-Glu(P)@7 0.000988662010058761 855.482482910156 428.7485 855.4814453125 428.747985839844 2 11 1.1.1.3332.4 1 30.6289 15924.95 30.6474 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.1699987649918 VATVSLPR Pro->pyro-Glu(P)@7 0.000744533026590943 855.482299804688 428.7484 855.4814453125 428.747985839844 2 11 1.1.1.3339.5 1 30.7964 15998.97 30.8627 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.1699987649918 VATVSLPR Pro->pyro-Glu(P)@7 0.000988662010058761 855.482482910156 428.7485 855.4814453125 428.747985839844 2 12 1.1.1.3346.5 1 30.9698 15977.38 31.0119 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.1699987649918 VATVSLPR Pro->pyro-Glu(P)@7 0.000988662010058761 855.482482910156 428.7485 855.4814453125 428.747985839844 2 11 1.1.1.3361.5 1 31.3076 14902.88 31.2749 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.1699987649918 VATVSLPR Pro->pyro-Glu(P)@7 0.000988662010058761 855.482482910156 428.7485 855.4814453125 428.747985839844 2 12 1.1.1.3368.4 1 31.4782 15942.21 31.5617 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.1699987649918 VATVSLPR Pro->pyro-Glu(P)@7 0.000561435997951776 855.482055664063 428.7483 855.4814453125 428.747985839844 2 12 1.1.1.3375.4 1 31.6424 15394.41 31.6575 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.1699987649918 VATVSLPR Formyl@N-term 0.00770644005388021 869.5048828125 435.7597 869.4970703125 435.755798339844 2 9 1.1.1.3927.4 1 44.6573 1408.865 44.627 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 34.0400010347366 VATVSLPR 0.00102694996166974 841.503295898438 421.7589 841.502136230469 421.758361816406 2 8 1.1.1.5225.2 1 72.4517 472.5846 72.4168 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 33.4800004959106 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.5322.2 1 74.58 443.6151 74.5968 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 33.1999987363815 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 8 1.1.1.4734.2 1 64.3278 467.3502 64.2676 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.7399998903275 VATVSLPR 0.00390535988844931 841.506103515625 421.7603 841.502136230469 421.758361816406 2 9 1.1.1.3399.2 1 32.2107 568251.6 32.1353 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.4099987745285 VATVSLPR Pro->pyro-Glu(P)@7 0.000744533026590943 855.482299804688 428.7484 855.4814453125 428.747985839844 2 11 1.1.1.3396.2 1 32.1391 12495.07 32.1592 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.3900014162064 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 8 1.1.1.4055.2 1 47.8436 2351.426 47.7656 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.3900014162064 VATVSLPR 0.00426169019192457 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.4719.2 1 63.9773 434.4209 63.7892 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.3900014162064 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 8 1.1.1.5333.2 1 74.7522 453.301 74.7442 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.3900014162064 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 8 1.1.1.5349.2 1 75.0968 418.4032 75.062 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 32.3900014162064 VATVSLPR 0.00365136004984379 841.505859375 421.7602 841.502136230469 421.758361816406 2 8 1.1.1.5384.2 1 75.845 349.5839 75.8585 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 31.8599998950958 VATVSLPR 0.00426169019192457 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.4712.2 1 63.7971 434.4209 63.7892 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 31.8599998950958 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.5313.2 1 74.4025 440.0457 74.3674 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 31.2000006437302 VATVSLPR 0.00390535988844931 841.506103515625 421.7603 841.502136230469 421.758361816406 2 10 1.1.1.3397.4 1 32.1663 568251.6 32.1353 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 31.2000006437302 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 10 1.1.1.3404.4 1 32.3335 518816.6 32.3024 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 31.2000006437302 VATVSLPR 0.00665182014927268 841.508850097656 421.7617 841.502136230469 421.758361816406 2 8 1.1.1.3744.2 1 40.2412 1526.462 40.285 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Deamidated(R)@8 0.0232005994766951 842.509460449219 422.262 842.486145019531 422.250366210938 2 10 1.1.1.3323.7 1 30.4148 180364.8 30.5755 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Deamidated(R)@8 0.0234446991235018 842.509643554688 422.2621 842.486145019531 422.250366210938 2 10 1.1.1.3338.2 1 30.7717 168876.2 30.8867 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Dehydrated(T)@3 0.000651335984002799 823.492248535156 412.7534 823.491577148438 412.753082275391 2 10 1.1.1.3366.4 1 31.4254 23834.63 31.3705 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Deamidated(R)@8 0.0232005994766951 842.509460449219 422.262 842.486145019531 422.250366210938 2 10 1.1.1.3369.4 1 31.4971 164343.5 31.49 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Deamidated(R)@8 0.0230174995958805 842.50927734375 422.2619 842.486145019531 422.250366210938 2 10 1.1.1.3377.2 1 31.6852 150144.9 31.6096 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Dioxidation(P)@7 0.000402384990593418 873.492492675781 437.7535 873.492004394531 437.753265380859 2 11 1.1.1.3407.5 1 32.4069 12675.09 32.3264 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Pro->pyro-Glu(P)@7 0.000988662010058761 855.482482910156 428.7485 855.4814453125 428.747985839844 2 11 1.1.1.3410.3 1 32.4752 13036.71 32.3742 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Deamidated(R)@8 0.0230174995958805 842.50927734375 422.2619 842.486145019531 422.250366210938 2 10 1.1.1.3415.3 1 32.5961 124280.5 32.4936 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Pro->pyro-Glu(P)@7 0.0409649014472961 855.5224609375 428.7685 855.4814453125 428.747985839844 2 11 1.1.1.3417.2 1 32.6406 365173.3 32.8276 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 -0.000583184009883553 885.527893066406 443.7712 885.528381347656 443.771453857422 2 12 1.1.1.3467.4 1 33.846 3264.486 33.8792 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Delta:H(4)C(2)@N-term 0.0040953098796308 869.537658691406 435.7761 869.533447265625 435.774017333984 2 9 1.1.1.3470.7 1 33.9139 183976.7 34.0706 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Pro->pyro-Glu(P)@7 0.0381573997437954 855.519653320313 428.7671 855.4814453125 428.747985839844 2 11 1.1.1.3474.2 1 34.0053 1422.148 34.0706 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Delta:H(2)C(2)@N-term 0.00500603020191193 867.522888183594 434.7687 867.517822265625 434.766174316406 2 10 1.1.1.3742.3 1 40.1988 17602.27 39.9528 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 30.6800007820129 VATVSLPR Delta:H(2)C(2)@N-term 0.00763043016195297 867.525451660156 434.77 867.517822265625 434.766174316406 2 10 1.1.1.3773.2 1 40.9322 855.7375 40.856 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 29.8099994659424 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.5275.2 1 73.503 476.3312 73.5198 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 29.0899991989136 VATVSLPR 0.00305091007612646 841.505249023438 421.7599 841.502136230469 421.758361816406 2 9 1.1.1.3511.5 1 34.8927 5221.89 34.9845 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.9799988269806 VATVSLPR Deamidated(R)@8 0.0234446991235018 842.509643554688 422.2621 842.486145019531 422.250366210938 2 10 1.1.1.3347.4 1 30.9912 168876.2 30.8867 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.9799988269806 VATVSLPR Formyl@N-term 0.00770644005388021 869.5048828125 435.7597 869.4970703125 435.755798339844 2 9 1.1.1.3934.2 1 44.8297 1408.865 44.627 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.4900009632111 VATVSLPR 0.00390535988844931 841.506103515625 421.7603 841.502136230469 421.758361816406 2 10 1.1.1.3363.2 1 31.3529 658315.9 31.3705 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.3499985933304 VATVSLPR 0.00102694996166974 841.503295898438 421.7589 841.502136230469 421.758361816406 2 8 1.1.1.4086.2 1 48.5916 2411.505 48.6835 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.3499985933304 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.5173.2 1 71.5619 466.672 71.524 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.3499985933304 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 8 1.1.1.5283.2 1 73.6909 577.8467 73.7076 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.2000005245209 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 10 1.1.1.3326.3 1 30.486 652488.3 30.5755 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.2000005245209 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 10 1.1.1.3333.3 1 30.6529 652488.3 30.5755 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.2000005245209 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 10 1.1.1.3340.2 1 30.8195 623147.8 30.8867 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.2000005245209 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 10 1.1.1.3347.3 1 30.9887 623147.8 30.8867 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.2000005245209 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 10 1.1.1.3355.3 1 31.1616 627228.5 31.1315 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.2000005245209 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 10 1.1.1.3369.2 1 31.4938 629981.3 31.5139 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 28.2000005245209 VATVSLPR 0.00366122997365892 841.505859375 421.7602 841.502136230469 421.758361816406 2 10 1.1.1.3390.4 1 31.9993 553199.3 31.9443 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.9000014066696 VATVSLPR 0.00390535988844931 841.506103515625 421.7603 841.502136230469 421.758361816406 2 10 1.1.1.3362.3 1 31.3281 658315.9 31.3705 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.9000014066696 VATVSLPR 0.00347813009284437 841.505676269531 421.7601 841.502136230469 421.758361816406 2 10 1.1.1.3376.2 1 31.663 568933.2 31.6096 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.9000014066696 VATVSLPR 0.00408846000209451 841.506286621094 421.7604 841.502136230469 421.758361816406 2 8 1.1.1.3999.5 1 46.4552 2550.667 46.4736 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.8800010681152 VATVSLPR 0.00365136004984379 841.505859375 421.7602 841.502136230469 421.758361816406 2 8 1.1.1.5290.2 1 73.8656 511.6311 73.9341 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.3099988698959 VATVSLPR Delta:H(4)C(2)@N-term 0.00427841022610664 869.537902832031 435.7762 869.533447265625 435.774017333984 2 7 1.1.1.3463.7 1 33.7415 172754.2 33.9751 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.3099988698959 VATVSLPR Delta:H(4)C(2)@N-term 0.0040953098796308 869.537658691406 435.7761 869.533447265625 435.774017333984 2 10 1.1.1.3484.3 1 34.2463 181083.9 34.1899 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.3099988698959 VATVSLPR Pro->pyro-Glu(P)@7 0.0365705005824566 855.51806640625 428.7663 855.4814453125 428.747985839844 2 7 1.1.1.3502.6 1 34.6757 837.0425 34.6451 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 27.0300000905991 VATVSLPR 0.00665182014927268 841.508850097656 421.7617 841.502136230469 421.758361816406 2 8 1.1.1.3583.2 1 36.5067 1948.26 36.4554 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.9499987363815 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.4275.2 1 53.2148 1215.392 53.2106 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.9499987363815 VATVSLPR 0.00206451001577079 841.504272460938 421.7594 841.502136230469 421.758361816406 2 8 1.1.1.4705.2 1 63.6182 375.6479 63.5579 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.9499987363815 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 8 1.1.1.5064.2 1 69.6344 374.722 69.6149 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.9499987363815 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 8 1.1.1.5408.2 1 76.3984 393.2207 76.5714 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.9499987363815 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 8 1.1.1.5422.2 1 76.7636 393.2207 76.5714 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.7399996519089 VATVSLPR 0.00445464998483658 841.506652832031 421.7606 841.502136230469 421.758361816406 2 8 1.1.1.3950.2 1 45.2257 2074.124 45.2458 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.4999985694885 VATVSLPR 0.00084385002264753 841.503051757813 421.7588 841.502136230469 421.758361816406 2 6 1.1.1.5461.2 1 77.4803 411.2146 77.5004 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.0500013828278 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 7 1.1.1.4207.3 1 51.5569 2022.258 51.4796 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.0500013828278 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 9 1.1.1.4984.2 1 68.6142 414.542 68.5675 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 26.0500013828278 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.5251.2 1 72.976 541.746 73.0976 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 25.8799999952316 VATVSLPR 0.00390535988844931 841.506103515625 421.7603 841.502136230469 421.758361816406 2 8 1.1.1.3634.2 1 37.7017 1596.097 37.7218 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 25.6599992513657 VATVSLPR Dehydrated(T)@3 0.00266540003940463 823.494262695313 412.7544 823.491577148438 412.753082275391 2 7 1.1.1.3429.2 1 32.9266 8066.945 32.6844 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 25.6599992513657 VATVSLPR Pro->pyro-Glu(P)@7 0.0407817997038364 855.522277832031 428.7684 855.4814453125 428.747985839844 2 11 1.1.1.3445.3 1 33.3117 79876.95 33.0657 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 25.6599992513657 VATVSLPR Delta:H(4)C(2)@N-term 0.00391220999881625 869.537475585938 435.776 869.533447265625 435.774017333984 2 10 1.1.1.3493.8 1 34.4613 143975.7 34.2138 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 24.7500002384186 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 9 1.1.1.4767.2 1 65.0896 430.379 65.0271 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 24.7500002384186 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 9 1.1.1.4783.2 1 65.4522 434.3334 65.4053 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 24.7500002384186 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.5144.2 1 71.0357 368.0925 71.0227 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 24.7500002384186 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 9 1.1.1.5452.2 1 77.2743 453.5556 77.2068 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 24.3300005793571 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.5184.2 1 71.734 459.394 71.6952 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 24.0500003099442 VATVSLPR Dioxidation(P)@7 0.000402384990593418 873.492492675781 437.7535 873.492004394531 437.753265380859 2 11 1.1.1.3421.5 1 32.7408 11090.74 32.5175 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 24.0500003099442 VATVSLPR Delta:H(4)C(2)@N-term 0.00427841022610664 869.537902832031 435.7762 869.533447265625 435.774017333984 2 10 1.1.1.3458.5 1 33.6228 116592.9 33.8553 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 23.5100001096725 VATVSLPR 0.00426169019192457 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.4064.2 1 48.0652 1804.169 48.0373 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 23.1000006198883 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.4776.2 1 65.2609 399.4066 65.2744 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 23.1000006198883 VATVSLPR 0.00365136004984379 841.505859375 421.7602 841.502136230469 421.758361816406 2 8 1.1.1.5298.2 1 74.0533 488.0782 73.9928 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 22.4600002169609 VATVSLPR Pro->pyro-Glu(P)@7 0.000561435997951776 855.482055664063 428.7483 855.4814453125 428.747985839844 2 11 1.1.1.3389.3 1 31.9771 13635 31.9921 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 22.4600002169609 VATVSLPR Delta:H(2)C(2)@N-term 0.00482294009998441 867.522644042969 434.7686 867.517822265625 434.766174316406 2 10 1.1.1.3718.4 1 39.6536 15877.49 39.8578 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 22.3199993371964 VATVSLPR -0.000743005017284304 841.50146484375 421.758 841.502136230469 421.758361816406 2 8 1.1.1.5122.2 1 70.6877 365.3265 70.7867 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 22.3199993371964 VATVSLPR 0.00102694996166974 841.503295898438 421.7589 841.502136230469 421.758361816406 2 9 1.1.1.5157.2 1 71.2139 380.7457 71.1662 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 22.3199993371964 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.5191.2 1 71.914 507.1833 71.8509 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 21.9300001859665 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 8 1.1.1.5100.2 1 70.3497 326.544 70.3876 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 21.5499997138977 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 8 1.1.1.5365.3 1 75.4808 479.962 75.4326 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 20.440000295639 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 5 1.1.1.4584.2 1 60.6605 294.5125 60.5814 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 20.0800001621246 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 8 1.1.1.4071.3 1 48.2343 2215.795 48.4203 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 20.0800001621246 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 8 1.1.1.4136.3 1 49.8129 2311.712 49.782 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 20.0800001621246 VATVSLPR 0.00401755981147289 841.506286621094 421.7604 841.502136230469 421.758361816406 2 8 1.1.1.4485.2 1 58.4436 543.9464 58.5364 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 20.0800001621246 VATVSLPR 0.0060316501185298 841.50830078125 421.7614 841.502136230469 421.758361816406 2 8 1.1.1.4529.2 1 59.4223 780.1024 59.2736 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 20.0800001621246 VATVSLPR -0.00117023999337107 841.501098632813 421.7578 841.502136230469 421.758361816406 2 9 1.1.1.5042.2 1 69.2992 432.4758 69.3561 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 19.7200000286102 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 8 1.1.1.4115.2 1 49.2928 2103.626 49.2882 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 19.7200000286102 VATVSLPR 0.00163727998733521 841.503845214844 421.7592 841.502136230469 421.758361816406 2 8 1.1.1.4129.2 1 49.6385 2311.712 49.782 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 19.7200000286102 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 9 1.1.1.4492.2 1 58.6239 790.9027 58.6612 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 19.7200000286102 VATVSLPR 0.00426169019192457 841.506469726563 421.7605 841.502136230469 421.758361816406 2 8 1.1.1.4538.2 1 59.6169 777.942 59.6574 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 19.030000269413 VATVSLPR 0.00383445993065834 841.506103515625 421.7603 841.502136230469 421.758361816406 2 8 1.1.1.4041.2 1 47.4989 2078.246 47.47 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 19.030000269413 VATVSLPR 0.00645887991413474 841.508666992188 421.7616 841.502136230469 421.758361816406 2 5 1.1.1.4306.2 1 53.9916 690.1582 53.9618 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 18.019999563694 VATVSLPR 0.00182037998456508 841.504089355469 421.7593 841.502136230469 421.758361816406 2 8 1.1.1.4200.2 1 51.3875 2022.258 51.4796 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 17.6899999380112 VATVSLPR 0.00145417999010533 841.503662109375 421.7591 841.502136230469 421.758361816406 2 8 1.1.1.4193.2 1 51.2151 1882.848 51.1134 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 16.7400002479553 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 9 1.1.1.4968.2 1 68.4389 405.4861 68.4781 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 16.3699999451637 VATVSLPR Carbamidomethyl@N-term -0.0276123005896807 898.49609375 450.2553 898.523620605469 450.269073486328 2 8 1.1.1.3360.6 1 31.2837 320.0376 31.227 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 16.3699999451637 VATVSLPR Delta:H(4)C(2)@N-term 0.00189813994802535 869.535461425781 435.775 869.533447265625 435.774017333984 2 8 1.1.1.3514.9 1 34.9694 3992.989 34.7174 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 15.5200004577637 VATVSLPR 0.00127107999287546 841.503479003906 421.759 841.502136230469 421.758361816406 2 9 1.1.1.4268.2 1 53.0482 1626.771 52.8968 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 90.0200009346008 VATVSLPRSCAAAGTECLISGWGNTK Oxidation(P)@7; Carbamidomethyl(C)@10; Carbamidomethyl(C)@17; FormaldehydeAdduct(W)@22; reduced acrolein addition +58(K)@26 missed R-S@8 0.00414732983335853 2791.36743164063 931.4631 2791.36328125 931.461730957031 3 12 1.1.1.4173.6 1 50.7478 1119.907 50.8008 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.0173186007887125 1869.83764648438 935.9261 1869.8203125 935.917419433594 2 18 1.1.1.4705.4 1 63.6299 1561.408 63.43 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.0136566003784537 1869.83410644531 935.9243 1869.8203125 935.917419433594 2 17 1.1.1.4712.4 1 63.8055 920.062 63.5317 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.0173186007887125 1869.83764648438 935.9261 1869.8203125 935.917419433594 2 17 1.1.1.4691.7 1 63.2706 1561.408 63.43 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VCNYVNWIQQTIAAN Carbamyl@N-term; Carbamidomethyl(C)@2; Deamidated(N)@3; Dioxidation(Y)@4; Deamidated(N)@6 0.0173186007887125 1869.83764648438 935.9261 1869.8203125 935.917419433594 2 17 1.1.1.4698.4 1 63.4459 1561.408 63.43 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@40; MDA adduct +62(K)@42; Carbamyl(R)@44 cleaved I-V@N-term; missed K-S@42 -0.0193013995885849 4877.19775390625 813.8736 4877.21728515625 813.876831054688 6 15 1.1.1.4330.7 1 54.6043 5257.849 54.646 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 98.0199992656708 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@40; Delta:H(4)C(2)(K)@42 cleaved I-V@N-term; missed K-S@42 0.0192176997661591 4800.24658203125 961.0566 4800.22705078125 961.052734375 5 14 1.1.1.4257.3 1 52.7962 7533.865 52.873 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.7899978160858 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@40; MDA adduct +62(K)@42; Carbamyl(R)@44 cleaved I-V@N-term; missed K-S@42 0.00839503016322851 4877.2255859375 976.4524 4877.21728515625 976.450744628906 5 14 1.1.1.4338.6 1 54.8032 36914.28 54.646 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 96.3599979877472 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@6; Ammonia-loss(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@40; MDA adduct +62(K)@42; Carbamyl(R)@44 cleaved I-V@N-term; missed K-S@42 0.00839503016322851 4877.2255859375 976.4524 4877.21728515625 976.450744628906 5 14 1.1.1.4331.10 1 54.6318 36914.28 54.646 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 55.0100028514862 VLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@27; acrolein addition +56(K)@33 cleaved D-V@N-term; missed K-I@13; missed K-L@33 0.0283320993185043 4779.48193359375 956.9037 4779.4541015625 956.898132324219 5 11 1.1.1.4589.11 1 60.792 572.1794 60.7804 2 88.83 88.83 83.5500001907349 74.4599997997284 66.6700005531311 cont|000141; cont|000040 spt|P00761| Trypsin precursor (EC 3.4.21.4) [Sus scrofa (contaminant)]; gi|2914482|pdb|1TFX|A Chain A, Complex Of The Second Kunitz Domain Of Tissue Factor Pathway Inhibitor With Porcine Trypsin [Sus scrofa (contaminant)] 0 99.0000009536743 YVNWIQQTIAAN cleaved N-Y@N-term 0.00582766998559237 1419.72045898438 710.8675 1419.71472167969 710.864624023438 2 16 1.1.1.4315.4 1 54.2231 3114.961 54.3418 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 AEAESLYQSK 0.000169738996191882 1124.53503417969 563.2748 1124.53491210938 563.274780273438 2 15 1.1.1.3084.4 1 25.0207 145.7465 25.0324 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 FLEQQNQVLQTKWELLQQVDTSTR missed K-W@12 0.0180248003453016 2931.52709960938 978.183 2931.50903320313 978.176940917969 3 22 1.1.1.4279.10 1 53.3188 795.8683 53.3567 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 GENALKDAK missed K-D@6 4.76423010695726E-05 944.492858886719 473.2537 944.492736816406 473.253631591797 2 10 1.1.1.2712.2 1 17.021 73.3478 17.0586 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR -0.00630574021488428 2382.93823242188 795.32 2382.94458007813 795.322143554688 3 39 1.1.1.3068.3 1 24.6359 414.3622 24.6658 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 GSGGGSSGGSIGGR 0.00160603004042059 1091.49731445313 546.7559 1091.49560546875 546.755065917969 2 20 1.1.1.2698.3 1 16.6901 894.1838 16.5781 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 IEISELNR 0.00526374019682407 972.529296875 487.2719 972.523986816406 487.269287109375 2 12 1.1.1.3526.3 0 35.2696 485.3795 35.2568 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 LLEGEESR cleaved T-L@N-term 0.0030357800424099 931.464050292969 466.7393 931.461059570313 466.737823486328 2 9 1.1.1.2960.2 0 22.168 378.3128 22.1881 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 LRSEIDNVKK missed R-S@2; missed K-K@9 0.00138134998269379 1200.68408203125 601.3493 1200.6826171875 601.348571777344 2 13 1.1.1.2846.4 1 19.8752 355.4066 19.9044 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 RVDQLKSDQSR missed R-V@1; missed K-S@6 -0.00672583002597094 1330.6884765625 444.5701 1330.6953125 444.572387695313 3 14 1.1.1.2715.2 1 17.094 239.5093 17.1074 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SLDLDSIIAEVK 0.00439290981739759 1301.71228027344 651.8634 1301.70788574219 651.861206054688 2 14 1.1.1.4429.4 1 57.053 852.9844 57.1227 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 SLNNQFASFIDKVR missed K-V@12 -0.00121918995864689 1637.85131835938 546.9577 1637.8525390625 546.958129882813 3 11 1.1.1.4230.4 1 52.1286 1210.496 52.2228 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 THNLEPYFESFINNLR 0.00541514018550515 1992.97485351563 665.3322 1992.96936035156 665.330383300781 3 20 1.1.1.4460.4 1 57.8167 229.4413 57.8088 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 THNLEPYFESFINNLRR missed R-R@16 0.00932755973190069 2149.07983398438 538.2772 2149.07055664063 538.27490234375 4 12 1.1.1.4367.2 1 55.5137 297.602 55.5101 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 TLLEGEESR -0.00212639989331365 1032.50671386719 517.2606 1032.5087890625 517.261657714844 2 10 1.1.1.3133.4 1 26.1607 2229.849 26.2981 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 TNAENEFVTIKK missed K-K@11 0.00611041020601988 1392.73107910156 697.3728 1392.72485351563 697.369750976563 2 18 1.1.1.3286.6 1 29.5449 331.448 29.55 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 1.42021656036377 99.0000009536743 AEAESLYQSKYEELQITAGR missed K-Y@10 0.0175928995013237 2285.13525390625 762.719 2285.11767578125 762.713134765625 3 10 1.1.1.3944.10 1 45.0888 101.5131 45.1467 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 1.05551731586456 97.9499995708466 AQYEDIAQK 0.00112857995554805 1064.51501464844 533.2648 1064.51379394531 533.264221191406 2 11 1.1.1.3071.6 1 24.7105 604.6602 24.7886 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.136082619428635 62.7600014209747 SLVNLGGSK 0.000768574012909085 873.492858886719 437.7537 873.492004394531 437.753265380859 2 11 1.1.1.3322.3 1 30.3923 18484.92 30.4556 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.106793247163296 99.0000009536743 SYGSGGGSYGSGGGGGGHGSYGSGSSSGGYR Carbamidomethyl@N-term cleaved S-S@N-term 0.0054878699593246 2716.08251953125 906.3681 2716.0771484375 906.366271972656 3 26 1.1.1.3064.6 1 24.5375 364.9867 24.5916 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.0788339450955391 47.7400004863739 RRVDQLK missed R-R@1; missed R-V@2 0.000596233992837369 913.546447753906 457.7805 913.545776367188 457.780151367188 2 9 1.1.1.2697.2 1 16.666 175.3787 16.6421 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0.0236500203609467 54.4099986553192 DVDGAYMTK Oxidation(M)@7 0.00376128009520471 1014.43664550781 508.2256 1014.43280029297 508.223693847656 2 9 1.1.1.2913.5 1 21.0777 246.6503 21.0828 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 96.450001001358 AQYEDIAQK 0.00112857995554805 1064.51501464844 533.2648 1064.51379394531 533.264221191406 2 9 1.1.1.3078.5 1 24.8771 604.6602 24.7886 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR Ser->LacticAcid(S)@20; Dioxidation(Y)@21 0.0430378988385201 2399.96655273438 800.9961 2399.92358398438 800.981750488281 3 22 1.1.1.3069.3 1 24.6607 283.247 24.6658 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 GSGGGSSGGSIGGR 0.00160603004042059 1091.49731445313 546.7559 1091.49560546875 546.755065917969 2 20 1.1.1.2686.3 1 16.5145 899.3867 16.5781 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 SLDLDSIIAEVK 0.00439290981739759 1301.71228027344 651.8634 1301.70788574219 651.861206054688 2 12 1.1.1.4436.4 1 57.2272 852.9844 57.1227 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 20.0800001621246 THNLEPYFESFINNLRR missed R-R@16 -0.00133853999432176 2149.06884765625 717.3636 2149.07055664063 717.364135742188 3 10 1.1.1.4371.4 1 55.6153 891.1409 55.5589 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 TLLEGEESR -0.00212639989331365 1032.50671386719 517.2606 1032.5087890625 517.261657714844 2 12 1.1.1.3140.3 1 26.3309 2229.849 26.2981 3 32.82 32.82 46.2700009346008 38.6599987745285 35.8700007200241 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 TLLEGEESR -0.00212639989331365 1032.50671386719 517.2606 1032.5087890625 517.261657714844 2 13 1.1.1.3148.2 1 26.5241 2422.288 26.2731 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 AKLEAAVAEAEQQGEAALSDAR missed K-L@2 0.0030063099693507 2227.11108398438 743.3776 2227.10815429688 743.376647949219 3 20 1.1.1.4210.9 1 51.6356 541.7534 51.6754 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 AQYDDVASR 9.34765994315967E-05 1023.46228027344 512.7384 1023.46215820313 512.738342285156 2 13 1.1.1.2966.3 1 22.3072 745.7991 22.4076 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 FAAFIDKVR missed K-V@7 0.00581680005416274 1065.60290527344 533.8087 1065.59716796875 533.805847167969 2 13 1.1.1.3657.4 0 38.2642 1523.466 38.293 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 LAELEGALQK 0.00931920018047094 1070.6064453125 536.3105 1070.59716796875 536.305847167969 2 17 1.1.1.3603.7 0 36.9973 1345.019 36.9548 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 LASELNHVQEVLEGYK -0.00309207988902926 1827.93359375 610.3185 1827.93664550781 610.319519042969 3 16 1.1.1.4151.4 0 50.1858 388.9516 50.2025 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 LEAAVAEAEQQGEAALSDAR 0.0192166995257139 2027.99548339844 1015.005 2027.97595214844 1014.99523925781 2 16 1.1.1.4128.19 1 49.6272 371.0766 49.5598 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 LGLDIEIATYR 0.00605332013219595 1262.69311523438 632.3538 1262.68701171875 632.350830078125 2 15 1.1.1.4221.8 0 51.9121 337.096 51.9488 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 LTAEIENAK -0.000874329009093344 987.522888183594 494.7687 987.523681640625 494.769104003906 2 9 1.1.1.3111.9 1 25.676 586.3254 25.6911 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 RLYEEEIR missed R-L@1 0.00089575897436589 1106.57312011719 554.2938 1106.57202148438 554.293273925781 2 12 1.1.1.3128.4 0 26.042 435.508 25.9967 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 SRAEAESWYR missed R-A@2 -0.0038308899383992 1253.57495117188 418.8656 1253.57885742188 418.866912841797 3 11 1.1.1.3130.4 0 26.0811 346.0271 26.1003 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 2 99.0000009536743 TKEEINELNR missed K-E@2 0.00122144003398716 1244.63732910156 623.3259 1244.63610839844 623.325317382813 2 17 1.1.1.3031.2 0 23.758 850.7991 23.7146 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0.856985211372375 96.8100011348724 LASELNHVQEVLEGYKK missed K-K@16 -0.00844611041247845 1956.02319335938 653.015 1956.03161621094 653.017822265625 3 12 1.1.1.4033.6 0 47.3042 668.7318 47.3218 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0.122628659009933 61.4499986171722 AEAESWYR 0.0058232001028955 1010.45166015625 506.2331 1010.44573974609 506.230163574219 2 11 1.1.1.3256.2 0 28.8703 439.2124 28.8991 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0.0644927322864532 43.8199996948242 HGETLRR missed R-R@6 -0.000656431016977876 867.466857910156 434.7407 867.467468261719 434.741027832031 2 9 1.1.1.2412.2 0 14.1516 145.0557 14.1631 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0.0186344906687737 50.3000020980835 EYQEVMNSK Oxidation(M)@6 0.00230864994227886 1142.49389648438 572.2542 1142.49133300781 572.252990722656 2 11 1.1.1.2789.5 0 18.6434 521.7646 18.6723 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0 37.2099995613098 AQYDDVASR 9.34765994315967E-05 1023.46228027344 512.7384 1023.46215820313 512.738342285156 2 8 1.1.1.2973.5 1 22.467 745.7991 22.4076 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0 21.1999997496605 EYQEVMNSK Oxidation(M)@6 0.00230864994227886 1142.49389648438 572.2542 1142.49133300781 572.252990722656 2 9 1.1.1.2796.5 0 18.8106 521.7646 18.6723 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0 60.4200005531311 LAELEGALQK 0.0231125000864267 1070.62023925781 536.3174 1070.59716796875 536.305847167969 2 11 1.1.1.3595.6 0 36.807 576.4236 36.8359 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0 45.4100012779236 LASELNHVQEVLEGYKK missed K-K@16 -0.00557002983987331 1956.02612304688 490.0138 1956.03161621094 490.015197753906 4 11 1.1.1.4034.5 0 47.3281 393.924 47.3218 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0 36.3400012254715 LEAAVAEAEQQGEAALSDAR 0.0208036005496979 2027.99743652344 1015.006 2027.97595214844 1014.99523925781 2 10 1.1.1.4121.16 1 49.4541 365.4279 49.5351 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0 99.0000009536743 SRAEAESWYR missed R-A@2 0.00039600400486961 1253.57922363281 627.7969 1253.57885742188 627.796752929688 2 13 1.1.1.3130.14 0 26.0895 330.1438 26.1003 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0 99.0000009536743 TKEEINELNR missed K-E@2 0.00122144003398716 1244.63732910156 623.3259 1244.63610839844 623.325317382813 2 14 1.1.1.3024.4 0 23.5843 850.7991 23.7146 4 23.06 23.06 45.7599997520447 24.4599997997284 22.6799994707108 sp|P78386|KRT85_HUMAN Keratin, type II cuticular Hb5 OS=Homo sapiens GN=KRT85 PE=1 SV=1 0 99.0000009536743 TKEEINELNR missed K-E@2 -0.00273823994211853 1244.63342285156 415.8851 1244.63610839844 415.885955810547 3 11 1.1.1.3025.3 0 23.6068 1061.585 23.7388 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 AATVGSLAGQPLQER -0.00014783900405746 1496.79443359375 749.4045 1496.79467773438 749.404602050781 2 26 1.1.1.3631.3 1 37.6453 2551.11 37.6504 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 AKLEEQAQQIR missed K-L@2 -0.00245623011142015 1312.70727539063 438.5764 1312.7099609375 438.577239990234 3 13 1.1.1.3062.4 1 24.4887 202.0411 24.4452 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 AKLEEQAQQIRLQAEAFQAR missed K-L@2; missed R-L@11 -0.0074752401560545 2327.22680664063 776.7496 2327.23461914063 776.752136230469 3 14 1.1.1.3948.14 1 45.1854 845.8378 45.221 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LAVYQAGAR -0.00128085003234446 947.517700195313 474.7661 947.518859863281 474.766723632813 2 13 1.1.1.3151.4 1 26.5944 1449.839 26.6324 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LGADMEDVCGR Oxidation(M)@5; Carbamidomethyl(C)@9 -0.000824221002403647 1237.50610351563 619.7603 1237.50671386719 619.760620117188 2 14 1.1.1.3070.6 1 24.6823 669.3276 24.5916 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LGPLVEQGRVR missed R-V@9 0.0117853004485369 1222.72644042969 612.3705 1222.71459960938 612.364562988281 2 12 1.1.1.3261.6 1 28.9888 405.6423 28.9701 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LQAEAFQAR 0.000191365004866384 1032.53552246094 517.275 1032.53527832031 517.27490234375 2 12 1.1.1.3224.2 1 28.2306 556.4536 28.2474 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 LSKELQAAQAR missed K-E@3 -0.00151513994205743 1213.67651367188 607.8455 1213.67785644531 607.84619140625 2 19 1.1.1.2961.2 1 22.2067 709.1115 22.241 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 RLAVYQAGAR missed R-L@1 -0.000784368021413684 1103.61926269531 552.8169 1103.61999511719 552.817260742188 2 14 1.1.1.3055.4 1 24.3339 200.446 24.3193 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 TRDRLDEVKEQVAEVR missed R-D@2; missed R-L@4; missed K-E@9 -0.00809687003493309 1942.01489257813 486.511 1942.02319335938 486.513092041016 4 18 1.1.1.3515.5 1 34.9973 1174.841 34.9845 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 2 99.0000009536743 VQAAVGTSAAPVPSDNH 0.00462472019717097 1619.79504394531 810.9048 1619.79040527344 810.902465820313 2 26 1.1.1.3272.6 1 29.2305 281.3919 29.212 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.183758705854416 73.0700016021729 ELQAAQAR -0.00160375004634261 885.465270996094 443.7399 885.466857910156 443.740692138672 2 10 1.1.1.2799.2 1 18.8739 661.082 18.9112 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.0883098393678665 53.659999370575 DADDLQKR missed K-R@7 0.000260861997958273 959.467468261719 480.741 959.467224121094 480.740875244141 2 10 1.1.1.2715.3 1 17.1023 210.371 17.1322 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.0824944898486137 51.7799973487854 GLSAIRER missed R-E@6 0.0012070300290361 900.515258789063 451.2649 900.514099121094 451.264343261719 2 8 1.1.1.2950.2 1 21.9305 753.694 22.0215 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0.056505486369133 41.729998588562 LVQYRGEVQAMLGQSTEELRVR missed R-G@5; missed R-V@20 0.00636728992685676 2561.34448242188 641.3434 2561.33837890625 641.341857910156 4 11 1.1.1.4130.4 1 49.6665 155.4952 49.6339 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0 99.0000009536743 AKLEEQAQQIR missed K-L@2 0.00182978005614132 1312.7119140625 657.3632 1312.7099609375 657.362243652344 2 17 1.1.1.3054.3 1 24.3142 282.5185 24.3911 5 22.41 22.41 53.6300003528595 39.750000834465 35.0199997425079 sp|P02649|APOE_HUMAN Apolipoprotein E OS=Homo sapiens GN=APOE PE=1 SV=1 0 99.0000009536743 LGADMEDVCGR Oxidation(M)@5; Carbamidomethyl(C)@9 -0.000824221002403647 1237.50610351563 619.7603 1237.50671386719 619.760620117188 2 15 1.1.1.3063.6 1 24.513 669.3276 24.5916 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 2 99.0000009536743 DNAELENLIR 0.00209301011636853 1185.60107421875 593.8078 1185.59899902344 593.806762695313 2 12 1.1.1.4025.9 0 47.108 1442.089 47.2229 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 2 99.0000009536743 EVEQWFATQTEELNK 0.0105437003076077 1850.87927246094 926.4469 1850.86865234375 926.441589355469 2 23 1.1.1.4116.13 1 49.3307 778.4074 49.4115 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 2 99.0000009536743 NQYEALVETNR 0.000378972996259108 1335.64233398438 668.8284 1335.64184570313 668.828247070313 2 9 1.1.1.3516.17 0 35.0253 177.9906 35.0337 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 2 99.0000009536743 QNQEYQVLLDVR Gln->pyro-Glu@N-term 0.0133200995624065 1486.75512695313 744.3848 1486.74157714844 744.378051757813 2 13 1.1.1.4274.3 0 53.1905 313.2505 53.2106 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 2 99.0000009536743 TIEELQQK 0.00113973999395967 987.52490234375 494.7697 987.523681640625 494.769104003906 2 11 1.1.1.3081.5 0 24.9421 1170.323 24.9098 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 2 99.0000009536743 TVNALEIELQAQHNLR -0.00384218990802765 1847.9814453125 617.0011 1847.9853515625 617.002380371094 3 16 1.1.1.4046.10 0 47.6278 3055.267 47.716 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 2 99.0000009536743 YSLENTLTESEAR 0.00360146001912653 1511.71411132813 756.8643 1511.71032714844 756.862487792969 2 19 1.1.1.3810.5 1 41.8283 405.855 41.8095 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 2 99.0000009536743 YSSQLSQVQSLITNVESQLAEIR 0.00260037998668849 2592.34204101563 865.1213 2592.33959960938 865.120422363281 3 35 1.1.1.5248.2 0 72.9294 405.8469 72.8747 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 1.24412524700165 99.0000009536743 ETMQFLNDR Oxidation(M)@3 0.00247999001294374 1168.52062988281 585.2676 1168.51831054688 585.266418457031 2 12 1.1.1.3218.2 0 28.1074 514.7029 28.0533 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 1.08092188835144 98.3500003814697 LASYLEK 0.00175820000004023 822.450500488281 412.2325 822.44873046875 412.231628417969 2 9 1.1.1.3177.2 0 27.1676 1099.829 27.1395 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0.120904117822647 63.239997625351 LVVQIDNAK 0.00125236995518208 998.577270507813 500.2959 998.576049804688 500.295288085938 2 10 1.1.1.3431.10 0 32.9891 1764.763 32.8991 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0.050122294574976 39.7000014781952 VRQLER missed R-Q@2 -6.31055008852854E-05 799.466247558594 400.7404 799.466430664063 400.740509033203 2 8 1.1.1.2702.2 0 16.774 239.4135 16.816 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0.0447934605181217 36.719998717308 YQTEQSLR 0.0010598199442029 1023.49963378906 512.7571 1023.49853515625 512.756530761719 2 8 1.1.1.2950.3 1 21.933 912.7856 22.0215 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0.0385789051651955 33.2100003957748 DNAELENLIRER missed R-E@10 -0.00156969996169209 1470.74108886719 736.3778 1470.74267578125 736.378601074219 2 9 1.1.1.3983.11 0 46.0555 984.1 46.1195 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0.033389013260603 30.0599992275238 QVVSSSEQLQSYQAEIIELRR missed R-R@20 0.00465585011988878 2462.28100585938 821.7676 2462.27661132813 821.76611328125 3 9 1.1.1.4110.9 0 49.1749 787.3632 49.239 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0.0177287664264441 51.0800004005432 ETMQFLNDRLASYLEK Oxidation(M)@3 missed R-L@9 0.0026410399004817 1972.958984375 658.6603 1972.95642089844 658.659423828125 3 10 1.1.1.4133.5 0 49.7389 552.0541 49.782 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0.00877392385154963 15.6700000166893 QLERDNAELENLIR Gln->pyro-Glu@N-term missed R-D@4 0.00395348994061351 1694.86291503906 848.4387 1694.85876464844 848.436645507813 2 9 1.1.1.4211.13 0 51.6687 253.3616 51.7248 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0.00217691925354302 92.5499975681305 NHEQEVNTLR Deamidated(Q)@4 cleaved Q-N@N-term -0.00186008994933218 1239.58227539063 414.2014 1239.58435058594 414.202056884766 3 11 1.1.1.2929.3 0 21.4309 417.2485 21.4723 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 99.0000009536743 DNAELENLIR 0.00209301011636853 1185.60107421875 593.8078 1185.59899902344 593.806762695313 2 13 1.1.1.4032.6 0 47.2803 1442.089 47.2229 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 99.0000009536743 ETMQFLNDR Oxidation(M)@3 -0.00228055007755756 1168.51611328125 585.2653 1168.51831054688 585.266418457031 2 12 1.1.1.3209.4 0 27.8974 311.2258 27.8881 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 99.0000009536743 EVEQWFATQTEELNK 0.0105437003076077 1850.87927246094 926.4469 1850.86865234375 926.441589355469 2 21 1.1.1.4123.13 1 49.5053 778.4074 49.4115 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 24.3300005793571 LASYLEK 0.00157511001452804 822.450256347656 412.2324 822.44873046875 412.231628417969 2 8 1.1.1.3169.2 0 26.9994 1086.737 27.1395 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 62.9999995231628 LVVQIDNAK 0.00308333989232779 998.5791015625 500.2968 998.576049804688 500.295288085938 2 11 1.1.1.3424.7 0 32.8225 1764.763 32.8991 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 28.2000005245209 LVVQIDNAK -0.00173821998760104 998.574279785156 500.2944 998.576049804688 500.295288085938 2 9 1.1.1.3439.5 0 33.1803 1305.338 32.9229 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 92.5499975681305 NHEQEVNTLR Deamidated(Q)@4 cleaved Q-N@N-term -0.000934605021029711 1239.58349609375 620.799 1239.58435058594 620.799438476563 2 14 1.1.1.2929.8 0 21.4434 658.1304 21.4723 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 21.9300001859665 QNQEYQVLLDVR 0.00321659003384411 1503.77136230469 502.2644 1503.76818847656 502.263336181641 3 7 1.1.1.4058.5 0 47.9209 255.519 47.8645 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 99.0000009536743 RTVNALEIELQAQHNLR Formyl@N-term; GlyGly(T)@2 missed R-T@1 0.0117592001333833 2146.13623046875 716.386 2146.12426757813 716.382019042969 3 13 1.1.1.4048.7 0 47.6746 321.3542 47.716 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 99.0000009536743 TVNALEIELQAQHNLR -0.00384218990802765 1847.9814453125 617.0011 1847.9853515625 617.002380371094 3 15 1.1.1.4053.8 0 47.7991 3055.267 47.716 6 18.64 18.64 52.2300004959106 35.6400012969971 30.9399992227554 sp|Q14525|KT33B_HUMAN Keratin, type I cuticular Ha3-II OS=Homo sapiens GN=KRT33B PE=1 SV=3 0 99.0000009536743 YSSQLSQVQSLITNVESQLAEIR 0.00260037998668849 2592.34204101563 865.1213 2592.33959960938 865.120422363281 3 36 1.1.1.5240.2 0 72.7314 328.2573 72.7716 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 FVSTTSSSR 0.00319256004877388 970.475280761719 486.2449 970.471984863281 486.243255615234 2 10 1.1.1.2807.4 1 19.0655 1051.959 19.1283 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 GLGVGFGSGGGSSSSVK 0.00269822007976472 1438.70788574219 720.3612 1438.70520019531 720.35986328125 2 29 1.1.1.3526.4 1 35.2755 663.0452 35.2805 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 ISISTSGGSFR 0.00238660001195967 1110.56921386719 556.2919 1110.56689453125 556.290771484375 2 14 1.1.1.3566.6 1 36.1355 533.1909 36.0693 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 LALDVEIATYR 0.00251339003443718 1262.68969726563 632.3521 1262.68701171875 632.350830078125 2 9 1.1.1.4139.7 0 49.8888 212.9456 49.9303 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 SFSTASAITPSVSR -0.00174838001839817 1409.71350097656 705.864 1409.71508789063 705.864807128906 2 22 1.1.1.3641.3 1 37.8832 1157.497 37.912 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 SGGGGGGGFGR -0.0122426003217697 864.371704101563 433.1931 864.383850097656 433.199188232422 2 12 1.1.1.2765.2 1 18.0595 0 -1 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 2 99.0000009536743 TSFTSVSR 0.000591846008319408 883.440490722656 442.7275 883.43994140625 442.727264404297 2 9 1.1.1.3075.3 1 24.7978 1102.131 24.9098 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 1.79588079452515 99.0000009536743 GRLDSELR missed R-L@2 -0.000199925998458639 944.503845214844 473.2592 944.503967285156 473.259246826172 2 10 1.1.1.3032.4 0 23.7824 168.9509 23.8118 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0.721246421337128 96.0399985313416 SLYNLGGSKR missed K-R@9 -0.00316165992990136 1093.58483886719 547.7997 1093.58801269531 547.80126953125 2 11 1.1.1.3139.10 1 26.3097 404.8611 26.2981 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0.109020404517651 61.870002746582 AQYEEIANR 0.00155090994667262 1092.52172851563 547.2681 1092.52001953125 547.267272949219 2 8 1.1.1.3100.4 1 25.4067 379.0867 25.469 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0.0925886407494545 57.480001449585 QLDSIVGER 0.0033189500682056 1015.53308105469 508.7738 1015.52984619141 508.772186279297 2 8 1.1.1.3411.13 0 32.5107 653.0375 32.398 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0.0555173270404339 43.7999993562698 NLDLDSIIAEVK 0.00508612999692559 1328.72387695313 665.3692 1328.71875 665.366638183594 2 9 1.1.1.4426.7 0 56.9796 505.424 57.0722 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0.0254883076995611 25.7400006055832 QSSVSFR 0.000734005006961524 809.403869628906 405.7092 809.403137207031 405.708862304688 2 8 1.1.1.2999.2 1 23.0812 264.9703 23.0863 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0.0231916625052691 23.7100005149841 QNLEPLFEQYINNLRR missed R-R@15 0.00243656011298299 2046.0673828125 683.0297 2046.06469726563 683.02880859375 3 9 1.1.1.4418.3 0 56.7787 639.091 56.8729 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0.00174066168256104 25.6599992513657 AIADAEQR cleaved N-A@N-term 0.000230478006415069 872.435485839844 437.225 872.435180664063 437.224884033203 2 7 1.1.1.2796.2 0 18.7981 276.7222 18.8396 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0 30.6800007820129 AQYEEIANR Methyl(N)@8 -0.00336633995175362 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 10 1.1.1.3111.14 0 25.6802 613.0195 25.7665 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0 17.849999666214 AQYEEIANR Methyl(N)@8 -0.00336633995175362 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 9 1.1.1.3118.7 0 25.8522 613.0195 25.7665 7 16.82 16.82 45.2499985694885 19.8300004005432 16.779999434948 sp|P13647|K2C5_HUMAN Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3 0 99.0000009536743 TSFTSVSR 0.000591846008319408 883.440490722656 442.7275 883.43994140625 442.727264404297 2 10 1.1.1.3082.2 1 24.9632 1102.131 24.9098 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 FSSSGGGGGGGR -0.00277216010726988 981.423645019531 491.7191 981.426391601563 491.720489501953 2 13 1.1.1.2603.2 1 15.6899 233.6999 15.7616 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 FSSSSGYGGGSSR -0.00137821002863348 1234.52001953125 618.2673 1234.521484375 618.268005371094 2 19 1.1.1.2907.3 1 20.9355 1569.562 21.0115 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR 0.00461986986920238 2704.158203125 902.3934 2704.15380859375 902.391906738281 3 21 1.1.1.4112.16 1 49.2298 662.6196 49.2882 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 GGSGGSYGGGGSGGGYGGGSGSR 0.00208605988882482 1790.72253417969 896.3685 1790.72045898438 896.367492675781 2 39 1.1.1.2862.2 1 20.2375 476.8888 20.2768 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 HGVQELEIELQSQLSK 0.0105684995651245 1836.96862792969 919.4916 1836.95812988281 919.486328125 2 25 1.1.1.4182.5 1 50.9638 393.6648 50.9449 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 HGVQELEIELQSQLSKK missed K-K@16 -0.0087016997858882 1965.04443359375 656.0221 1965.05310058594 656.024963378906 3 15 1.1.1.4113.6 1 49.2486 433.1003 49.1899 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 SGGGGGGGLGSGGSIR -0.001119349966757 1231.58947753906 616.802 1231.59057617188 616.802551269531 2 27 1.1.1.3023.3 1 23.5643 1756.399 23.5212 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 STMQELNSR -0.000892793003004044 1064.49133300781 533.2529 1064.49206542969 533.253295898438 2 14 1.1.1.3035.3 1 23.8555 911.8669 23.9094 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 FSSSGGGGGGGR 0.00204940000548959 981.428466796875 491.7215 981.426391601563 491.720489501953 2 14 1.1.1.2625.2 1 15.8621 144.6421 15.8306 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 FSSSSGYGGGSSR -0.00137821002863348 1234.52001953125 618.2673 1234.521484375 618.268005371094 2 12 1.1.1.2915.7 1 21.1255 1569.562 21.0115 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 30.6800007820129 LASYLDK Methyl(D)@6 0.00175821001175791 822.450500488281 412.2325 822.44873046875 412.231628417969 2 9 1.1.1.3177.2 0 27.1676 1099.829 27.1395 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 SGGGGGGGLGSGGSIR 0.00193228002171963 1231.59252929688 616.8035 1231.59057617188 616.802551269531 2 23 1.1.1.3005.3 1 23.2061 509.1844 23.342 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 SGGGGGGGLGSGGSIR -0.001119349966757 1231.58947753906 616.802 1231.59057617188 616.802551269531 2 28 1.1.1.3016.3 1 23.3961 1756.399 23.5212 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 99.0000009536743 STMQELNSR Oxidation(M)@3 -0.00115602998994291 1080.48583984375 541.2502 1080.48693847656 541.250732421875 2 14 1.1.1.2787.3 1 18.5957 485.5231 18.6485 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 56.9000005722046 STMQELNSR -0.000892793003004044 1064.49133300781 533.2529 1064.49206542969 533.253295898438 2 7 1.1.1.3042.7 1 24.0185 911.8669 23.9094 8 16 16 38.5199993848801 19.5800006389618 19.5800006389618 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 52.7199983596802 STMQELNSR Oxidation(M)@3 -0.00176636001560837 1080.48522949219 541.2499 1080.48693847656 541.250732421875 2 11 1.1.1.3037.4 1 23.9043 196.6706 23.9094 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 GSLGGGFSSGGFSGGSFSR 0.00192720000632107 1706.76684570313 854.3907 1706.76489257813 854.389709472656 2 23 1.1.1.3961.12 1 45.5102 922.7113 45.4442 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 QSVEADINGLRR Gln->pyro-Glu@N-term missed R-R@11 0.0096728103235364 1339.69409179688 670.8543 1339.68444824219 670.849487304688 2 11 1.1.1.3839.9 1 42.5169 369.6248 42.4791 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 SKELTTEIDNNIEQISSYKSEITELRR missed K-E@2; missed K-S@19; missed R-R@26 -0.00729061989113688 3195.61865234375 799.9119 3195.6259765625 799.913757324219 4 15 1.1.1.4221.10 1 51.9154 203.8874 51.899 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 SLLEGEGSSGGGGR -0.00175520998891443 1261.58801269531 631.8013 1261.58984375 631.802185058594 2 17 1.1.1.3122.12 1 25.9558 975.5552 26.0271 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 SQYEQLAEQNRK missed R-K@11 -0.00345117994584143 1492.72351074219 498.5818 1492.72705078125 498.582946777344 3 16 1.1.1.3059.2 1 24.4342 496.2376 24.4452 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 2 99.0000009536743 VTMQNLNDRLASYLDKVR missed R-L@9; missed K-V@16 -0.010529899969697 2135.10546875 534.7836 2135.11572265625 534.786193847656 4 14 1.1.1.4212.3 0 51.6834 1113.061 51.7248 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 1.11918652057648 98.6800014972687 VLDELTLTK 0.00064693798776716 1030.59167480469 516.3031 1030.59106445313 516.302795410156 2 11 1.1.1.3801.3 1 41.6055 450.2231 41.619 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0.0376306623220444 99.0000009536743 SSKGSLGGGFSSGGFSGGSFSR cleaved S-S@N-term; missed K-G@3 -4.00805997848511 2004.91552734375 1003.465 2008.923828125 1005.46923828125 2 11 1.1.1.3958.20 1 45.4383 153.5301 45.4193 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0.0136762224137783 48.1000006198883 NHEEEMKDLR Oxidation(M)@6 missed K-D@7 -0.00680762995034456 1315.57592773438 439.5326 1315.58264160156 439.534820556641 3 11 1.1.1.2685.2 1 16.479 148.9758 16.4721 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0 99.0000009536743 GSLGGGFSSGGFSGGSFSR 0.00192720000632107 1706.76684570313 854.3907 1706.76489257813 854.389709472656 2 17 1.1.1.3954.13 1 45.3381 922.7113 45.4442 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0 30.6800007820129 LASYLDK Methyl(D)@6 0.00175821001175791 822.450500488281 412.2325 822.44873046875 412.231628417969 2 9 1.1.1.3177.2 0 27.1676 1099.829 27.1395 9 13.17 13.17 30.9899985790253 19.5199996232986 19.5199996232986 sp|P13645|K1C10_HUMAN; cont|000136; cont|000133; cont|000129; cont|000122 Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6; cra|hCP1812051| keratin 10 (epidermolytic hyperkeratosis; keratosis palmaris et plantaris) [Homo sapiens (contaminant)]; pir|KRHU0| keratin 10, type I, cytoskeletal - human [Homo sapiens (contaminant)]; trm|Q8N175| Keratin 10 [Homo sapiens (contaminant)]; spt|P13645| Keratin, type I cytoskeletal 10 (Cytokeratin 10) (K10) (CK 10) [Homo sapiens (contaminant)] 0 99.0000009536743 SLLEGEGSSGGGGR -0.00175520998891443 1261.58801269531 631.8013 1261.58984375 631.802185058594 2 9 1.1.1.3132.15 1 26.1452 971.0381 26.0271 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 DALSSVQESQVAQQAR -0.000648586021270603 1715.84326171875 858.9289 1715.84387207031 858.92919921875 2 26 1.1.1.3633.4 1 37.6929 9632.737 37.4545 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 SEAEDASLLSFMQGYMK cleaved A-S@N-term 0.0131650995463133 1905.86206054688 953.9383 1905.84887695313 953.931701660156 2 23 1.1.1.4553.4 1 59.9028 1093.194 60.0628 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 SEAEDASLLSFMQGYMKHATK Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.00558724999427795 2359.087890625 787.3699 2359.08251953125 787.368103027344 3 22 1.1.1.4185.5 1 51.0284 641.3256 51.0169 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.013399800285697 2016.01013183594 505.0098 2016.02355957031 505.01318359375 4 15 1.1.1.3463.18 1 33.7507 1269.213 33.6858 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 1.60206043720245 99.0000009536743 PEVRPTSAVAA cleaved D-P@N-term -0.00259387004189193 1096.58508300781 549.2998 1096.58764648438 549.301086425781 2 10 1.1.1.3131.16 1 26.117 418.1555 26.1254 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.954677045345306 99.0000009536743 SVQESQVAQQAR cleaved S-S@N-term -0.000165265999385156 1329.66369628906 665.8391 1329.66369628906 665.839111328125 2 18 1.1.1.2953.7 1 22.008 277.203 22.0215 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.555955231189728 99.0000009536743 MQGYMKHATKTAKDALSSVQESQVAQQAR Oxidation(M)@5; acrolein addition +56(K)@6; acrolein addition +56(K)@10; acrolein addition +112(K)@13 cleaved F-M@N-term; missed K-H@6; missed K-T@10; missed K-D@13 0.0011448300210759 3431.68115234375 1144.901 3431.68139648438 1144.90100097656 3 15 1.1.1.3614.7 1 37.2589 1665.782 37.3117 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.0419141501188278 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Bromo(W)@33; acrolein addition +112(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 -0.00511731021106243 4506.0927734375 902.2258 4506.09765625 902.226867675781 5 17 1.1.1.4265.9 1 52.9778 824.5681 52.9688 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.0362121723592281 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK acrolein addition +76(K)@30; Bromo(W)@33; acrolein addition +94(K)@37 missed K-D@3; missed R-G@19; missed K-D@30 -0.0404952988028526 4320.9560546875 865.1985 4320.99658203125 865.206604003906 5 18 1.1.1.4326.12 1 54.5084 733.6686 54.521 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.00174066168256104 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK Phospho(S)@25; MDA adduct +54(K)@27; MDA adduct +54(K)@34 missed R-G@16; missed K-D@27 -0.0286333002150059 3960.79223632813 991.2053 3960.82080078125 991.212463378906 4 13 1.1.1.4555.3 1 59.9553 152.0954 59.9663 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.000869458774104714 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK acrolein addition +76(K)@34; Cation:K(D)@35; acrolein addition +76(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 -0.0806123986840248 4205.89306640625 842.1859 4205.9736328125 842.202026367188 5 15 1.1.1.4336.7 1 54.7526 1854.4 54.7446 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.00496640987694263 1715.84887695313 858.9317 1715.84387207031 858.92919921875 2 19 1.1.1.3505.9 1 34.7605 122.8285 34.7414 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR -0.000648586021270603 1715.84326171875 858.9289 1715.84387207031 858.92919921875 2 26 1.1.1.3609.6 1 37.14 35028.57 37.3117 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR -0.000648586021270603 1715.84326171875 858.9289 1715.84387207031 858.92919921875 2 26 1.1.1.3617.7 1 37.3305 35383.93 37.3117 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR -0.000648586021270603 1715.84326171875 858.9289 1715.84387207031 858.92919921875 2 24 1.1.1.3619.5 1 37.3748 35383.93 37.3117 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR -0.000648586021270603 1715.84326171875 858.9289 1715.84387207031 858.92919921875 2 26 1.1.1.3625.3 1 37.5208 35383.93 37.3117 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Cation:Na(E)@8 0.0043397000990808 1737.83020019531 580.284 1737.82580566406 580.282531738281 3 21 1.1.1.3613.5 1 37.2318 847.4902 37.3357 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Methyl(D)@1 -0.0322635993361473 1729.82727050781 865.9209 1729.85949707031 865.93701171875 2 17 1.1.1.3614.6 1 37.2556 602.4069 37.264 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Methyl+Deamidated(Q)@13; Deamidated(Q)@14 0.00853252969682217 1731.83605957031 866.9253 1731.82751464844 866.921020507813 2 26 1.1.1.3619.6 1 37.3782 628.0618 37.3357 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Cation:Na(E)@8 -0.00194371002726257 1737.82385253906 869.9192 1737.82580566406 869.920166015625 2 17 1.1.1.3620.5 1 37.4019 586.02 37.2879 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.4399974346161 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK MDA adduct +62(K)@27; Bromo(W)@30; acrolein addition +76(K)@34 missed R-G@16; missed K-D@27 0.0179155003279448 3988.80859375 998.2094 3988.79077148438 998.204956054688 4 13 1.1.1.4551.3 1 59.8563 314.0637 59.8698 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.0199992656708 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK acrolein addition +76(K)@27; Bromo(W)@30; acrolein addition +94(K)@34 missed R-G@16; missed K-D@27 -0.0233498997986317 4020.794921875 1006.206 4020.81689453125 1006.21148681641 4 13 1.1.1.4415.7 1 56.7129 1869.788 56.7988 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 31.1500012874603 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK Phosphoguanosine(K)@27; acrolein addition +56(K)@34 missed R-G@16; missed K-D@27 0.016966599971056 4173.9228515625 1044.488 4173.90673828125 1044.48400878906 4 11 1.1.1.4386.14 1 55.9918 651.3637 56.0277 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Bromo(W)@18; reduced acrolein addition +58(K)@27; MDA adduct +54(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 -0.00780660007148981 4205.91064453125 1052.485 4205.91796875 1052.48681640625 4 14 1.1.1.4333.12 1 54.6887 1332.522 54.7446 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term 0.00998296029865742 1937.8486328125 969.9316 1937.83862304688 969.926635742188 2 21 1.1.1.4040.11 1 47.4845 2004.714 47.3961 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@12 cleaved A-S@N-term 0.0191415995359421 1921.86291503906 961.9387 1921.84375 961.929138183594 2 24 1.1.1.4175.6 1 50.7924 653.8104 50.7047 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term 0.0140148000791669 1921.85791015625 961.9362 1921.84375 961.929138183594 2 24 1.1.1.4349.8 1 55.0764 2850.054 55.1174 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@16 cleaved A-S@N-term 0.00780422985553741 1921.85168457031 641.6245 1921.84375 641.621887207031 3 15 1.1.1.4350.3 1 55.0973 684.4515 55.1174 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK cleaved A-S@N-term 0.0131650995463133 1905.86206054688 953.9383 1905.84887695313 953.931701660156 2 25 1.1.1.4560.6 1 60.0737 1093.194 60.0628 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK cleaved A-S@N-term 0.0131650995463133 1905.86206054688 953.9383 1905.84887695313 953.931701660156 2 24 1.1.1.4567.5 1 60.2449 1093.194 60.0628 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term 6.20744031039067E-05 1937.83862304688 969.9266 1937.83862304688 969.926635742188 2 23 1.1.1.4026.19 1 47.143 1619.539 47.3712 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Oxidation(M)@12; Oxidation(M)@16 cleaved A-S@N-term 6.20744031039067E-05 1937.83862304688 969.9266 1937.83862304688 969.926635742188 2 25 1.1.1.4033.18 1 47.3167 2007.845 47.3961 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMK Deamidated(Q)@13; Oxidation(M)@16 cleaved A-S@N-term 0.0291166007518768 1922.85693359375 962.4357 1922.82775878906 962.421142578125 2 12 1.1.1.4349.9 1 55.0773 1760.548 55.1174 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMKHATK Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 0.0121788997203112 2359.09448242188 787.3721 2359.08251953125 787.368103027344 3 23 1.1.1.4177.2 1 50.8311 692.0239 50.8248 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 SEAEDASLLSFMQGYMKHATK cleaved A-S@N-term; missed K-H@17 -0.000238091000937857 2343.08740234375 782.0364 2343.08740234375 782.036437988281 3 14 1.1.1.4351.6 1 55.1248 372.2767 55.1174 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 50.4899978637695 SEAEDASLLSFMQGYMKHATK Oxidation(M)@16 cleaved A-S@N-term; missed K-H@17 -0.00867221038788557 2359.07373046875 590.7757 2359.08251953125 590.777893066406 4 10 1.1.1.4179.2 1 50.8835 838.3621 50.8248 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.0068343598395586 2016.01684570313 673.0129 2016.02355957031 673.01513671875 3 27 1.1.1.3434.4 1 33.0606 1507.828 33.0418 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00720056006684899 2016.0166015625 673.0128 2016.02355957031 673.01513671875 3 26 1.1.1.3452.9 1 33.4872 16665.91 33.6619 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00720056006684899 2016.0166015625 673.0128 2016.02355957031 673.01513671875 3 28 1.1.1.3459.6 1 33.6567 17001.16 33.6858 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00720056006684899 2016.0166015625 673.0128 2016.02355957031 673.01513671875 3 27 1.1.1.3466.8 1 33.8236 17001.16 33.6858 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00262312008999288 2016.02099609375 673.0143 2016.02355957031 673.01513671875 3 23 1.1.1.3474.4 1 34.0136 13064.72 33.7583 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00115834001917392 2016.0224609375 673.0148 2016.02355957031 673.01513671875 3 25 1.1.1.3491.5 1 34.4233 422.2111 34.4524 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00115834001917392 2016.0224609375 673.0148 2016.02355957031 673.01513671875 3 23 1.1.1.3498.8 1 34.5893 422.2111 34.4524 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Carbamidomethyl@N-term missed K-D@3 0.00129392999224365 2073.04638671875 692.0227 2073.04516601563 692.022277832031 3 25 1.1.1.3452.10 1 33.4897 328.8772 33.4948 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Methyl(S)@7 missed K-D@3 -0.0384062007069588 2030.00073242188 677.6742 2030.03930664063 677.68701171875 3 18 1.1.1.3457.6 1 33.6056 381.2452 33.7099 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Cation:Na(E)@11 missed K-D@3 -0.00370214995928109 2038.00170898438 680.3412 2038.00549316406 680.342468261719 3 17 1.1.1.3462.7 1 33.7239 219.1693 33.6858 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Deamidated(Q)@10; Methyl(E)@11 missed K-D@3 -0.017399100586772 2031.005859375 678.0092 2031.02331542969 678.015014648438 3 14 1.1.1.3466.9 1 33.8261 513.2546 33.6858 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR acrolein addition +56(K)@3; Ser->LacticAcid(S)@7 missed K-D@3 0.00251382007263601 2057.04125976563 686.6877 2057.03881835938 686.686889648438 3 19 1.1.1.3501.10 1 34.6641 1214.473 34.7414 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR acrolein addition +56(K)@3; Ser->LacticAcid(S)@7 missed K-D@3 0.00251382007263601 2057.04125976563 686.6877 2057.03881835938 686.686889648438 3 18 1.1.1.3507.15 1 34.8088 1214.473 34.7414 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR acrolein addition +56(K)@3; Ser->LacticAcid(S)@8 missed K-D@3 0.00251382007263601 2057.04125976563 686.6877 2057.03881835938 686.686889648438 3 13 1.1.1.3513.8 1 34.9549 1214.473 34.7414 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Formyl@N-term; reduced acrolein addition +58(K)@3 missed K-D@3 -0.00742209004238248 2102.05346679688 1052.034 2102.06030273438 1052.03747558594 2 18 1.1.1.4021.20 1 47.0164 494.7815 46.9972 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 92.5499975681305 TAKDALSSVQESQVAQQAR Lys->Hydroxyallysine(K)@3; Oxidation(D)@4 missed K-D@3 0.0154496002942324 2046.99731445313 683.3397 2046.98181152344 683.334533691406 3 14 1.1.1.3462.8 1 33.7264 443.3825 33.7099 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK acrolein addition +76(K)@30; Bromo(W)@33; acrolein addition +94(K)@37 missed K-D@3; missed R-G@19; missed K-D@30 -0.0319506004452705 4320.96533203125 865.2003 4320.99658203125 865.206604003906 5 17 1.1.1.4318.9 1 54.3019 745.4496 54.317 10 11.19 11.19 72.7299988269806 71.7199981212616 71.7199981212616 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK MDA adduct +54(K)@30; Dichloro(Y)@32; acrolein addition +94(K)@37 missed K-D@3; missed R-G@19; missed K-D@30 -0.0164534002542496 4288.97119140625 858.8015 4288.9873046875 858.804809570313 5 14 1.1.1.4381.10 1 55.863 587.1801 55.8773 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 2 99.0000009536743 ETQSQLETER 0.0017297399463132 1219.56982421875 610.7922 1219.56811523438 610.791320800781 2 12 1.1.1.2924.9 1 21.3227 238.4895 21.3278 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 2 99.0000009536743 GAGSIAGASASPK -0.00103188003413379 1072.55029296875 537.2824 1072.55126953125 537.282897949219 2 17 1.1.1.2936.3 1 21.6101 318.7234 21.639 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 2 99.0000009536743 GIVDSITGQR 0.00489298021420836 1044.56127929688 523.2879 1044.55639648438 523.285461425781 2 12 1.1.1.3661.4 1 38.3592 497.4453 38.4119 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 2 99.0000009536743 IQSQFTDAQK 0.00104071001987904 1164.57861328125 583.2966 1164.57751464844 583.296020507813 2 14 1.1.1.3077.4 1 24.8563 135.3893 24.8613 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 2 99.0000009536743 IVQLKPR 0.00119871995411813 852.5556640625 427.2851 852.554504394531 427.284545898438 2 8 1.1.1.2975.2 1 22.5081 167.4636 22.5282 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0.54211813211441 95.1099991798401 LQDTSSYAK 0.0042242300696671 1011.49145507813 506.753 1011.4873046875 506.750915527344 2 9 1.1.1.2897.4 1 20.7137 165.9298 20.7229 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0.0757207125425339 59.8200023174286 ISTEEAIR 0.00197719992138445 917.48388671875 459.7492 917.481811523438 459.748168945313 2 8 1.1.1.3092.4 1 25.2146 227.1089 25.2531 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0.0447934605181217 45.9399998188019 STLEAETR 0.00265470007434487 905.448059082031 453.7313 905.445434570313 453.72998046875 2 9 1.1.1.2851.3 1 19.9892 292.9639 19.9762 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0.0438315682113171 45.2300012111664 VLLQEEGTR -0.00445195008069277 1043.556640625 522.7856 1043.56115722656 522.787841796875 2 6 1.1.1.3172.4 1 27.0519 275.6812 27.1159 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0.021819481626153 28.5899996757507 SVEEVASEIQPFLR 0.00860590022057295 1602.83410644531 802.4243 1602.82531738281 802.419921875 2 10 1.1.1.4322.8 1 54.4017 446.2269 54.4176 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0.00744648277759552 39.0300005674362 FGDSNTVMR Oxidation(M)@8 0.0012353400234133 1041.45629882813 521.7354 1041.45495605469 521.734741210938 2 7 1.1.1.2939.6 1 21.6733 159.5686 21.7105 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0.000869458774104714 26.2899994850159 FLSEMLKSLEDLKLKNTK reduced acrolein addition +96(K)@7; acrolein addition +38(K)@13; MDA adduct +54(K)@15; acrolein addition +94(K)@18 missed K-S@7; missed K-L@13; missed K-N@15 -0.0299999993294477 2418.2822265625 605.5778 2418.31201171875 605.585266113281 4 9 1.1.1.4845.2 1 66.7435 2811.207 66.5363 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0 34.1699987649918 EKSEREKNSLR hexanoyl addition +98(K)@2; Methyl(E)@4; acrolein addition +38(K)@7 missed K-S@2; missed R-E@5; missed K-N@7 0.00203045993112028 1524.828125 763.4213 1524.82604980469 763.420288085938 2 12 1.1.1.3707.2 0 39.4155 541.058 39.3732 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0 19.7899997234344 SLKELQLQKQK acrolein addition +112(K)@3; Deamidated(Q)@6; reduced acrolein addition +96(K)@9; reduced acrolein addition +96(K)@11 cleaved N-S@N-term; missed K-E@3; missed K-Q@9 0.0286274999380112 1646.97814941406 550 1646.94946289063 549.990417480469 3 4 1.1.1.4621.2 1 61.5575 4165.214 61.6985 11 10.74 10.74 39.1499996185303 2.33399998396635 2.05499995499849 sp|P15924|DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 0 24.0500003099442 YKRQVQNLVNKSKK acrolein addition +38(K)@2; Deamidated(N)@7; acrolein addition +56(K)@13; MDA adduct +54(K)@14 cleaved E-Y@N-term; missed K-R@2; missed R-Q@3; missed K-S@11; missed K-K@13 -0.0160255990922451 1881.03125 628.0177 1881.04724121094 628.023010253906 3 11 1.1.1.3843.7 0 42.6177 961.254 42.5749 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 STGKPTLYNVSLVMSDTAGTC Oxidation(M)@14; Carbamidomethyl(C)@21 cleaved C-Y@C-term -0.000594613025896251 2217.029296875 1109.522 2217.029296875 1109.52197265625 2 18 1.1.1.4030.20 1 47.2427 1454.106 47.1979 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 STGKPTLYNVSLVMSDTAGTCY Oxidation(M)@14; Carbamidomethyl(C)@21 0.0151947000995278 2380.107421875 1191.061 2380.0927734375 1191.05358886719 2 15 1.1.1.4122.19 1 49.4789 4032.249 49.4608 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTC Oxidation(M)@18; Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 -0.00566426990553737 2660.26196289063 887.7612 2660.26733398438 887.763061523438 3 21 1.1.1.3962.13 1 45.5318 2131.432 45.4691 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 2 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.00751993013545871 2823.3232421875 942.115 2823.33056640625 942.117492675781 3 19 1.1.1.4031.9 1 47.2623 15423.49 47.3465 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 1.10237288475037 99.0000009536743 GGKYAATSQVLLPSK Carbamidomethyl@N-term; HPNE addition +172(K)@3 missed K-Y@3 0.0102589000016451 1747.98229980469 874.9984 1747.97204589844 874.993286132813 2 15 1.1.1.4310.5 1 54.0965 1102.715 54.166 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0.353596270084381 99.0000009536743 QTISRPKGVALHRPDVYLLPPAR Gln->pyro-Glu@N-term; acrolein addition +56(K)@7; Oxidation(P)@14 missed K-G@7 -0.0146134002134204 2638.4560546875 660.6213 2638.470703125 660.624938964844 4 14 1.1.1.3569.4 1 36.2068 0 -1 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0.00130484171677381 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00235676998272538 1318.75207519531 660.3833 1318.74963378906 660.382080078125 2 10 1.1.1.3942.10 1 45.0332 197.6425 45.0226 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0.000434511806815863 98.3399987220764 GFSPADVFVQWMQR Dethiomethyl(M)@12 cleaved T-G@N-term 0.0314230993390083 1618.82067871094 810.4176 1618.78918457031 810.401916503906 2 12 1.1.1.4240.8 1 52.3821 566.4821 52.3215 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 95.3199982643127 GFSPADVFVQWMQR Dethiomethyl(M)@12 cleaved T-G@N-term 0.0272727999836206 1618.81652832031 810.4155 1618.78918457031 810.401916503906 2 11 1.1.1.4176.6 1 50.8164 743.8203 50.8969 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 88.7099981307983 GFSPADVFVQWMQR Dethiomethyl(M)@12 cleaved T-G@N-term 0.0272727999836206 1618.81652832031 810.4155 1618.78918457031 810.401916503906 2 11 1.1.1.4183.6 1 50.9845 743.8203 50.8969 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 GGKYAATSQVLLPSK Lys-add@N-term; acrolein addition +56(K)@3 missed K-Y@3 0.00422568991780281 1702.96594238281 568.6626 1702.96179199219 568.661193847656 3 17 1.1.1.3784.5 1 41.2022 1481.899 41.2378 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 28.9799988269806 GGKYAATSQVLLPSK hexanoyl addition +98(K)@3 missed K-Y@3 -0.0352880991995335 1616.87841796875 809.4465 1616.91381835938 809.464172363281 2 8 1.1.1.3911.19 1 44.2733 183.8428 44.28 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 25.6599992513657 GGKYAATSQVLLPSK hexanoyl addition +98(K)@3 missed K-Y@3 -0.0238140001893044 1616.89001464844 809.4523 1616.91381835938 809.464172363281 2 8 1.1.1.3901.10 1 44.0218 394.8834 43.9092 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 16.9300004839897 GGKYAATSQVLLPSK Carbamyl@N-term; HPNE addition +172(K)@3 missed K-Y@3 0.0189919006079435 1733.97521972656 867.9949 1733.95629882813 867.985473632813 2 9 1.1.1.4228.11 1 52.0924 243.3833 52.1478 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 72.2699999809265 STGKPTLYNVSLVMSDTAGTC Oxidation(M)@14; Carbamidomethyl(C)@21 cleaved C-Y@C-term -0.000594613025896251 2217.029296875 1109.522 2217.029296875 1109.52197265625 2 11 1.1.1.4023.21 1 47.0674 1454.106 47.1979 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 STGKPTLYNVSLVMSDTAGTCY Oxidation(M)@14; Carbamidomethyl(C)@21 0.0151947000995278 2380.107421875 1191.061 2380.0927734375 1191.05358886719 2 13 1.1.1.4115.11 1 49.3078 4032.249 49.4608 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 70.2899992465973 STGKPTLYNVSLVMSDTAGTCY Dioxidation(M)@14; Carbamidomethyl(C)@21 0.0144865997135639 2396.10131835938 1199.058 2396.08764648438 1199.05102539063 2 8 1.1.1.4122.20 1 49.4806 148.1106 49.4856 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTC Oxidation(M)@18; Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 -0.00566426990553737 2660.26196289063 887.7612 2660.26733398438 887.763061523438 3 18 1.1.1.3955.11 1 45.3578 2131.432 45.4691 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTC Carbamidomethyl(C)@25 cleaved C-Y@C-term; missed K-S@4 0.00696570985019207 2644.279296875 882.4337 2644.2724609375 882.431396484375 3 14 1.1.1.4150.9 1 50.1677 575.8668 50.2775 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Carbamidomethyl(C)@25 missed K-S@4 0.00719719985499978 2807.34326171875 936.7883 2807.33569335938 936.785888671875 3 20 1.1.1.4222.14 1 51.9421 2189.53 52.0479 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Carbamidomethyl(C)@25 missed K-S@4 0.00719719985499978 2807.34326171875 936.7883 2807.33569335938 936.785888671875 3 19 1.1.1.4229.14 1 52.1142 2189.53 52.0479 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY Carbamidomethyl@N-term; Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 -0.0183375999331474 2880.33374023438 961.1185 2880.35205078125 961.124633789063 3 14 1.1.1.4034.17 1 47.3398 339.4463 47.3465 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 TVDKSTGKPTLYNVSLVMSDTAGTCY acrolein addition +56(K)@4; Ser->LacticAcid(S)@5; Oxidation(M)@18; Carbamidomethyl(C)@25 missed K-S@4 0.00409501977264881 2864.34985351563 955.7906 2864.34594726563 955.789245605469 3 16 1.1.1.4036.18 1 47.3885 449.5054 47.3961 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00296709011308849 1318.75268554688 660.3836 1318.74963378906 660.382080078125 2 16 1.1.1.3877.7 1 43.4346 11992.49 43.6648 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00272295996546745 1318.75244140625 660.3835 1318.74963378906 660.382080078125 2 18 1.1.1.3884.7 1 43.6083 20368.05 43.787 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00272295996546745 1318.75244140625 660.3835 1318.74963378906 660.382080078125 2 19 1.1.1.3891.8 1 43.7769 20486.6 43.787 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00272295996546745 1318.75244140625 660.3835 1318.74963378906 660.382080078125 2 19 1.1.1.3898.15 1 43.9514 20486.6 43.787 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00296709011308849 1318.75268554688 660.3836 1318.74963378906 660.382080078125 2 18 1.1.1.3905.14 1 44.1208 12321.55 43.8603 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00272295996546745 1318.75244140625 660.3835 1318.74963378906 660.382080078125 2 15 1.1.1.3912.13 1 44.2931 1412.943 44.2551 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00272295996546745 1318.75244140625 660.3835 1318.74963378906 660.382080078125 2 14 1.1.1.3919.9 1 44.4647 1412.943 44.2551 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 99.0000009536743 YAATSQVLLPSK Trimethyl(A)@2 0.00357742002233863 1318.75329589844 660.3839 1318.74963378906 660.382080078125 2 13 1.1.1.3926.10 1 44.6376 504.726 44.5774 12 9.46 9.46 25.4400014877319 17.2600001096725 17.2600001096725 sp|P01871|IGHM_HUMAN Ig mu chain C region OS=Homo sapiens GN=IGHM PE=1 SV=3 0 22.4600002169609 YAATSQVLLPSK Acetyl@N-term 0.0369113013148308 1318.75024414063 660.3824 1318.71325683594 660.363891601563 2 7 1.1.1.3933.13 1 44.8134 313.3308 44.8251 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 2 99.0000009536743 ALEEANADLEVK 0.00737001979723573 1300.65844726563 651.3365 1300.65100097656 651.332824707031 2 12 1.1.1.3509.15 0 34.854 192.1344 34.8624 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 2 99.0000009536743 APSTYGGGLSVSSSR 0.000514479004777968 1424.69006347656 713.3523 1424.68957519531 713.35205078125 2 20 1.1.1.3296.7 1 29.7825 327.4978 29.8114 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 2 99.0000009536743 EVATNSELVQSGK 0.000617254001554102 1360.68408203125 681.3493 1360.68347167969 681.348999023438 2 16 1.1.1.3116.6 1 25.8104 256.0812 25.8882 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 2 99.0000009536743 VLDELTLAR 0.00271158991381526 1028.58923339844 515.3019 1028.58666992188 515.300598144531 2 12 1.1.1.3864.5 0 43.1166 593.0206 43.1041 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 99.0000009536743 ALEEANADLEVK 0.00737001979723573 1300.65844726563 651.3365 1300.65100097656 651.332824707031 2 12 1.1.1.3517.14 0 35.0517 192.1344 34.8624 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 99.0000009536743 APSTYGGGLSVSSSR 0.00930317025631666 1424.69885253906 713.3567 1424.68957519531 713.35205078125 2 15 1.1.1.3304.11 1 29.973 251.5575 29.9543 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 99.0000009536743 EVATNSELVQSGK 0.000617254001554102 1360.68408203125 681.3493 1360.68347167969 681.348999023438 2 14 1.1.1.3123.11 1 25.9801 256.0812 25.8882 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 30.6800007820129 LASYLDK Methyl(D)@6 0.00175821001175791 822.450500488281 412.2325 822.44873046875 412.231628417969 2 9 1.1.1.3177.2 0 27.1676 1099.829 27.1395 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 99.0000009536743 VLDELTLAR 0.00271158991381526 1028.58923339844 515.3019 1028.58666992188 515.300598144531 2 9 1.1.1.3857.9 0 42.9506 593.0206 43.1041 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 98.5300004482269 VLDELTLAR 0.00332191004417837 1028.58984375 515.3022 1028.58666992188 515.300598144531 2 11 1.1.1.3871.3 0 43.285 463.302 43.2742 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 52.7199983596802 VLDELTLAR 0.00332191004417837 1028.58984375 515.3022 1028.58666992188 515.300598144531 2 9 1.1.1.3878.6 0 43.4566 463.302 43.2742 13 8 10 31.5699994564056 14.190000295639 14.190000295639 sp|P02533|K1C14_HUMAN Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4 0 99.0000009536743 VTMQNLNDRLASYLDKVR missed R-L@9; missed K-V@16 -0.010529899969697 2135.10546875 534.7836 2135.11572265625 534.786193847656 4 14 1.1.1.4212.3 0 51.6834 1113.061 51.7248 14 7.96 8 34.0000003576279 21.9999998807907 21.9999998807907 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 2 99.0000009536743 SKEQLTPLIK missed K-E@2 0.0010073899757117 1155.6875 578.851 1155.68627929688 578.850463867188 2 13 1.1.1.3324.13 1 30.4506 537.3437 30.4315 14 7.96 8 34.0000003576279 21.9999998807907 21.9999998807907 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 2 99.0000009536743 SKEQLTPLIKK missed K-E@2; missed K-K@10 0.000798956025391817 1283.78210449219 642.8983 1283.78125 642.89794921875 2 13 1.1.1.3120.6 1 25.9074 190.3957 25.8882 14 7.96 8 34.0000003576279 21.9999998807907 21.9999998807907 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 2 99.0000009536743 SPELQAEAK -0.000286536989733577 971.492065429688 486.7533 971.492370605469 486.753479003906 2 13 1.1.1.2948.5 1 21.8899 740.7322 21.8538 14 7.96 8 34.0000003576279 21.9999998807907 21.9999998807907 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 1.95860815048218 99.0000009536743 VKSPELQAEAK missed K-S@2 -0.00392853980883956 1198.65185546875 400.5579 1198.65576171875 400.559204101563 3 10 1.1.1.2973.2 1 22.4595 494.5747 22.4555 14 7.96 8 34.0000003576279 21.9999998807907 21.9999998807907 sp|P02652|APOA2_HUMAN Apolipoprotein A-II OS=Homo sapiens GN=APOA2 PE=1 SV=1 0 99.0000009536743 SPELQAEAK -0.000286536989733577 971.492065429688 486.7533 971.492370605469 486.753479003906 2 13 1.1.1.2941.4 1 21.7293 740.7322 21.8538 15 7.34 7.34 68.6699986457825 57.8299999237061 57.8299999237061 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 2 99.0000009536743 DVSSALDKLKEFGNTLEDKAR cleaved P-D@N-term; missed K-L@8; missed K-E@10; missed K-A@19 -0.00264950003474951 2335.19946289063 584.8071 2335.20190429688 584.807739257813 4 15 1.1.1.4296.4 1 53.7387 450.8046 53.7322 15 7.34 7.34 68.6699986457825 57.8299999237061 57.8299999237061 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 2 99.0000009536743 IKQSELSAK missed K-Q@2 -0.00104336999356747 1002.56988525391 502.2922 1002.57098388672 502.292755126953 2 12 1.1.1.2801.7 1 18.9234 3879.307 18.9833 15 7.34 7.34 68.6699986457825 57.8299999237061 57.8299999237061 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 2 99.0000009536743 TPDVSSALDKLKEFGNTLEDKARELISR cleaved G-T@N-term; missed K-L@10; missed K-E@12; missed K-A@21; missed R-E@23 -0.0207147002220154 3131.62548828125 627.3324 3131.64624023438 627.336547851563 5 21 1.1.1.4805.2 1 65.9188 163.7487 65.8984 15 7.34 7.34 68.6699986457825 57.8299999237061 57.8299999237061 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 1.10790538787842 99.0000009536743 TPDVSSALDKLKEFGNTLEDKAR cleaved G-T@N-term; missed K-L@10; missed K-E@12; missed K-A@21 0.00384261994622648 2533.30615234375 845.4427 2533.30249023438 845.44140625 3 14 1.1.1.4324.9 1 54.4542 587.4523 54.4692 15 7.34 7.34 68.6699986457825 57.8299999237061 57.8299999237061 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 0.235077023506165 99.0000009536743 MREWFSETFQK Oxidation(M)@1; Dioxidation(W)@4 missed R-E@2 0.0064393999055028 1535.67810058594 768.8463 1535.67150878906 768.843017578125 2 13 1.1.1.3623.3 1 37.4674 1214.278 37.5259 15 7.34 7.34 68.6699986457825 57.8299999237061 57.8299999237061 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 0.000434511806815863 34.1699987649918 KQSELSAK ONE addition +154(K)@1 cleaved I-K@N-term; missed K-Q@1 0.0101891001686454 1043.59643554688 522.8055 1043.58630371094 522.800415039063 2 7 1.1.1.2812.12 1 19.1967 142.5008 19.1772 15 7.34 7.34 68.6699986457825 57.8299999237061 57.8299999237061 sp|P02654|APOC1_HUMAN Apolipoprotein C-I OS=Homo sapiens GN=APOC1 PE=1 SV=1 0 99.0000009536743 TPDVSSALDKLKEFGNTLEDKAR cleaved G-T@N-term; missed K-L@10; missed K-E@12; missed K-A@21 -0.00530698010697961 2533.296875 634.3315 2533.30249023438 634.332885742188 4 12 1.1.1.4323.5 1 54.4251 1681.986 54.495 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 GFSSGSAVVSGGSR -0.000348508008755744 1253.59973144531 627.8071 1253.59997558594 627.807312011719 2 19 1.1.1.3152.6 1 26.6273 375.5928 26.585 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 GGSISGGGYGSGGGK -0.00239001004956663 1196.53991699219 599.2772 1196.54223632813 599.278381347656 2 13 1.1.1.2847.4 1 19.8951 176.4084 19.9283 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 2 99.0000009536743 HGGGGGGFGGGGFGSR 0.00199037999846041 1319.57751464844 660.796 1319.57556152344 660.795043945313 2 14 1.1.1.3106.8 1 25.5557 252.1015 25.5658 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0.0861861482262611 99.0000009536743 AQYEEIAQR -0.00336634996347129 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 10 1.1.1.3111.14 0 25.6802 613.0195 25.7665 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 25.6599992513657 AIADAEQR cleaved D-A@N-term 0.000230478006415069 872.435485839844 437.225 872.435180664063 437.224884033203 2 7 1.1.1.2796.2 0 18.7981 276.7222 18.8396 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 52.7199983596802 AQYEEIAQR -0.00336634996347129 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 9 1.1.1.3118.7 0 25.8522 613.0195 25.7665 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 93.3399975299835 HGGGGGGFGGGGFGSR -0.0013974099420011 1319.57409667969 440.8653 1319.57556152344 440.865783691406 3 8 1.1.1.3108.3 1 25.5951 347.0751 25.5658 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 99.0000009536743 IEISELNR 0.00526374019682407 972.529296875 487.2719 972.523986816406 487.269287109375 2 12 1.1.1.3526.3 0 35.2696 485.3795 35.2568 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 99.0000009536743 LALDVEIATYR 0.00251339003443718 1262.68969726563 632.3521 1262.68701171875 632.350830078125 2 9 1.1.1.4139.7 0 49.8888 212.9456 49.9303 16 6.09 12.05 45.6999987363815 11.4200003445148 11.4200003445148 sp|P35908|K22E_HUMAN Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2 0 43.7999993562698 NLDLDSIIAEVK 0.00508612999692559 1328.72387695313 665.3692 1328.71875 665.366638183594 2 9 1.1.1.4426.7 0 56.9796 505.424 57.0722 17 6.05 6.05 40.8199995756149 16.0999998450279 13.1099998950958 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 ATEHLSTLSEK 0.0012561900075525 1214.61572265625 608.3151 1214.6142578125 608.314392089844 2 17 1.1.1.2998.3 1 23.0574 833.4797 22.9673 17 6.05 6.05 40.8199995756149 16.0999998450279 13.1099998950958 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 LEALKENGGAR missed K-E@5 0.00243560993112624 1156.62243652344 579.3185 1156.61999511719 579.317321777344 2 11 1.1.1.2921.5 1 21.2504 339.6398 21.3036 17 6.05 6.05 40.8199995756149 16.0999998450279 13.1099998950958 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 2 99.0000009536743 THLAPYSDELRQR missed R-Q@11 -0.00351660000160336 1584.79736328125 529.2731 1584.80090332031 529.274230957031 3 17 1.1.1.3197.4 1 27.6413 508.9319 27.6464 17 6.05 6.05 40.8199995756149 16.0999998450279 13.1099998950958 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 0.0545314140617847 58.6399972438812 AELQEGAR 0.000230473000556231 872.435485839844 437.225 872.435180664063 437.224884033203 2 8 1.1.1.2796.2 0 18.7981 276.7222 18.8396 17 6.05 6.05 40.8199995756149 16.0999998450279 13.1099998950958 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 0 99.0000009536743 ATEHLSTLSEK 0.0012561900075525 1214.61572265625 608.3151 1214.6142578125 608.314392089844 2 18 1.1.1.2991.6 1 22.8868 833.4797 22.9673 17 6.05 6.05 40.8199995756149 16.0999998450279 13.1099998950958 sp|P02647|APOA1_HUMAN Apolipoprotein A-I OS=Homo sapiens GN=APOA1 PE=1 SV=1 0 99.0000009536743 LEALKENGGAR Deamidated(N)@7 missed K-E@5 0.00336211989633739 1157.607421875 579.811 1157.60400390625 579.809326171875 2 10 1.1.1.2970.7 1 22.4025 152.2652 22.3599 18 6.04 6.05 19.6199998259544 6.19600005447865 6.19600005447865 sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=1 2 99.0000009536743 ELSLHTNALQDLDGNVFR 0.00222499994561076 2041.02514648438 681.349 2041.02282714844 681.348205566406 3 11 1.1.1.4240.5 1 52.3771 281.0507 52.42 18 6.04 6.05 19.6199998259544 6.19600005447865 6.19600005447865 sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=1 2 99.0000009536743 NSLTHISPR 0.00129032996483147 1023.54748535156 512.781 1023.54614257813 512.780334472656 2 14 1.1.1.3036.2 1 23.8799 588.1285 23.9094 18 6.04 6.05 19.6199998259544 6.19600005447865 6.19600005447865 sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=1 2 99.0000009536743 NWLLLNQPR 0.00249570002779365 1152.64282226563 577.3287 1152.64038085938 577.327453613281 2 11 1.1.1.4131.6 1 49.6944 462.3986 49.7078 18 6.04 6.05 19.6199998259544 6.19600005447865 6.19600005447865 sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=1 0.0236500203609467 37.8600001335144 LTLFGNSLK 0.00335862999781966 991.573669433594 496.7941 991.570251464844 496.792388916016 2 10 1.1.1.4062.2 1 48.0181 1222.572 48.0373 18 6.04 6.05 19.6199998259544 6.19600005447865 6.19600005447865 sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=1 0.0209070984274149 35.1099997758865 YLSLANNK -1.3624399798573E-05 921.492065429688 461.7533 921.492004394531 461.753265380859 2 6 1.1.1.3192.11 1 27.5121 898.8566 27.5499 18 6.04 6.05 19.6199998259544 6.19600005447865 6.19600005447865 sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=1 0 99.0000009536743 NSLTHISPR 0.00129032996483147 1023.54748535156 512.781 1023.54614257813 512.780334472656 2 12 1.1.1.3029.2 1 23.7011 598.5645 23.9338 18 6.04 6.05 19.6199998259544 6.19600005447865 6.19600005447865 sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=1 0 44.1500008106232 NWLLLNQPR 0.00273982994258404 1152.64331054688 577.3289 1152.64038085938 577.327453613281 2 7 1.1.1.4124.6 1 49.5175 459.687 49.7078 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 2 99.0000009536743 SVITFGSYSPR 0.00295804999768734 1212.61682128906 607.3157 1212.61389160156 607.314208984375 2 13 1.1.1.3883.7 1 43.5813 575.8923 43.5669 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 2 99.0000009536743 VAPATGDLLSTGTR 0.0248147994279861 1357.7451171875 679.8798 1357.72009277344 679.867370605469 2 20 1.1.1.3644.8 1 37.9547 929.4453 37.9835 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 1.67778015136719 99.0000009536743 AQYEEVAR -0.000986492028459907 964.46044921875 483.2375 964.46142578125 483.237976074219 2 8 1.1.1.2957.4 1 22.1018 152.066 22.1168 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 0.0555173270404339 60.6199979782104 LKAEIEHAK missed K-A@2 0.00258598010987043 1037.58972167969 519.8021 1037.5869140625 519.800720214844 2 9 1.1.1.2803.4 1 18.9782 111.3838 18.9592 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 0.0376306623220444 99.0000009536743 QLEVLVSDQAR -0.984740972518921 1255.68762207031 628.8511 1256.67248535156 629.343505859375 2 12 1.1.1.3659.5 1 38.3117 2170.864 38.4596 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 0.0136762224137783 26.7199993133545 SNLEPLFESYITNLRR missed R-R@15 0.0110684996470809 1951.02722167969 651.3497 1951.01635742188 651.346069335938 3 8 1.1.1.4392.4 1 56.1339 224.5371 56.1021 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 0 99.0000009536743 LGLDIEIATYR 0.00605332013219595 1262.69311523438 632.3538 1262.68701171875 632.350830078125 2 15 1.1.1.4221.8 0 51.9121 337.096 51.9488 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 0 99.0000009536743 LLEGEESR 0.0030357800424099 931.464050292969 466.7393 931.461059570313 466.737823486328 2 9 1.1.1.2960.2 0 22.168 378.3128 22.1881 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 0 99.0000009536743 SVITFGSYSPR 0.00295804999768734 1212.61682128906 607.3157 1212.61389160156 607.314208984375 2 12 1.1.1.3876.6 1 43.4119 575.8923 43.5669 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 0 99.0000009536743 SVITFGSYSPR 0.00295804999768734 1212.61682128906 607.3157 1212.61389160156 607.314208984375 2 11 1.1.1.3890.6 1 43.7525 575.8923 43.5669 19 5.78 9.97 36.3299995660782 11.9999997317791 10.4999996721745 sp|Q9NSB2|KRT84_HUMAN Keratin, type II cuticular Hb4 OS=Homo sapiens GN=KRT84 PE=1 SV=1 0 99.0000009536743 VAPATGDLLSTGTR 0.0310401003807783 1357.75122070313 679.8829 1357.72009277344 679.867370605469 2 18 1.1.1.3649.4 1 38.0736 1134.099 38.031 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 2 99.0000009536743 ADTLTDEINFLR 0.00904637016355991 1406.71325683594 704.3639 1406.7041015625 704.359375 2 12 1.1.1.4272.4 0 53.1427 486.4033 53.1863 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 2 99.0000009536743 SGFSSISVSR 0.00387427001260221 1025.51806640625 513.7663 1025.51416015625 513.764343261719 2 14 1.1.1.3462.6 1 33.7214 440.9202 33.7825 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 1.72124660015106 99.0000009536743 SLYGLGGSKR missed K-R@9 -0.000160662006237544 1036.56652832031 519.2905 1036.56652832031 519.29052734375 2 7 1.1.1.3139.6 0 26.3056 458.5164 26.2239 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0.0186344906687737 34.1500014066696 QEIAEINR 0.00129686994478106 971.5048828125 486.7597 971.503601074219 486.759094238281 2 6 1.1.1.3111.8 0 25.6752 106.0879 25.6654 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0.00174066168256104 35.0499987602234 ASTSTTIR Protein Terminal Acetyl@N-term cleaved M-A@N-term -0.000727056001778692 877.449890136719 439.7322 877.450500488281 439.732543945313 2 8 1.1.1.3065.4 0 24.5519 586.2944 24.5181 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0 25.6599992513657 AIADAEQR cleaved A-A@N-term 0.000230478006415069 872.435485839844 437.225 872.435180664063 437.224884033203 2 7 1.1.1.2796.2 0 18.7981 276.7222 18.8396 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0 99.0000009536743 AQYEEIAQR -0.00336634996347129 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 10 1.1.1.3111.14 0 25.6802 613.0195 25.7665 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0 52.7199983596802 AQYEEIAQR -0.00336634996347129 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 9 1.1.1.3118.7 0 25.8522 613.0195 25.7665 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0 16.3699999451637 GFSANSAR Lys-add@N-term; Deamidated(N)@5 0.0105178998783231 937.472290039063 469.7434 937.461730957031 469.738159179688 2 10 1.1.1.2786.2 0 18.5636 392.2309 18.577 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0 99.0000009536743 GRLDSELR missed R-L@2 -0.000199925998458639 944.503845214844 473.2592 944.503967285156 473.259246826172 2 10 1.1.1.3032.4 0 23.7824 168.9509 23.8118 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0 99.0000009536743 LALDVEIATYR 0.00251339003443718 1262.68969726563 632.3521 1262.68701171875 632.350830078125 2 9 1.1.1.4139.7 0 49.8888 212.9456 49.9303 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0 43.7999993562698 NLDLDSIIAEVK 0.00508612999692559 1328.72387695313 665.3692 1328.71875 665.366638183594 2 9 1.1.1.4426.7 0 56.9796 505.424 57.0722 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0 57.480001449585 QLDSIVGER 0.0033189500682056 1015.53308105469 508.7738 1015.52984619141 508.772186279297 2 8 1.1.1.3411.13 0 32.5107 653.0375 32.398 20 5.74 11.94 39.1799986362457 12.2299998998642 10.639999806881 sp|P48668|K2C6C_HUMAN Keratin, type II cytoskeletal 6C OS=Homo sapiens GN=KRT6C PE=1 SV=3 0 23.7100005149841 QNLEPLFEQYINNLRR missed R-R@15 0.00243656011298299 2046.0673828125 683.0297 2046.06469726563 683.02880859375 3 9 1.1.1.4418.3 0 56.7787 639.091 56.8729 21 5.3 5.3 19.1899999976158 5.36900013685226 5.36900013685226 sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 2 99.0000009536743 ALMGSPQLVAAVVR 0.00390241993591189 1410.8056640625 706.4101 1410.8017578125 706.408142089844 2 13 1.1.1.4198.2 1 51.3378 235.5812 51.3824 21 5.3 5.3 19.1899999976158 5.36900013685226 5.36900013685226 sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 2 99.0000009536743 TLVTQNSGVEALIHAILR 0.00217771995812655 1934.09704589844 645.7063 1934.09497070313 645.70556640625 3 19 1.1.1.4746.4 1 64.6166 200.6941 64.6217 21 5.3 5.3 19.1899999976158 5.36900013685226 5.36900013685226 sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 1.29242980480194 99.0000009536743 HLTSNSPR 0.000177895999513566 910.462280273438 456.2384 910.462097167969 456.238311767578 2 10 1.1.1.2599.2 1 15.6469 177.6226 15.6643 21 5.3 5.3 19.1899999976158 5.36900013685226 5.36900013685226 sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 0.0123337358236313 25.8300006389618 LNYGIPAIVK 0.00575019000098109 1086.6494140625 544.332 1086.64367675781 544.329162597656 2 6 1.1.1.4045.4 1 47.5981 466.4124 47.6913 21 5.3 5.3 19.1899999976158 5.36900013685226 5.36900013685226 sp|P14923|PLAK_HUMAN Junction plakoglobin OS=Homo sapiens GN=JUP PE=1 SV=3 0 99.0000009536743 ALMGSPQLVAAVVR Oxidation(M)@3; Deamidated(Q)@7 0.0258948002010584 1427.80651855469 714.9105 1427.78063964844 714.897583007813 2 10 1.1.1.4027.10 1 47.1588 342.5242 47.173 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 2 99.0000009536743 LNVEVDAAPTVDLNR 0.00239370996132493 1624.84448242188 813.4295 1624.84204101563 813.428283691406 2 15 1.1.1.3965.17 1 45.6112 550.4069 45.6923 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 2 99.0000009536743 SNHEQEVNTLR 0.00799295026808977 1325.64050292969 663.8275 1325.63244628906 663.823486328125 2 17 1.1.1.2901.4 1 20.7938 217.75 20.8461 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0.528708279132843 99.0000009536743 EVEQWFTTQTEELNK -0.0329779982566834 1880.84631347656 941.4304 1880.87927246094 941.446899414063 2 14 1.1.1.4094.11 1 48.7915 358.3881 48.7793 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0.0419141501188278 56.1299979686737 SQYEALVETNRR missed R-R@11 -0.000900961982551962 1464.73120117188 489.251 1464.73205566406 489.251312255859 3 11 1.1.1.3253.2 1 28.8178 2040.024 28.6757 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0.00612308504059911 15.4799997806549 QLVESDINGLRR missed R-R@11 -0.00360255991108716 1398.75427246094 467.2587 1398.75793457031 467.259918212891 3 9 1.1.1.3501.6 1 34.6557 704.1946 34.7174 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 DNAELENLIR 0.00209301011636853 1185.60107421875 593.8078 1185.59899902344 593.806762695313 2 12 1.1.1.4025.9 0 47.108 1442.089 47.2229 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 DNAELENLIR 0.00209301011636853 1185.60107421875 593.8078 1185.59899902344 593.806762695313 2 13 1.1.1.4032.6 0 47.2803 1442.089 47.2229 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 33.2100003957748 DNAELENLIRER missed R-E@10 -0.00156969996169209 1470.74108886719 736.3778 1470.74267578125 736.378601074219 2 9 1.1.1.3983.11 0 46.0555 984.1 46.1195 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 ETMQFLNDR Oxidation(M)@3 0.00247999001294374 1168.52062988281 585.2676 1168.51831054688 585.266418457031 2 12 1.1.1.3218.2 0 28.1074 514.7029 28.0533 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 ETMQFLNDR Oxidation(M)@3 -0.00228055007755756 1168.51611328125 585.2653 1168.51831054688 585.266418457031 2 12 1.1.1.3209.4 0 27.8974 311.2258 27.8881 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 51.0800004005432 ETMQFLNDRLASYLEK Oxidation(M)@3 missed R-L@9 0.0026410399004817 1972.958984375 658.6603 1972.95642089844 658.659423828125 3 10 1.1.1.4133.5 0 49.7389 552.0541 49.782 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 98.3500003814697 LASYLEK 0.00175820000004023 822.450500488281 412.2325 822.44873046875 412.231628417969 2 9 1.1.1.3177.2 0 27.1676 1099.829 27.1395 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 24.3300005793571 LASYLEK 0.00157511001452804 822.450256347656 412.2324 822.44873046875 412.231628417969 2 8 1.1.1.3169.2 0 26.9994 1086.737 27.1395 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 63.239997625351 LVVQIDNAK 0.00125236995518208 998.577270507813 500.2959 998.576049804688 500.295288085938 2 10 1.1.1.3431.10 0 32.9891 1764.763 32.8991 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 62.9999995231628 LVVQIDNAK 0.00308333989232779 998.5791015625 500.2968 998.576049804688 500.295288085938 2 11 1.1.1.3424.7 0 32.8225 1764.763 32.8991 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 28.2000005245209 LVVQIDNAK -0.00173821998760104 998.574279785156 500.2944 998.576049804688 500.295288085938 2 9 1.1.1.3439.5 0 33.1803 1305.338 32.9229 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 92.5499975681305 NHEQEVNTLR Deamidated(Q)@4 cleaved S-N@N-term -0.00186008994933218 1239.58227539063 414.2014 1239.58435058594 414.202056884766 3 11 1.1.1.2929.3 0 21.4309 417.2485 21.4723 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 92.5499975681305 NHEQEVNTLR Deamidated(Q)@4 cleaved S-N@N-term -0.000934605021029711 1239.58349609375 620.799 1239.58435058594 620.799438476563 2 14 1.1.1.2929.8 0 21.4434 658.1304 21.4723 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 15.6700000166893 QLERDNAELENLIR Gln->pyro-Glu@N-term missed R-D@4 0.00395348994061351 1694.86291503906 848.4387 1694.85876464844 848.436645507813 2 9 1.1.1.4211.13 0 51.6687 253.3616 51.7248 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 QNQEYQVLLDVR Gln->pyro-Glu@N-term 0.0133200995624065 1486.75512695313 744.3848 1486.74157714844 744.378051757813 2 13 1.1.1.4274.3 0 53.1905 313.2505 53.2106 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 21.9300001859665 QNQEYQVLLDVR 0.00321659003384411 1503.77136230469 502.2644 1503.76818847656 502.263336181641 3 7 1.1.1.4058.5 0 47.9209 255.519 47.8645 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 30.0599992275238 QVVSSSEQLQSYQAEIIELRR missed R-R@20 0.00465585011988878 2462.28100585938 821.7676 2462.27661132813 821.76611328125 3 9 1.1.1.4110.9 0 49.1749 787.3632 49.239 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 RTVNALEIELQAQHNLR Formyl@N-term; GlyGly(T)@2 missed R-T@1 0.0117592001333833 2146.13623046875 716.386 2146.12426757813 716.382019042969 3 13 1.1.1.4048.7 0 47.6746 321.3542 47.716 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 SQYEALVETNR Delta:H(2)C(2)@N-term; Deamidated(Q)@2 0.0116124004125595 1335.64233398438 668.8284 1335.63061523438 668.822631835938 2 10 1.1.1.3516.17 0 35.0253 177.9906 35.0337 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 56.3199996948242 SQYEALVETNRR missed R-R@11 -0.00355586991645396 1464.72839355469 489.2501 1464.73205566406 489.251312255859 3 11 1.1.1.3244.2 0 28.6234 2043.514 28.6757 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 TIEELQQK 0.00113973999395967 987.52490234375 494.7697 987.523681640625 494.769104003906 2 11 1.1.1.3081.5 0 24.9421 1170.323 24.9098 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 TVNALEIELQAQHNLR -0.00384218990802765 1847.9814453125 617.0011 1847.9853515625 617.002380371094 3 16 1.1.1.4046.10 0 47.6278 3055.267 47.716 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 TVNALEIELQAQHNLR -0.00384218990802765 1847.9814453125 617.0011 1847.9853515625 617.002380371094 3 15 1.1.1.4053.8 0 47.7991 3055.267 47.716 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 39.7000014781952 VRQLER missed R-Q@2 -6.31055008852854E-05 799.466247558594 400.7404 799.466430664063 400.740509033203 2 8 1.1.1.2702.2 0 16.774 239.4135 16.816 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 YSSQLSQVQSLITNVESQLAEIR 0.00260037998668849 2592.34204101563 865.1213 2592.33959960938 865.120422363281 3 36 1.1.1.5240.2 0 72.7314 328.2573 72.7716 22 4.58 17.47 51.6799986362457 35.5800002813339 33.1699997186661 sp|Q15323|K1H1_HUMAN Keratin, type I cuticular Ha1 OS=Homo sapiens GN=KRT31 PE=1 SV=3 0 99.0000009536743 YSSQLSQVQSLITNVESQLAEIR 0.00260037998668849 2592.34204101563 865.1213 2592.33959960938 865.120422363281 3 35 1.1.1.5248.2 0 72.9294 405.8469 72.8747 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 2 99.0000009536743 FSGSGSGTDFTLK -0.000410050008213148 1302.60864257813 652.3116 1302.60925292969 652.311889648438 2 21 1.1.1.3633.3 1 37.6871 5491.667 37.7456 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 2 99.0000009536743 FSGSGSGTDFTLKISR missed K-I@13 -0.00536709977313876 1658.82092285156 553.9476 1658.82641601563 553.949401855469 3 18 1.1.1.3788.7 1 41.3018 1060.566 41.3093 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0.179798528552055 99.0000009536743 LIYKVSNRDSGVPDRFSGSGSGTDFTLK Carbamidomethyl@N-term; MDA adduct +54(K)@4 missed K-V@4; missed R-D@8; missed R-F@15 -0.0488226003944874 3113.49291992188 779.3805 3113.54174804688 779.392700195313 4 13 1.1.1.3906.14 1 44.1472 1866.522 44.1061 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0.154281973838806 99.0000009536743 YKVSNRDSGVPDRFSGSGSGTDFTLK acrolein addition +38(K)@2; Deamidated(N)@5 cleaved I-Y@N-term; missed K-V@2; missed R-D@6; missed R-F@13 0.0132269002497196 2815.3544921875 704.8459 2815.34130859375 704.842590332031 4 14 1.1.1.3903.10 1 44.0681 6796.519 44.0815 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0.0447934605181217 99.0000009536743 DRFSGSGSGTDFTLK cleaved P-D@N-term; missed R-F@2 -0.994005024433136 1572.74328613281 787.3789 1573.7373046875 787.875915527344 2 11 1.1.1.3973.15 1 45.8066 4415.901 45.9432 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0.0114410435780883 99.0000009536743 VSNRDSGVPDRFSGSGSGTDFTLK Dioxidation(P)@9 missed R-D@4; missed R-F@11 0.0425969995558262 2517.2158203125 630.3112 2517.17309570313 630.300598144531 4 14 1.1.1.3895.9 1 43.8763 7456.453 44.0566 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0.00833099242299795 99.0000009536743 RFSGSGSGTDFTLKISR cleaved D-R@N-term; missed R-F@1; missed K-I@14 -2.03896999359131 1812.88879394531 605.3035 1814.92749023438 605.983093261719 3 14 1.1.1.4008.4 1 46.6797 1975.726 46.7229 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0.00612308504059911 99.0000009536743 DSGVPDRFSGSGSGTDFTLK Dioxidation(P)@5 missed R-F@7 0.0443878993391991 2060.97314453125 687.9983 2060.9287109375 687.983520507813 3 14 1.1.1.3973.9 1 45.8016 8109.592 45.9178 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0.000869458774104714 99.0000009536743 RLIYKVSNRDSGVPDRFSGSGSGTDFTLK acrolein addition +112(K)@5; FMN(S)@7; Deamidated(N)@8 missed R-L@1; missed K-V@5; missed R-D@9; missed R-F@16 0.0330557003617287 3709.77465820313 928.4509 3709.74145507813 928.442626953125 4 15 1.1.1.3902.20 1 44.0508 528.6918 44.1309 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 DRFSGSGSGTDFTLK cleaved P-D@N-term; missed R-F@2 -0.994005024433136 1572.74328613281 787.3789 1573.7373046875 787.875915527344 2 15 1.1.1.3980.17 1 45.9851 4415.901 45.9432 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 FSGSGSGTDFTLK -0.000410050008213148 1302.60864257813 652.3116 1302.60925292969 652.311889648438 2 19 1.1.1.3641.2 1 37.8749 5491.667 37.7456 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 LIYKVSNRDSGVPDRFSGSGSGTDFTLK Carbamidomethyl@N-term; MDA adduct +54(K)@4 missed K-V@4; missed R-D@8; missed R-F@15 -0.0488226003944874 3113.49291992188 779.3805 3113.54174804688 779.392700195313 4 15 1.1.1.3899.12 1 43.9725 1866.522 44.1061 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 VSNRDSGVPDRFSGSGSGTDFTLK Dioxidation(R)@4 missed R-D@4; missed R-F@11 0.0425969995558262 2517.2158203125 630.3112 2517.17309570313 630.300598144531 4 13 1.1.1.3902.15 1 44.0466 7496.563 44.0566 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 VSNRDSGVPDRFSGSGSGTDFTLK Arg-add@N-term; Oxidation(R)@4 missed R-D@4; missed R-F@11 -0.0227029006928205 2657.2568359375 886.7595 2657.279296875 886.76708984375 3 14 1.1.1.3981.17 1 46.0102 1617.457 45.9432 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0 30.6800007820129 VSNRDSGVPDRFSGSGSGTDFTLK Dioxidation(R)@11 missed R-D@4; missed R-F@11 0.0425969995558262 2517.2158203125 630.3112 2517.17309570313 630.300598144531 4 12 1.1.1.3909.13 1 44.2184 7496.563 44.0566 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 YKVSNRDSGVPDRFSGSGSGTDFTLK acrolein addition +38(K)@2; Deamidated(N)@5 cleaved I-Y@N-term; missed K-V@2; missed R-D@6; missed R-F@13 0.0132269002497196 2815.3544921875 704.8459 2815.34130859375 704.842590332031 4 13 1.1.1.3896.11 1 43.9042 6783.639 44.0815 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0 99.0000009536743 YKVSNRDSGVPDRFSGSGSGTDFTLK acrolein addition +38(K)@2; Deamidated(N)@5 cleaved I-Y@N-term; missed K-V@2; missed R-D@6; missed R-F@13 0.0132269002497196 2815.3544921875 704.8459 2815.34130859375 704.842590332031 4 13 1.1.1.3910.12 1 44.2483 6796.519 44.0815 23 4.41 4.41 24.0600004792213 24.0600004792213 24.0600004792213 sp|P06310|KV206_HUMAN Ig kappa chain V-II region RPMI 6410 OS=Homo sapiens PE=4 SV=1 0 20.1199993491173 YKVSNRDSGVPDRFSGSGSGTDFTLKISR acrolein addition +38(K)@2; Deamidated(N)@5 cleaved I-Y@N-term; missed K-V@2; missed R-D@6; missed R-F@13; missed K-I@26 0.0110850995406508 3171.56982421875 635.3212 3171.55859375 635.318969726563 5 11 1.1.1.3954.9 1 45.3314 610.083 45.3448 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 2 99.0000009536743 LEAAVAQSEQQGEAALSDAR 0.00880048982799053 2042.99548339844 1022.505 2042.98681640625 1022.50073242188 2 28 1.1.1.3813.6 1 41.8997 334.4894 41.881 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 2 99.0000009536743 LTAEVENAK -0.00241638999432325 973.505676269531 487.7601 973.507995605469 487.761291503906 2 12 1.1.1.2969.3 1 22.3686 2021.416 22.3361 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0.170696213841438 87.4300003051758 AQYDDIVTR -0.00189173000399023 1079.52282714844 540.7687 1079.52478027344 540.769653320313 2 9 1.1.1.3321.11 1 30.3784 736.6338 30.5275 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0.0472075566649437 62.3099982738495 KYEEEVSLR missed K-Y@1 -0.000698083022143692 1151.58142089844 576.798 1151.58227539063 576.798400878906 2 10 1.1.1.3131.18 1 26.1203 745.4082 26.1254 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0.00700490176677704 19.2399993538857 LLEGEEQR 0.000818562984932214 972.488464355469 487.2515 972.487609863281 487.251098632813 2 9 1.1.1.2962.4 1 22.2238 2038.548 22.2885 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 61.4499986171722 AEAESWYR 0.0058232001028955 1010.45166015625 506.2331 1010.44573974609 506.230163574219 2 11 1.1.1.3256.2 0 28.8703 439.2124 28.8991 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 50.3000020980835 EYQEVMNSK Oxidation(M)@6 0.00230864994227886 1142.49389648438 572.2542 1142.49133300781 572.252990722656 2 11 1.1.1.2789.5 0 18.6434 521.7646 18.6723 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 21.1999997496605 EYQEVMNSK Oxidation(M)@6 0.00230864994227886 1142.49389648438 572.2542 1142.49133300781 572.252990722656 2 9 1.1.1.2796.5 0 18.8106 521.7646 18.6723 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 FAAFIDKVR missed K-V@7 0.00581680005416274 1065.60290527344 533.8087 1065.59716796875 533.805847167969 2 13 1.1.1.3657.4 0 38.2642 1523.466 38.293 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 43.8199996948242 HGETLRR missed R-R@6 -0.000656431016977876 867.466857910156 434.7407 867.467468261719 434.741027832031 2 9 1.1.1.2412.2 0 14.1516 145.0557 14.1631 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 LAELEGALQK 0.00931920018047094 1070.6064453125 536.3105 1070.59716796875 536.305847167969 2 17 1.1.1.3603.7 0 36.9973 1345.019 36.9548 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 60.4200005531311 LAELEGALQK 0.0231125000864267 1070.62023925781 536.3174 1070.59716796875 536.305847167969 2 11 1.1.1.3595.6 0 36.807 576.4236 36.8359 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 LASELNHVQEVLEGYK -0.00309207988902926 1827.93359375 610.3185 1827.93664550781 610.319519042969 3 16 1.1.1.4151.4 0 50.1858 388.9516 50.2025 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 96.8100011348724 LASELNHVQEVLEGYKK missed K-K@16 -0.00844611041247845 1956.02319335938 653.015 1956.03161621094 653.017822265625 3 12 1.1.1.4033.6 0 47.3042 668.7318 47.3218 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 45.4100012779236 LASELNHVQEVLEGYKK missed K-K@16 -0.00557002983987331 1956.02612304688 490.0138 1956.03161621094 490.015197753906 4 11 1.1.1.4034.5 0 47.3281 393.924 47.3218 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 LGLDIEIATYR 0.00605332013219595 1262.69311523438 632.3538 1262.68701171875 632.350830078125 2 15 1.1.1.4221.8 0 51.9121 337.096 51.9488 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 RLYEEEIR missed R-L@1 0.00089575897436589 1106.57312011719 554.2938 1106.57202148438 554.293273925781 2 12 1.1.1.3128.4 0 26.042 435.508 25.9967 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 SRAEAESWYR missed R-A@2 -0.0038308899383992 1253.57495117188 418.8656 1253.57885742188 418.866912841797 3 11 1.1.1.3130.4 0 26.0811 346.0271 26.1003 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 SRAEAESWYR missed R-A@2 0.00039600400486961 1253.57922363281 627.7969 1253.57885742188 627.796752929688 2 13 1.1.1.3130.14 0 26.0895 330.1438 26.1003 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 TKEEINELNR missed K-E@2 0.00122144003398716 1244.63732910156 623.3259 1244.63610839844 623.325317382813 2 14 1.1.1.3024.4 0 23.5843 850.7991 23.7146 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 TKEEINELNR missed K-E@2 0.00122144003398716 1244.63732910156 623.3259 1244.63610839844 623.325317382813 2 17 1.1.1.3031.2 0 23.758 850.7991 23.7146 24 4.22 19.51 51.4900028705597 25.9400010108948 20.5899998545647 sp|Q14533|KRT81_HUMAN Keratin, type II cuticular Hb1 OS=Homo sapiens GN=KRT81 PE=1 SV=2 0 99.0000009536743 TKEEINELNR missed K-E@2 -0.00273823994211853 1244.63342285156 415.8851 1244.63610839844 415.885955810547 3 11 1.1.1.3025.3 0 23.6068 1061.585 23.7388 25 4.2 5.17 37.9000008106232 13.6999994516373 9.84999984502792 sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens GN=KRT36 PE=1 SV=1 2 99.0000009536743 NHEEEVSVLR -0.00145070999860764 1210.59265136719 606.3036 1210.59423828125 606.304382324219 2 11 1.1.1.3132.14 1 26.1435 232.9459 26.1502 25 4.2 5.17 37.9000008106232 13.6999994516373 9.84999984502792 sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens GN=KRT36 PE=1 SV=1 2 99.0000009536743 VPSLAGAAGYISSAR 0.00179439003113657 1418.75341796875 710.384 1418.75183105469 710.383178710938 2 12 1.1.1.4035.6 1 47.3537 521.758 47.3961 25 4.2 5.17 37.9000008106232 13.6999994516373 9.84999984502792 sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens GN=KRT36 PE=1 SV=1 0.14327110350132 85.3399991989136 TITEEIRDGK missed R-D@7 -0.00058546697255224 1160.60302734375 581.3088 1160.60375976563 581.309143066406 2 11 1.1.1.3105.3 1 25.5363 109.7353 25.5414 25 4.2 5.17 37.9000008106232 13.6999994516373 9.84999984502792 sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens GN=KRT36 PE=1 SV=1 0.0574958920478821 67.9099977016449 ENAELESR 0.00166078994516283 946.437255859375 474.2259 946.435607910156 474.225067138672 2 8 1.1.1.2812.8 1 19.1901 238.6413 19.2018 25 4.2 5.17 37.9000008106232 13.6999994516373 9.84999984502792 sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens GN=KRT36 PE=1 SV=1 0 99.0000009536743 ETMQFLNDR Oxidation(M)@3 0.00247999001294374 1168.52062988281 585.2676 1168.51831054688 585.266418457031 2 12 1.1.1.3218.2 0 28.1074 514.7029 28.0533 25 4.2 5.17 37.9000008106232 13.6999994516373 9.84999984502792 sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens GN=KRT36 PE=1 SV=1 0 99.0000009536743 ETMQFLNDR Oxidation(M)@3 -0.00228055007755756 1168.51611328125 585.2653 1168.51831054688 585.266418457031 2 12 1.1.1.3209.4 0 27.8974 311.2258 27.8881 25 4.2 5.17 37.9000008106232 13.6999994516373 9.84999984502792 sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens GN=KRT36 PE=1 SV=1 0 99.0000009536743 QNQEYQVLLDVK Gln->pyro-Glu@N-term; Formyl(K)@12 0.0245535001158714 1486.75512695313 744.3848 1486.73034667969 744.372436523438 2 14 1.1.1.4274.3 0 53.1905 313.2505 53.2106 25 4.2 5.17 37.9000008106232 13.6999994516373 9.84999984502792 sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens GN=KRT36 PE=1 SV=1 0 42.8700000047684 QNQEYQVLLDVK Formyl(K)@12 0.0144499996677041 1503.77136230469 502.2644 1503.75695800781 502.259582519531 3 7 1.1.1.4058.5 0 47.9209 255.519 47.8645 25 4.2 5.17 37.9000008106232 13.6999994516373 9.84999984502792 sp|O76013|KRT36_HUMAN Keratin, type I cuticular Ha6 OS=Homo sapiens GN=KRT36 PE=1 SV=1 0 39.7000014781952 VRQLER missed R-Q@2 -6.31055008852854E-05 799.466247558594 400.7404 799.466430664063 400.740509033203 2 8 1.1.1.2702.2 0 16.774 239.4135 16.816 26 4.01 4.01 27.0900011062622 0.547900004312396 0.372599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 SHDELPR -0.0022392300888896 852.406677246094 427.2106 852.408996582031 427.211761474609 2 9 1.1.1.2811.5 1 19.1655 127.5235 19.1772 26 4.01 4.01 27.0900011062622 0.547900004312396 0.372599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 2 99.0000009536743 TGISPLALIK 0.00304765999317169 1011.63586425781 506.8252 1011.6328125 506.823699951172 2 12 1.1.1.4223.4 1 51.9593 340.2701 52.0479 26 4.01 4.01 27.0900011062622 0.547900004312396 0.372599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.00261361571028829 33.7599992752075 TLQGIPQMIGEVIR Oxidation(M)@8 0.0197391994297504 1569.87463378906 785.9446 1569.85485839844 785.934692382813 2 10 1.1.1.4198.4 1 51.3412 128.7157 51.3333 26 4.01 4.01 27.0900011062622 0.547900004312396 0.372599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0.000869458774104714 76.4699995517731 SGLLTSLK acrolein addition +38(K)@8 cleaved A-S@N-term 0.0336899012327194 855.540283203125 428.7774 855.506591796875 428.760559082031 2 6 1.1.1.4458.2 1 57.7668 389.5197 57.5642 26 4.01 4.01 27.0900011062622 0.547900004312396 0.372599996626377 sp|P04114|APOB_HUMAN Apolipoprotein B-100 OS=Homo sapiens GN=APOB PE=1 SV=1 0 33.8800013065338 QGLKDNVFDGLVR Deamidated(Q)@1; acrolein addition +76(K)@4 cleaved F-Q@N-term; missed K-D@4 0.00517369015142322 1536.798828125 769.4067 1536.79370117188 769.404113769531 2 9 1.1.1.4138.7 0 49.8707 3128.175 50.0291 27 4 6 48.1299996376038 6.55400007963181 6.55400007963181 sp|P19013|K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens GN=KRT4 PE=1 SV=4 2 99.0000009536743 GAFSSVSMSGGAGR Oxidation(M)@8 -5.13915001647547E-05 1285.57202148438 643.7933 1285.57214355469 643.793334960938 2 10 1.1.1.3112.14 1 25.7056 239.5321 25.7417 27 4 6 48.1299996376038 6.55400007963181 6.55400007963181 sp|P19013|K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens GN=KRT4 PE=1 SV=4 2 99.0000009536743 SKAEAEALYQTK missed K-A@2 -0.00143336004111916 1337.68115234375 446.901 1337.68273925781 446.901519775391 3 10 1.1.1.3071.3 1 24.7005 115.1107 24.6907 27 4 6 48.1299996376038 6.55400007963181 6.55400007963181 sp|P19013|K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens GN=KRT4 PE=1 SV=4 0 99.0000009536743 AQYEEIAQR -0.00336634996347129 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 10 1.1.1.3111.14 0 25.6802 613.0195 25.7665 27 4 6 48.1299996376038 6.55400007963181 6.55400007963181 sp|P19013|K2C4_HUMAN Keratin, type II cytoskeletal 4 OS=Homo sapiens GN=KRT4 PE=1 SV=4 0 52.7199983596802 AQYEEIAQR -0.00336634996347129 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 9 1.1.1.3118.7 0 25.8522 613.0195 25.7665 28 4 4 43.2599991559982 3.25599983334541 3.25599983334541 sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 2 99.0000009536743 AGFAGDDAPR 0.00353916990570724 975.444702148438 488.7296 975.440979003906 488.727783203125 2 16 1.1.1.3053.2 1 24.2903 243.5571 24.2715 28 4 4 43.2599991559982 3.25599983334541 3.25599983334541 sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 2 99.0000009536743 SYELPDGQVITIGNER 0.00668356008827686 1789.89123535156 895.9529 1789.88464355469 895.949584960938 2 16 1.1.1.4147.14 1 50.0948 244.0519 50.1281 28 4 4 43.2599991559982 3.25599983334541 3.25599983334541 sp|Q6S8J3|POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=1 SV=3 0.00261361571028829 97.1599996089935 LAPSMMKIR Oxidation(M)@5; reduced acrolein addition +58(K)@7 cleaved A-L@N-term; missed K-I@7 0.00098924501799047 1119.61547851563 560.815 1119.61437988281 560.814514160156 2 7 1.1.1.4346.3 1 54.9968 283.0017 54.9667 29 4 4 11.4399999380112 2.47900001704693 2.47900001704693 sp|Q02413|DSG1_HUMAN Desmoglein-1 OS=Homo sapiens GN=DSG1 PE=1 SV=2 2 99.0000009536743 ESSNVVVTER 0.00439201993867755 1118.56103515625 560.2878 1118.55676269531 560.28564453125 2 11 1.1.1.2996.5 1 23.0063 177.6104 23.0387 29 4 4 11.4399999380112 2.47900001704693 2.47900001704693 sp|Q02413|DSG1_HUMAN Desmoglein-1 OS=Homo sapiens GN=DSG1 PE=1 SV=2 2 99.0000009536743 YVMGNNPADLLAVDSR Oxidation(M)@3 -0.00137923995498568 1749.83422851563 875.9244 1749.83557128906 875.925048828125 2 14 1.1.1.4023.18 1 47.0649 453.0757 46.9972 29 4 4 11.4399999380112 2.47900001704693 2.47900001704693 sp|Q02413|DSG1_HUMAN Desmoglein-1 OS=Homo sapiens GN=DSG1 PE=1 SV=2 0 30.6800007820129 LADISLGK Carbamyl@N-term; MDA adduct +54(K)@8 0.0131189003586769 912.5048828125 457.2597 912.491638183594 457.253112792969 2 11 1.1.1.3346.8 1 30.9773 5193.346 31.0597 29 4 4 11.4399999380112 2.47900001704693 2.47900001704693 sp|Q02413|DSG1_HUMAN Desmoglein-1 OS=Homo sapiens GN=DSG1 PE=1 SV=2 0 30.6800007820129 LADISLGK Carbamyl@N-term; MDA adduct +54(K)@8 0.011348900385201 912.503051757813 457.2588 912.491638183594 457.253112792969 2 11 1.1.1.3354.7 1 31.1453 5133.995 31.0836 29 4 4 11.4399999380112 2.47900001704693 2.47900001704693 sp|Q02413|DSG1_HUMAN Desmoglein-1 OS=Homo sapiens GN=DSG1 PE=1 SV=2 0 99.0000009536743 YVMGNNPADLLAVDSR 0.0112640997394919 1733.85192871094 867.9332 1733.84069824219 867.927612304688 2 19 1.1.1.4165.12 1 50.543 334.5866 50.5301 30 4 4 17.679999768734 17.0200005173683 17.0200005173683 sp|P08519|APOA_HUMAN Apolipoprotein(a) OS=Homo sapiens GN=LPA PE=1 SV=1 2 99.0000009536743 GTYSTTVTGR 0.000433636014349759 1041.50952148438 521.762 1041.50903320313 521.761840820313 2 11 1.1.1.2973.6 1 22.4695 594.2877 22.5039 30 4 4 17.679999768734 17.0200005173683 17.0200005173683 sp|P08519|APOA_HUMAN Apolipoprotein(a) OS=Homo sapiens GN=LPA PE=1 SV=1 2 99.0000009536743 TPEYYPNAGLIMNYCR Oxidation(M)@12; Carbamidomethyl(C)@15 0.00525583000853658 1976.88122558594 989.4479 1976.87609863281 989.4453125 2 17 1.1.1.4008.11 1 46.6914 291.7163 46.6734 30 4 4 17.679999768734 17.0200005173683 17.0200005173683 sp|P08519|APOA_HUMAN Apolipoprotein(a) OS=Homo sapiens GN=LPA PE=1 SV=1 0 34.1699987649918 GTFSTTVTGR Oxidation(F)@3 0.000433642009738833 1041.50952148438 521.762 1041.50903320313 521.761840820313 2 11 1.1.1.2973.6 1 22.4695 594.2877 22.5039 31 2.83 2.83 42.960000038147 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 2 99.0000009536743 VGAHAGEYGAEALERMFLSFPTTK Oxidation(M)@16 missed R-M@15 -0.00562052009627223 2597.2529296875 650.3205 2597.25854492188 650.321899414063 4 18 1.1.1.4297.3 1 53.7631 1210.727 53.7067 31 2.83 2.83 42.960000038147 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 0.832682609558105 99.0000009536743 MFLSFPTTK 0.00983482040464878 1070.55688476563 536.2857 1070.54699707031 536.280822753906 2 8 1.1.1.4154.9 1 50.2625 174.6558 50.2775 31 2.83 2.83 42.960000038147 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 0 68.9499974250793 MFLSFPTTK Oxidation(M)@1 0.00339416996575892 1086.54553222656 544.28 1086.5419921875 544.278259277344 2 9 1.1.1.4010.6 1 46.7302 620.633 46.7229 31 2.83 2.83 42.960000038147 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 0 47.8300005197525 MFLSFPTTK 0.00397564982995391 1070.55102539063 536.2828 1070.54699707031 536.280822753906 2 7 1.1.1.4145.8 1 50.0379 624.5568 49.8808 31 2.83 2.83 42.960000038147 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 0 37.5499993562698 MFLSFPTTK 0.00397564982995391 1070.55102539063 536.2828 1070.54699707031 536.280822753906 2 9 1.1.1.4136.7 1 49.8212 624.5568 49.8808 31 2.83 2.83 42.960000038147 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 0 99.0000009536743 VGAHAGEYGAEALERMFLSFPTTK Oxidation(M)@16 missed R-M@15 0.00596841983497143 2597.26440429688 866.7621 2597.25854492188 866.760070800781 3 15 1.1.1.4294.9 1 53.6916 1413.368 53.7067 32 2.52 2.52 11.5900002419949 4.5889999717474 4.5889999717474 sp|Q5VU13|VSIG8_HUMAN V-set and immunoglobulin domain-containing protein 8 OS=Homo sapiens GN=VSIG8 PE=1 SV=1 2 99.0000009536743 ISGHHYPYR 0.004231589846313 1128.55090332031 565.2827 1128.54650878906 565.280517578125 2 8 1.1.1.2801.8 1 18.9251 173.4165 18.9592 32 2.52 2.52 11.5900002419949 4.5889999717474 4.5889999717474 sp|Q5VU13|VSIG8_HUMAN V-set and immunoglobulin domain-containing protein 8 OS=Homo sapiens GN=VSIG8 PE=1 SV=1 0.511449217796326 99.0000009536743 HGSLPHLQQR reduced HNE(H)@1 cleaved N-H@N-term 0.00909341964870691 1329.76086425781 665.8877 1329.75170898438 665.883117675781 2 10 1.1.1.3749.7 1 40.375 907.0062 40.4039 32 2.52 2.52 11.5900002419949 4.5889999717474 4.5889999717474 sp|Q5VU13|VSIG8_HUMAN V-set and immunoglobulin domain-containing protein 8 OS=Homo sapiens GN=VSIG8 PE=1 SV=1 0.00612308504059911 34.7900003194809 KVIVTVQAR cleaved R-P@C-term; missed K-V@1 -0.000817816006019711 1012.63848876953 507.3265 1012.63934326172 507.326934814453 2 10 1.1.1.3061.2 1 24.4641 108.9192 24.4452 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 2 99.0000009536743 EVQLLESGGGLVQPGGSLR 0.0118490001186728 1895.02307128906 948.5188 1895.01123046875 948.512878417969 2 14 1.1.1.4274.7 1 53.1972 605.9118 53.1863 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0.040005162358284 64.2700016498566 GRFTISR cleaved N-G@N-term; missed R-F@2 0.00108163000550121 835.467468261719 418.741 835.466430664063 418.740509033203 2 10 1.1.1.3037.2 1 23.8926 2079.02 23.9094 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0.000869458774104714 99.0000009536743 LLESGGGLVQPGGSLR Ser->LacticAcid(S)@4; Deamidated(Q)@10 cleaved Q-L@N-term 0.0107004996389151 1524.82543945313 763.42 1524.81481933594 763.414672851563 2 13 1.1.1.3695.4 1 39.1681 31508.34 38.9124 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0.000434511806815863 99.0000009536743 VQLLESGGGLVQPGGSLR Deamidated(Q)@2; GlyGly(S)@6 cleaved E-V@N-term 0.0350667983293533 1881.03076171875 628.0175 1880.99560546875 628.005798339844 3 14 1.1.1.3834.6 1 42.4023 25221.38 42.2399 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 EVQLLESGGGLVQPGGSLR Methyl(E)@1 0.00163873995188624 1909.02844238281 955.5215 1909.02685546875 955.520751953125 2 16 1.1.1.4015.19 1 46.8655 431.5412 46.8722 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 45.4100012779236 EVQLLESGGGLVQPGGSLR -0.000538645021151751 1895.01062011719 632.6775 1895.01123046875 632.677673339844 3 11 1.1.1.3826.8 1 42.2059 438.3887 42.2159 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 92.7100002765656 FTISRNDSKNTLYLLMNSLQAZBTALYYCAR Dioxidation(M)@16; Deamidated(N)@17; Deamidated(B)@23; Carbamidomethyl(C)@29 missed R-N@5; missed K-N@9 -0.0206045992672443 3702.74536132813 926.6936 3702.76586914063 926.69873046875 4 12 1.1.1.4168.16 1 50.6225 6895.872 50.6065 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 46.4800000190735 GRFTISR cleaved N-G@N-term; missed R-F@2 0.00108163000550121 835.467468261719 418.741 835.466430664063 418.740509033203 2 10 1.1.1.3044.2 1 24.0631 5512.504 23.983 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 LLESGGGLVQPGGSLR Ser->LacticAcid(S)@4; Deamidated(Q)@10 cleaved Q-L@N-term 0.0107004996389151 1524.82543945313 763.42 1524.81481933594 763.414672851563 2 16 1.1.1.3679.5 1 38.785 35338.7 38.8648 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 LLESGGGLVQPGGSLR Ser->LacticAcid(S)@4; Deamidated(Q)@10 cleaved Q-L@N-term 0.0107004996389151 1524.82543945313 763.42 1524.81481933594 763.414672851563 2 16 1.1.1.3687.5 1 38.9785 35338.7 38.8648 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 37.9900008440018 LLESGGGLVQPGGSLR Ser->LacticAcid(S)@4; Deamidated(Q)@10 cleaved Q-L@N-term 0.0132638998329639 1524.828125 763.4213 1524.81481933594 763.414672851563 2 13 1.1.1.3707.2 0 39.4155 541.058 39.3732 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 NDSKNTLYLLMNSLQAZBTALYYCAR Oxidation(M)@11; Oxidation(N)@12; Deamidated(Z)@17; Deamidated(B)@18; Carbamidomethyl(C)@24 missed K-N@4 -0.016771299764514 3098.41723632813 1033.813 3098.4326171875 1033.81811523438 3 16 1.1.1.4147.16 1 50.0981 16882.04 50.2273 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 VQLLESGGGLVQPGGSLR Deamidated(Q)@2; GlyGly(S)@6 cleaved E-V@N-term 0.0350667983293533 1881.03076171875 628.0175 1880.99560546875 628.005798339844 3 13 1.1.1.3820.5 0 42.0673 25167.53 42.2399 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 VQLLESGGGLVQPGGSLR Carbamidomethyl@N-term; Carbamidomethyl(E)@5 cleaved E-V@N-term -0.00686345994472504 1880.00463867188 627.6755 1880.01159667969 627.677795410156 3 16 1.1.1.4238.3 1 52.3278 438.0753 52.3215 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 VQLLESGGGLVQPGGSLR Carbamidomethyl@N-term; Carbamidomethyl(E)@5 cleaved E-V@N-term 0.000587589980568737 1880.01232910156 941.0134 1880.01159667969 941.013061523438 2 15 1.1.1.4238.8 1 52.3361 931.006 52.2967 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 VQLLESGGGLVQPGGSLR Carbamidomethyl@N-term; Carbamidomethyl(E)@5 cleaved E-V@N-term 0.00400546006858349 1880.015625 941.0151 1880.01159667969 941.013061523438 2 14 1.1.1.4224.8 1 51.9908 686.1823 52.2228 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 39.7300004959106 VQLLESGGGLVQPGGSLR GlyGly(S)@6 cleaved E-V@N-term -0.0123563995584846 1879.99926757813 627.6737 1880.01159667969 627.677795410156 3 8 1.1.1.4231.6 1 52.1556 392.7986 52.198 33 2.04 2.04 55.460000038147 43.7000006437302 37.8199994564056 sp|P01774|HV313_HUMAN Ig heavy chain V-III region POM OS=Homo sapiens PE=1 SV=1 0 17.849999666214 VQLLESGGGLVQPGGSLR Deamidated(Q)@2; GlyGly(S)@6 cleaved E-V@N-term 0.0356160998344421 1881.03125 628.0177 1880.99560546875 628.005798339844 3 12 1.1.1.3843.7 0 42.6177 961.254 42.5749 34 2.01 2.01 16.2000000476837 1.47299999371171 1.47299999371171 sp|Q13835|PKP1_HUMAN; sp|Q13835-2|PKP1_HUMAN Plakophilin-1 OS=Homo sapiens GN=PKP1 PE=1 SV=2; Isoform 1a of Plakophilin-1 OS=Homo sapiens GN=PKP1 2 99.0000009536743 LLQSGNSDVVR -0.00346335000358522 1186.62731933594 594.3209 1186.63061523438 594.322570800781 2 16 1.1.1.3168.2 1 26.979 226.6168 26.9688 34 2.01 2.01 16.2000000476837 1.47299999371171 1.47299999371171 sp|Q13835|PKP1_HUMAN; sp|Q13835-2|PKP1_HUMAN Plakophilin-1 OS=Homo sapiens GN=PKP1 PE=1 SV=2; Isoform 1a of Plakophilin-1 OS=Homo sapiens GN=PKP1 0.013228265568614 40.0400012731552 QLEYNAR 0.00039627100341022 892.440673828125 447.2276 892.440307617188 447.227416992188 2 6 1.1.1.2967.4 1 22.3218 117.4092 22.3361 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 2 99.0000009536743 SGFSSVSVSR -0.00102800002787262 1011.49749755859 506.756 1011.49853515625 506.756530761719 2 9 1.1.1.3241.5 1 28.546 598.5484 28.3999 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 ADTLTDEINFLR 0.00904637016355991 1406.71325683594 704.3639 1406.7041015625 704.359375 2 12 1.1.1.4272.4 0 53.1427 486.4033 53.1863 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 25.6599992513657 AIADAEQR cleaved A-A@N-term 0.000230478006415069 872.435485839844 437.225 872.435180664063 437.224884033203 2 7 1.1.1.2796.2 0 18.7981 276.7222 18.8396 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 AQYEEIAQR -0.00336634996347129 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 10 1.1.1.3111.14 0 25.6802 613.0195 25.7665 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 52.7199983596802 AQYEEIAQR -0.00336634996347129 1106.5322265625 554.2734 1106.53564453125 554.275085449219 2 9 1.1.1.3118.7 0 25.8522 613.0195 25.7665 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 35.0499987602234 ASTSTTIR Protein Terminal Acetyl@N-term cleaved M-A@N-term -0.000727056001778692 877.449890136719 439.7322 877.450500488281 439.732543945313 2 8 1.1.1.3065.4 0 24.5519 586.2944 24.5181 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 16.3699999451637 GFSANSAR Lys-add@N-term; Deamidated(N)@5 0.0105178998783231 937.472290039063 469.7434 937.461730957031 469.738159179688 2 10 1.1.1.2786.2 0 18.5636 392.2309 18.577 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 GRLDSELR missed R-L@2 -0.000199925998458639 944.503845214844 473.2592 944.503967285156 473.259246826172 2 10 1.1.1.3032.4 0 23.7824 168.9509 23.8118 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 LALDVEIATYR 0.00251339003443718 1262.68969726563 632.3521 1262.68701171875 632.350830078125 2 9 1.1.1.4139.7 0 49.8888 212.9456 49.9303 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 43.7999993562698 NLDLDSIIAEVK 0.00508612999692559 1328.72387695313 665.3692 1328.71875 665.366638183594 2 9 1.1.1.4426.7 0 56.9796 505.424 57.0722 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 34.1500014066696 QEIAEINR 0.00129686994478106 971.5048828125 486.7597 971.503601074219 486.759094238281 2 6 1.1.1.3111.8 0 25.6752 106.0879 25.6654 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 57.480001449585 QLDSIVGER 0.0033189500682056 1015.53308105469 508.7738 1015.52984619141 508.772186279297 2 8 1.1.1.3411.13 0 32.5107 653.0375 32.398 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 23.7100005149841 QNLEPLFEQYINNLRR missed R-R@15 0.00243656011298299 2046.0673828125 683.0297 2046.06469726563 683.02880859375 3 9 1.1.1.4418.3 0 56.7787 639.091 56.8729 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 SGFSSVSVSR 0.00141330005135387 1011.49987792969 506.7572 1011.49853515625 506.756530761719 2 16 1.1.1.3230.2 1 28.3475 594.5339 28.4053 35 2 11.94 36.5200012922287 12.2299998998642 10.639999806881 sp|P02538|K2C6A_HUMAN; cont|000125 Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3; spt|P02538| Keratin, type II cytoskeletal 6A (Cytokeratin 6A) (CK 6A) (K6a keratin) [Homo sapiens (contaminant)] 0 99.0000009536743 SLYGLGGSKR missed K-R@9 -0.000160662006237544 1036.56652832031 519.2905 1036.56652832031 519.29052734375 2 7 1.1.1.3139.6 0 26.3056 458.5164 26.2239 36 2 8 36.149999499321 10.7799999415874 10.7799999415874 sp|P08779|K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4 2 99.0000009536743 EVFTSSSSSSSR 0.00165654998272657 1259.56469726563 630.7896 1259.56298828125 630.788757324219 2 17 1.1.1.2930.2 1 21.4672 460.322 21.5199 36 2 8 36.149999499321 10.7799999415874 10.7799999415874 sp|P08779|K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4 0 99.0000009536743 ALEEANADLEVK 0.00737001979723573 1300.65844726563 651.3365 1300.65100097656 651.332824707031 2 12 1.1.1.3509.15 0 34.854 192.1344 34.8624 36 2 8 36.149999499321 10.7799999415874 10.7799999415874 sp|P08779|K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4 0 99.0000009536743 ALEEANADLEVK 0.00737001979723573 1300.65844726563 651.3365 1300.65100097656 651.332824707031 2 12 1.1.1.3517.14 0 35.0517 192.1344 34.8624 36 2 8 36.149999499321 10.7799999415874 10.7799999415874 sp|P08779|K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4 0 30.6800007820129 LASYLDK Methyl(D)@6 0.00175821001175791 822.450500488281 412.2325 822.44873046875 412.231628417969 2 9 1.1.1.3177.2 0 27.1676 1099.829 27.1395 36 2 8 36.149999499321 10.7799999415874 10.7799999415874 sp|P08779|K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4 0 99.0000009536743 VLDELTLAR 0.00271158991381526 1028.58923339844 515.3019 1028.58666992188 515.300598144531 2 12 1.1.1.3864.5 0 43.1166 593.0206 43.1041 36 2 8 36.149999499321 10.7799999415874 10.7799999415874 sp|P08779|K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4 0 99.0000009536743 VLDELTLAR 0.00271158991381526 1028.58923339844 515.3019 1028.58666992188 515.300598144531 2 9 1.1.1.3857.9 0 42.9506 593.0206 43.1041 36 2 8 36.149999499321 10.7799999415874 10.7799999415874 sp|P08779|K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4 0 98.5300004482269 VLDELTLAR 0.00332191004417837 1028.58984375 515.3022 1028.58666992188 515.300598144531 2 11 1.1.1.3871.3 0 43.285 463.302 43.2742 36 2 8 36.149999499321 10.7799999415874 10.7799999415874 sp|P08779|K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4 0 52.7199983596802 VLDELTLAR 0.00332191004417837 1028.58984375 515.3022 1028.58666992188 515.300598144531 2 9 1.1.1.3878.6 0 43.4566 463.302 43.2742 36 2 8 36.149999499321 10.7799999415874 10.7799999415874 sp|P08779|K1C16_HUMAN Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4 0 99.0000009536743 VTMQNLNDRLASYLDKVR missed R-L@9; missed K-V@16 -0.010529899969697 2135.10546875 534.7836 2135.11572265625 534.786193847656 4 14 1.1.1.4212.3 0 51.6834 1113.061 51.7248 37 2 2 29.1200011968613 0.221200007945299 0.221200007945299 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 2 99.0000009536743 VKEPLSSAK acrolein addition +76(K)@2; MDA adduct +54(K)@9 missed K-E@2 -0.0052734799683094 1087.58605957031 544.8003 1087.59130859375 544.802978515625 2 11 1.1.1.3293.9 1 29.7111 1427.726 29.6212 37 2 2 29.1200011968613 0.221200007945299 0.221200007945299 sp|Q8N3K9|CMYA5_HUMAN Cardiomyopathy-associated protein 5 OS=Homo sapiens GN=CMYA5 PE=1 SV=3 0 53.8500010967255 VKEPLSSAK acrolein addition +76(K)@2; MDA adduct +54(K)@9 missed K-E@2 -0.0052734799683094 1087.58605957031 544.8003 1087.59130859375 544.802978515625 2 11 1.1.1.3285.3 1 29.5212 1427.726 29.6212 38 2 2 47.5499987602234 6.99300020933151 6.99300020933151 sp|P21741|MK_HUMAN Midkine OS=Homo sapiens GN=MDK PE=1 SV=1 2 99.0000009536743 YNAQCQETIR Carbamidomethyl(C)@5 0.00187214999459684 1281.5791015625 641.7968 1281.5771484375 641.7958984375 2 12 1.1.1.3024.5 1 23.5884 109.0674 23.5694 39 2 2 20.3600004315376 2.01299991458654 2.01299991458654 sp|Q08554|DSC1_HUMAN Desmocollin-1 OS=Homo sapiens GN=DSC1 PE=1 SV=2 2 99.0000009536743 VIQSQDGFPAGQELLGYK 0.0149133000522852 1949.00451660156 975.5095 1948.98950195313 975.502014160156 2 12 1.1.1.4137.15 1 49.8494 143.6123 49.8067 40 2 2 50 10.0000001490116 10.0000001490116 sp|P81605|DCD_HUMAN; cont|000124 Dermcidin OS=Homo sapiens GN=DCD PE=1 SV=2; spt|P81605| Dermcidin precursor (Preproteolysin) (Contains: Survival-promoting peptide; DCD-1) [Homo sapiens (contaminant)] 2 99.0000009536743 ENAGEDPGLAR -0.000113114998384845 1127.52062988281 564.7676 1127.52075195313 564.767639160156 2 16 1.1.1.2968.6 1 22.3548 655.6693 22.3837 41 2 2 92.4499988555908 9.43399965763092 9.43399965763092 sp|P0CG06|LAC3_HUMAN Ig lambda-3 chain C regions OS=Homo sapiens GN=IGLC3 PE=1 SV=1 2 99.0000009536743 AGVETTTPSK -0.00085764197865501 989.502075195313 495.7583 989.5029296875 495.758758544922 2 12 1.1.1.2801.6 1 18.9217 1259.726 18.8396 42 2 2 21.4900001883507 4.47800010442734 4.47800010442734 sp|P04406|G3P_HUMAN Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens GN=GAPDH PE=1 SV=3 2 99.0000009536743 GALQNIIPASTGAAK 0.00721189985051751 1410.79028320313 706.4024 1410.78308105469 706.398803710938 2 11 1.1.1.3878.8 1 43.4616 127.6141 43.4691 43 2 2 53.0600011348724 6.80299997329712 6.80299997329712 sp|P02100|HBE_HUMAN Hemoglobin subunit epsilon OS=Homo sapiens GN=HBE1 PE=1 SV=2 2 99.0000009536743 LLVVYPWTQR 0.00290025002323091 1273.72131347656 637.8679 1273.71826171875 637.866394042969 2 13 1.1.1.4241.4 1 52.4049 867.0367 52.4916 44 2 2 9.03099998831749 1.04700000956655 1.04700000956655 sp|P01833|PIGR_HUMAN Polymeric immunoglobulin receptor OS=Homo sapiens GN=PIGR PE=1 SV=4 2 99.0000009536743 RAPAFEGR missed R-A@1 0.00282151997089386 902.47509765625 452.2448 902.472229003906 452.243408203125 2 10 1.1.1.2846.2 1 19.8635 79.5279 19.8321 45 2 2 34.6199989318848 6.1540000140667 6.1540000140667 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 2 99.0000009536743 GNYDAAQR 0.00090069801080972 893.400085449219 447.7073 893.399169921875 447.706848144531 2 12 1.1.1.2725.2 1 17.3395 6460.3 17.2678 45 2 2 34.6199989318848 6.1540000140667 6.1540000140667 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 99.0000009536743 GNYDAAQR -0.00166266004089266 893.3974609375 447.706 893.399169921875 447.706848144531 2 7 1.1.1.2804.4 1 18.9884 153.8081 18.9592 45 2 2 34.6199989318848 6.1540000140667 6.1540000140667 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 52.7199983596802 GNYDAAQR -0.000869241019245237 893.398254394531 447.7064 893.399169921875 447.706848144531 2 7 1.1.1.2797.3 1 18.8262 155.6674 18.577 45 2 2 34.6199989318848 6.1540000140667 6.1540000140667 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 45.4100012779236 GNYDAAQR 0.00090069801080972 893.400085449219 447.7073 893.399169921875 447.706848144531 2 10 1.1.1.2717.2 1 17.1525 6460.3 17.2678 45 2 2 34.6199989318848 6.1540000140667 6.1540000140667 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 43.299999833107 GNYDAAQR 0.00090069801080972 893.400085449219 447.7073 893.399169921875 447.706848144531 2 10 1.1.1.2733.2 1 17.5057 6637.537 17.2678 45 2 2 34.6199989318848 6.1540000140667 6.1540000140667 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 41.5699988603592 GNYDAAQR 0.00090069801080972 893.400085449219 447.7073 893.399169921875 447.706848144531 2 10 1.1.1.2744.2 1 17.696 530.1962 17.6568 45 2 2 34.6199989318848 6.1540000140667 6.1540000140667 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 33.2800000905991 GNYDAAQRGPGGVWAAK Dioxidation(W)@14; Carbamidomethyl(K)@17 missed R-G@8 -0.00649899989366531 1805.83813476563 602.9533 1805.84448242188 602.955444335938 3 12 1.1.1.2942.3 1 21.7473 167.7288 21.7105 45 2 2 34.6199989318848 6.1540000140667 6.1540000140667 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 30.6800007820129 GNYDAAQRGPGGVWAAK Trp->Kynurenin(W)@14 missed R-G@8 -0.045108400285244 1720.78308105469 574.6016 1720.828125 574.616638183594 3 11 1.1.1.3010.2 1 23.299 160.5038 23.2885 46 2 2 15.8700004220009 5.82000017166138 5.82000017166138 sp|P05090|APOD_HUMAN Apolipoprotein D OS=Homo sapiens GN=APOD PE=1 SV=1 2 99.0000009536743 MTVTDQVNCPK Oxidation(M)@1; Carbamidomethyl(C)@9 0.00431165983900428 1307.58923339844 654.8019 1307.5849609375 654.799743652344 2 18 1.1.1.3020.3 1 23.4921 146.16 23.5212 47 2 2 65.7899975776672 21.0500001907349 21.0500001907349 sp|P62988|UBIQ_HUMAN Ubiquitin OS=Homo sapiens GN=RPS27A PE=1 SV=1 2 99.0000009536743 TITLEVEPSDTIENVK 0.00662920996546745 1786.92663574219 894.4706 1786.92004394531 894.46728515625 2 18 1.1.1.4034.16 1 47.3381 338.3601 47.3712 48 2 2 12.3499996960163 5.00000007450581 5.00000007450581 sp|P01877|IGHA2_HUMAN Ig alpha-2 chain C region OS=Homo sapiens GN=IGHA2 PE=1 SV=3 2 99.0000009536743 QEPSQGTTTFAVTSILR 0.00528021017089486 1834.94763183594 918.4811 1834.94250488281 918.478515625 2 17 1.1.1.4208.10 1 51.593 294.9876 51.6259 49 2 2 17.569999396801 6.0809999704361 6.0809999704361 sp|P61626|LYSC_HUMAN Lysozyme C OS=Homo sapiens GN=LYZ PE=1 SV=1 2 99.0000009536743 ATNYNAGDR -3.2279498554999E-05 980.431091308594 491.2228 980.43115234375 491.222869873047 2 9 1.1.1.2722.5 1 17.2627 113.7225 17.2414 50 1.92 2 58.4200024604797 8.91100019216537 8.91100019216537 sp|P02655|APOC2_HUMAN Apolipoprotein C-II OS=Homo sapiens GN=APOC2 PE=1 SV=1 1.92081785202026 99.0000009536743 TAAQNLYEK 0.000707402010448277 1036.51965332031 519.2671 1036.51892089844 519.266723632813 2 12 1.1.1.3033.3 1 23.8068 299.424 23.8362 51 1.82 1.82 40.5600011348724 6.29400014877319 6.29400014877319 sp|P16104|H2AX_HUMAN Histone H2A.x OS=Homo sapiens GN=H2AFX PE=1 SV=2 1.82390916347504 99.0000009536743 AGLQFPVGR 0.00724165979772806 943.53125 472.7729 943.52392578125 472.769256591797 2 10 1.1.1.3781.3 1 41.129 274.1276 41.1663 51 1.82 1.82 40.5600011348724 6.29400014877319 6.29400014877319 sp|P16104|H2AX_HUMAN Histone H2A.x OS=Homo sapiens GN=H2AFX PE=1 SV=2 0 99.0000009536743 AGLQFPVGR 0.0124294003471732 943.536499023438 472.7755 943.52392578125 472.769256591797 2 9 1.1.1.3788.4 1 41.2943 227.2668 41.2855 52 1.68 1.68 3.45400013029575 1.554000005126 1.554000005126 sp|Q5T749|KPRP_HUMAN Keratinocyte proline-rich protein OS=Homo sapiens GN=KPRP PE=1 SV=1 1.67778015136719 99.0000009536743 RSEPIYNSR missed R-S@1 -0.00840802025049925 1120.55432128906 561.2844 1120.5625 561.288513183594 2 11 1.1.1.2840.4 1 19.7313 116.1067 19.7126 53 1.41 1.41 27.1899998188019 13.1600007414818 13.1600007414818 sp|P06702|S10A9_HUMAN Protein S100-A9 OS=Homo sapiens GN=S100A9 PE=1 SV=1 1.40893566608429 99.0000009536743 NIETIINTFHQYSVK 0.0158175993710756 1805.94702148438 903.9808 1805.93115234375 903.972900390625 2 12 1.1.1.4312.10 1 54.1518 346.0034 54.166 53 1.41 1.41 27.1899998188019 13.1600007414818 13.1600007414818 sp|P06702|S10A9_HUMAN Protein S100-A9 OS=Homo sapiens GN=S100A9 PE=1 SV=1 0 49.4300007820129 KDLQNFLKKENKNEKV acrolein addition +112(K)@1; MDA adduct +54(K)@8; MDA adduct +54(K)@9; acrolein addition +94(K)@12 cleaved V-I@C-term; missed K-D@1; missed K-K@8; missed K-E@9; missed K-N@12; missed K-V@15 -0.00089421501616016 2288.20458984375 763.7421 2288.20532226563 763.742370605469 3 10 1.1.1.5222.2 1 72.3847 523.9883 72.4168 53 1.41 1.41 27.1899998188019 13.1600007414818 13.1600007414818 sp|P06702|S10A9_HUMAN Protein S100-A9 OS=Homo sapiens GN=S100A9 PE=1 SV=1 0 46.4399993419647 KDLQNFLKKENKNEKV acrolein addition +112(K)@1; MDA adduct +54(K)@8; MDA adduct +54(K)@9; acrolein addition +94(K)@12 cleaved V-I@C-term; missed K-D@1; missed K-K@8; missed K-E@9; missed K-N@12; missed K-V@15 0.00404947996139526 2288.20922851563 763.7437 2288.20532226563 763.742370605469 3 10 1.1.1.5200.2 1 72.0411 857.8846 72.1131