N Unused Total %Cov %Cov(50) %Cov(95) Accessions Names Used Annotation Contrib Conf Sequence Modifications Cleavages dMass Prec MW Prec m/z Theor MW Theor m/z Theor z Sc Spectrum Specific Time PrecursorSignal PrecursorElution 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0308899004012346 1691.96545410156 846.99 1691.9345703125 846.974548339844 2 24 1.1.1.4537.6 1 56.5237 12825.63 56.6139 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 0.0312824994325638 2497.21459960938 833.4122 2497.18359375 833.401794433594 3 29 1.1.1.4355.4 1 52.0379 2977.079 52.1236 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14; ONE addition +154(K)@21; Methyl+Deamidated(Q)@22 missed K-L@5; missed K-Q@21 0.059909999370575 3035.580078125 759.9023 3035.52026367188 759.887329101563 4 14 1.1.1.4243.5 1 49.2929 490.7507 49.2836 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.0110023003071547 2994.50537109375 500.0915 2994.51611328125 500.093292236328 6 15 1.1.1.4231.4 1 48.9977 4562.865 49.0646 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 0.0312535986304283 3990.1484375 799.037 3990.11767578125 799.030822753906 5 16 1.1.1.4466.2 1 54.7669 930.0419 54.6883 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25; missed K-H@34 0.00875047966837883 4480.42822265625 747.7453 4480.41943359375 747.743835449219 6 18 1.1.1.4353.6 1 51.9872 1335.893 51.8772 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ALKAWSVAR missed K-A@3 0.00667652999982238 1000.58850097656 501.3015 1000.58178710938 501.298187255859 2 13 1.1.1.3328.2 1 27.7272 234.7797 27.6881 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ATEEQLKTVMENFVAFVDK missed K-T@7 0.0280863996595144 2198.12109375 733.7143 2198.09301757813 733.704895019531 3 26 1.1.1.4878.3 1 64.82 476.4751 64.7103 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.0274817999452353 4122.8955078125 825.5864 4122.8681640625 825.580932617188 5 31 1.1.1.4479.7 1 55.0997 1415.004 55.0907 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1; Dehydrated(S)@3; Deamidated(Q)@5 missed K-F@6 0.0126221003010869 1177.56762695313 589.7911 1177.55493164063 589.784790039063 2 11 1.1.1.3612.8 1 34.2962 2159.429 34.444 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 0.0166119001805782 1926.8076171875 643.2765 1926.791015625 643.270935058594 3 25 1.1.1.3453.13 1 30.5059 2007.363 30.6086 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 0.00640511000528932 1137.4970703125 569.7558 1137.49072265625 569.752624511719 2 15 1.1.1.3196.7 1 24.6623 8713.499 24.6241 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Deamidated(N)@8; Carbamidomethyl(C)@12; Dehydrated(S)@14 missed R-R@9 0.0285225994884968 2982.39624023438 746.6063 2982.36743164063 746.59912109375 4 14 1.1.1.4258.7 1 49.6603 1194.984 49.6737 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12; Carbamidomethyl(C)@39 missed R-R@9; missed K-A@25; missed K-L@30 0.064844898879528 5478.63134765625 914.1125 5478.56689453125 914.101745605469 6 19 1.1.1.4454.14 1 54.4768 559.0762 54.462 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 CCTKPESERMPCTEDYLSLILNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12 missed R-M@9 0.0178966000676155 2887.3154296875 722.8361 2887.29736328125 722.831604003906 4 21 1.1.1.4372.3 1 52.4303 1824.215 52.4437 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAFLGSFLYEYSR 0.0235981997102499 1566.75903320313 784.3868 1566.73547363281 784.375 2 22 1.1.1.4633.2 1 58.8762 2272.648 58.8447 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 0.0209116004407406 2457.1943359375 820.072 2457.17333984375 820.065063476563 3 23 1.1.1.4336.7 1 51.573 1420.191 51.5309 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EKVLTSSAR missed K-V@2 0.00322495005093515 989.553894042969 495.7842 989.550537109375 495.782562255859 2 13 1.1.1.2883.2 1 18.2588 1456.802 18.1993 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 ETYGDMADCCEK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.0287925992161036 1477.544921875 739.7797 1477.51599121094 739.765258789063 2 11 1.1.1.3249.11 1 25.9518 101.1574 25.9327 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 EYEATLEECCAK Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.0276477001607418 1501.63403320313 751.8243 1501.6064453125 751.810546875 2 17 1.1.1.3388.9 1 28.9539 0 -1 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 FKDLGEEHFKGLVLIAFSQYLQQCPFDEHVKLVNELTEFAK Carbamidomethyl(C)@24 missed K-D@2; missed K-G@10; missed K-L@31 0.0543964989483356 4866.52783203125 812.0952 4866.47314453125 812.086120605469 6 29 1.1.1.4948.3 1 66.5346 345.6226 66.5717 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIK -0.00559382000938058 1304.70336914063 435.9084 1304.70886230469 435.910217285156 3 14 1.1.1.3642.3 1 34.9812 3194.083 34.9963 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@14 missed K-Q@11; missed K-L@19 0.0169440992176533 3814.92700195313 763.9927 3814.91015625 763.989318847656 5 25 1.1.1.4478.7 1 55.0739 1675.079 55.1164 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPEYAVSVLLR 0.0165282003581524 1282.71984863281 642.3672 1282.70336914063 642.358947753906 2 10 1.1.1.4019.8 1 43.8522 591.8086 43.8136 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 0.0492255985736847 4356.06103515625 872.2195 4356.01171875 872.209655761719 5 33 1.1.1.4563.5 1 57.1623 737.7724 57.1774 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 IETMREKVLTSSAR missed R-E@5; missed K-V@7 -0.00160027004312724 1619.86486816406 540.9622 1619.86645507813 540.962768554688 3 13 1.1.1.3243.7 1 25.8037 691.5109 25.859 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KECCDKPLLEK ONE addition +154(K)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved L-K@N-term; missed K-E@1 0.0130711002275348 1572.80236816406 525.2747 1572.78918457031 525.270324707031 3 12 1.1.1.3195.7 1 24.6391 540.6898 24.6741 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KQTALVELLK missed K-Q@1 0.010530199855566 1141.71765136719 571.8661 1141.70703125 571.860778808594 2 17 1.1.1.3844.5 1 39.6514 6875.094 39.7345 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00579159986227751 1638.93603515625 547.3193 1638.93041992188 547.317443847656 3 22 1.1.1.3850.6 1 39.796 11509.24 39.5446 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LCVLHEKTPVSEK Carbamidomethyl(C)@2 missed K-T@7 0.000196990993572399 1538.81286621094 513.9449 1538.81262207031 513.94482421875 3 18 1.1.1.3291.7 1 26.9408 1310.914 26.9525 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LCVLHEKTPVSEKVTK Carbamidomethyl(C)@2 missed K-T@7; missed K-V@13 0.0131390001624823 1867.03686523438 623.3529 1867.02368164063 623.348510742188 3 19 1.1.1.3298.21 1 27.1165 580.7992 27.1216 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LFTFHADICTLPDTEK Carbamidomethyl(C)@9 0.0171055998653173 1906.9306640625 636.6508 1906.91345214844 636.645080566406 3 21 1.1.1.4262.6 1 49.7591 862.9716 49.7961 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.0271754004061222 1536.82092285156 769.4177 1536.79370117188 769.404113769531 2 15 1.1.1.4272.5 1 50.0105 2376.13 50.1133 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKAWSVAR cleaved A-L@N-term; missed K-A@2 -0.0150033999234438 929.529663085938 465.7721 929.544677734375 465.779632568359 2 10 1.1.1.2947.2 1 19.4865 270.6467 19.5165 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -0.000131141001475044 1531.77368164063 511.5985 1531.77380371094 511.598541259766 3 21 1.1.1.3180.4 1 24.27 4812.9 24.2792 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 0.00223917001858354 2669.31811523438 534.8709 2669.31591796875 534.870483398438 5 19 1.1.1.4273.3 1 50.0216 1757.266 50.0155 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPK Oxidation(P)@6 missed K-F@4 -0.0023233899846673 862.488891601563 432.2517 862.491271972656 432.252899169922 2 9 1.1.1.3048.2 1 21.6426 679.9512 21.5641 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 -0.00636145006865263 1749.96020507813 438.4973 1749.96655273438 438.498901367188 4 16 1.1.1.3666.6 1 35.5209 2627.789 35.5072 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.00675811991095543 2520.42724609375 631.1141 2520.42041015625 631.112365722656 4 19 1.1.1.4557.2 1 57.0109 1080.109 56.9331 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 LVNELTEFAK 0.0119318002834916 1162.63549804688 582.325 1162.62341308594 582.318969726563 2 13 1.1.1.4079.5 1 45.3072 2149.617 45.178 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14 0.0161316003650427 2619.30224609375 655.8328 2619.28588867188 655.828735351563 4 18 1.1.1.4744.2 1 61.5398 1145.233 61.5852 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 MPCTEDYLSLILNRLCVLHEKTPVSEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 0.00791400019079447 3260.63232421875 653.1337 3260.62426757813 653.132141113281 5 18 1.1.1.4701.3 1 60.4535 718.4332 60.4226 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 NYQEAKDAFLGSFLYEYSR missed K-D@6 0.0294266995042562 2300.10424804688 767.7087 2300.07495117188 767.698913574219 3 19 1.1.1.4477.5 1 55.0468 1197.603 55.0907 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 PVSEKVTK cleaved T-P@N-term; missed K-V@5 -0.000637218996416777 886.511901855469 444.2632 886.512390136719 444.263458251953 2 12 1.1.1.2899.2 1 18.6045 329.8792 18.6336 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEK Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 0.00719363987445831 1050.41491699219 526.2147 1050.40771484375 526.211120605469 2 11 1.1.1.3223.5 1 25.3032 298.5768 25.3894 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 missed K-L@8 0.0276699997484684 2511.21264648438 838.0782 2511.18530273438 838.069030761719 3 24 1.1.1.4538.6 1 56.5547 1111.398 56.4668 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLK Dehydrated(T)@2 0.00176868005655706 995.603271484375 498.8089 995.601501464844 498.808044433594 2 12 1.1.1.4201.3 1 48.2811 1361.432 48.2724 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 QTALVELLKHKPK missed K-H@9 0.00421075010672212 1503.91772460938 502.3132 1503.91369628906 502.311828613281 3 13 1.1.1.3593.5 1 33.8556 3271.715 33.9148 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPEYAVSVLLR missed R-H@1 -0.000256895989878103 1438.80432128906 480.6087 1438.80444335938 480.608764648438 3 19 1.1.1.3704.4 1 36.4255 8943.446 36.5116 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANK missed R-H@1 0.0118556004017591 2044.03234863281 682.3514 2044.02062988281 682.347534179688 3 19 1.1.1.4287.5 1 50.3665 1164.816 50.4077 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.011273399926722 4512.12451171875 753.028 4512.11279296875 753.026123046875 6 27 1.1.1.4461.7 1 54.6467 1719.824 54.6137 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 0.0174538996070623 1879.93151855469 627.6511 1879.91381835938 627.645202636719 3 18 1.1.1.3972.5 1 42.7132 4265.994 42.9426 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SHCIAEVEK Carbamidomethyl(C)@3 0.00400782003998756 1071.50610351563 536.7603 1071.501953125 536.758239746094 2 15 1.1.1.2992.6 1 20.5303 2788.212 20.5604 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SHCIAEVEKDAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@3; Carbamidomethyl(C)@30 missed K-D@9; missed K-D@27 0.0612430013716221 3510.72607421875 878.6888 3510.66479492188 878.673461914063 4 26 1.1.1.4281.11 1 50.2254 328.8292 50.211 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.0110624004155397 1418.69738769531 473.9064 1418.68640136719 473.902740478516 3 15 1.1.1.4053.4 1 44.6773 3347.878 44.543 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 SLHTLFGDELCKVASLR Carbamidomethyl(C)@11 missed K-V@12 -0.00842245016247034 1945.00048828125 487.2574 1945.00915527344 487.259552001953 4 19 1.1.1.4405.3 1 53.2186 964.0903 53.2387 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.00417537987232208 1462.57751464844 488.5331 1462.58166503906 488.534515380859 3 16 1.1.1.2894.3 1 18.4911 9425.091 18.5086 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TKCCTESLVNR Acetyl@N-term; hexanoyl addition +98(K)@2; Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved V-T@N-term; missed K-C@2 0.0060859601944685 1506.72302246094 503.2483 1506.71704101563 503.246307373047 3 16 1.1.1.3190.3 1 24.5201 167.0499 24.5007 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TPVSEKVTK missed K-V@6 0.00181342998985201 987.561889648438 494.7882 987.56005859375 494.787292480469 2 15 1.1.1.2896.4 1 18.5472 3084.321 18.6336 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.0155026996508241 1414.69592285156 708.3552 1414.68029785156 708.347412109375 2 15 1.1.1.4245.4 1 49.3425 269.4634 49.3324 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.0264365002512932 3323.4873046875 831.8791 3323.46069335938 831.872436523438 4 25 1.1.1.4323.14 1 51.2527 1832.368 51.2885 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VASLRETYGDMADCCEK Oxidation(M)@11; Carbamidomethyl(C)@14; Carbamidomethyl(C)@15 missed R-E@5 0.0130158001556993 2019.8466796875 674.2895 2019.83361816406 674.28515625 3 24 1.1.1.3276.2 1 26.5919 375.2078 26.5969 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VHKECCHGDLLECADDRADLAK Carbamidomethyl(C)@5; Carbamidomethyl(C)@6; Carbamidomethyl(C)@13 missed K-E@3; missed R-A@17 -0.000276528997346759 2611.15747070313 523.2388 2611.15771484375 523.238830566406 5 16 1.1.1.3386.5 1 28.9064 698.9095 28.8878 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 VPQVSTPTLVEVSR -0.990755975246429 1509.84448242188 504.2888 1510.83544921875 504.619110107422 3 12 1.1.1.4019.6 1 43.8489 265.6056 43.9601 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 0.0182428006082773 1442.65307617188 722.3338 1442.634765625 722.324645996094 2 16 1.1.1.3233.5 1 25.555 12513.24 25.365 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 YICDNQDTISSKLKECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16; Carbamidomethyl(C)@17 missed K-L@12; missed K-E@14 0.00944378040730953 2956.40771484375 592.2888 2956.39794921875 592.286865234375 5 22 1.1.1.3821.5 1 39.109 826.1958 39.0937 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 2 99.0000009536743 YTRKVPQVSTPTLVEVSR Octanoyl(T)@2 missed R-K@3; missed K-V@4 0.0132079999893904 2185.25927734375 1093.637 2185.2470703125 1093.630859375 2 11 1.1.1.3830.8 1 39.3261 0 -1 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.85387206077576 98.580002784729 QNCDQFEKLGEYGFQNALIVRYTR Carbamidomethyl(C)@3 missed K-L@8; missed R-Y@21 0.023327799513936 2948.447265625 738.1191 2948.423828125 738.11328125 4 15 1.1.1.4398.6 1 53.0523 729.4206 53.0432 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.74472737312317 99.0000009536743 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 0.0318428985774517 1739.85412597656 870.9343 1739.822265625 870.918395996094 2 18 1.1.1.4559.5 1 57.0616 929.4136 56.9821 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.69897043704987 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30 0.0369963012635708 4408.13623046875 882.6345 4408.099609375 882.627136230469 5 17 1.1.1.4488.5 1 55.318 981.4196 55.2848 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.67778015136719 97.8600025177002 DAFLGSFLYEYSRRHPEYAVSVLLR missed R-R@13; missed R-H@14 0.0234177000820637 2987.55249023438 747.8954 2987.529296875 747.8896484375 4 15 1.1.1.4704.2 1 60.5302 449.1702 60.5503 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.537602186203 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 0.0183961000293493 3766.77978515625 754.3632 3766.76098632813 754.359436035156 5 16 1.1.1.4554.2 1 56.9367 1008.63 56.8841 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 1.22184872627258 94.0199971199036 AEFVEVTK 0.00287463003769517 921.483703613281 461.7491 921.480773925781 461.747650146484 2 12 1.1.1.3362.4 1 28.3752 7506.331 28.4567 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.995678603649139 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 0.0147268995642662 3605.80102539063 722.1675 3605.78637695313 722.16455078125 5 20 1.1.1.4410.4 1 53.3425 1880.616 53.3124 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.681936681270599 97.9499995708466 DAIPENLPPLTADFAEDK 0.0425724983215332 1954.9951171875 978.5048 1954.95239257813 978.483459472656 2 9 1.1.1.4417.16 1 53.5299 365.3883 53.5903 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.489454984664917 67.5599992275238 LGEYGFQNALIVRYTR missed R-Y@13 0.00311435991898179 1899.00341796875 634.0084 1899.00024414063 634.007385253906 3 11 1.1.1.4298.2 1 50.6287 849.7537 50.5765 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.30016228556633 49.9000012874603 LVVSTQTALA 0.00612596981227398 1001.58184814453 501.7982 1001.57568359375 501.795135498047 2 12 1.1.1.3904.6 1 41.0832 7501.036 40.9737 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.2284125238657 40.8899992704391 LCVLHEK Carbamidomethyl(C)@2 -0.000790801015682518 897.473449707031 449.744 897.474243164063 449.744384765625 2 11 1.1.1.3142.2 1 23.4904 261.4399 23.5193 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.125518172979355 25.1399993896484 LRCASIQKFGER Carbamidomethyl(C)@3 missed R-C@2; missed K-F@8 0.0263340994715691 1463.79309082031 732.9038 1463.76672363281 732.890625 2 7 1.1.1.3237.10 1 25.6545 104.0002 25.6344 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.118045032024384 23.8000005483627 LKHLVDEPQNLIK missed K-H@2 0.00625215983018279 1545.89404296875 516.3053 1545.88781738281 516.30322265625 3 8 1.1.1.3579.9 1 33.5173 125.7448 33.4805 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0952844545245171 19.6899995207787 IETMREK missed R-E@5 -0.00162742997054011 905.462463378906 453.7385 905.464050292969 453.739288330078 2 9 1.1.1.2827.2 1 17.4545 516.6198 17.5367 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0883098393678665 18.4400007128716 YLYEIAR 0.0022182899992913 926.488464355469 464.2515 926.486145019531 464.250366210938 2 10 1.1.1.3648.2 1 35.1341 11331.68 35.0439 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0762380361557007 84.7299993038177 LKHLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR acrolein addition +94(K)@2; MDA adduct +54(K)@13; Carbamidomethyl(C)@16; acrolein addition +76(K)@21 missed K-H@2; missed K-Q@13; missed K-L@21 0.0582675002515316 4280.2314453125 857.0535 4280.1728515625 857.041870117188 5 9 1.1.1.4408.5 1 53.2998 690.6879 53.337 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.0159229654818773 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Lys->Allysine(K)@4; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 0.0275455005466938 4719.3115234375 787.5592 4719.28369140625 787.554565429688 6 15 1.1.1.4501.2 1 55.6282 1039.594 55.6492 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00921730790287256 29.2199999094009 RCASIQK Carbamidomethyl(C)@2 cleaved L-R@N-term; missed R-C@1 0.000725211983080953 861.449890136719 431.7322 861.449096679688 431.731811523438 2 6 1.1.1.2942.2 1 19.3537 109.6142 19.3415 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00833099242299795 29.2199999094009 LLFSSAYSR cleaved L-L@N-term 0.00487812981009483 1042.54968261719 522.2821 1042.54479980469 522.279663085938 2 7 1.1.1.3566.14 1 33.2077 609.3096 33.2144 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.00130484171677381 89.5399987697601 RRDTHKSEIAHRFKDLGEEHFKGLVLIAFSQYLQQCPFDEHVK reduced acrolein addition +58(K)@6; ONE addition +154(K)@14; reduced HNE(H)@20; Deamidated(Q)@31; Carbamidomethyl(C)@36 cleaved F-R@N-term; missed R-R@1; missed R-D@2; missed K-S@6; missed R-F@12; missed K-D@14; missed K-G@22 -0.00310714007355273 5579.8994140625 930.9905 5579.90283203125 930.991088867188 6 11 1.1.1.4714.16 0 60.8046 805.706 60.9955 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000869458774104714 69.2200005054474 CCTESLVNRRPCFSALTPDETYVPKAFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12; Carbamidomethyl(C)@39 missed R-R@9; missed K-A@25; missed K-L@30; missed K-Q@46; missed K-K@49 0.0330043993890285 5958.9052734375 852.2795 5958.873046875 852.274841308594 7 10 1.1.1.4452.7 1 54.4193 551.6265 54.4101 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0.000434511806815863 98.8300025463104 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLL acrolein addition +56(K)@16; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Methyl(D)@29; reduced acrolein addition +96(K)@30; Carbamidomethyl(C)@33 cleaved L-P@C-term; missed R-H@1; missed K-Y@16; missed K-G@30 0.0674957036972046 4453.13232421875 891.6337 4453.064453125 891.620178222656 5 14 1.1.1.4392.2 1 52.9093 713.3853 52.9226 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 22.3700001835823 AEFVEVTK 0.00330185005441308 921.484069824219 461.7493 921.480773925781 461.747650146484 2 10 1.1.1.3370.4 1 28.5461 6970.844 28.5513 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 22.3700001835823 AEFVEVTK 0.00330185005441308 921.484069824219 461.7493 921.480773925781 461.747650146484 2 10 1.1.1.3378.5 1 28.7169 6970.844 28.5513 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 20.1900005340576 AEFVEVTK 0.00330185005441308 921.484069824219 461.7493 921.480773925781 461.747650146484 2 8 1.1.1.3392.6 1 29.0489 2673.781 28.793 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AEFVEVTKLVTDLTK missed K-L@8 0.0308899004012346 1691.96545410156 846.99 1691.9345703125 846.974548339844 2 27 1.1.1.4544.4 1 56.6937 12825.63 56.6139 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 0.0312824994325638 2497.21459960938 833.4122 2497.18359375 833.401794433594 3 34 1.1.1.4362.2 1 52.2085 2977.079 52.1236 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEK Carbamidomethyl(C)@14 missed K-L@5 -0.00556052010506392 2497.17822265625 625.3018 2497.18359375 625.303161621094 4 15 1.1.1.4363.4 1 52.2274 2753.206 52.1236 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21 0.0485420003533363 2866.4697265625 956.4972 2866.42114257813 956.48095703125 3 30 1.1.1.4296.7 1 50.5956 1945.658 50.6488 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 0.031386598944664 2994.5478515625 749.6442 2994.51611328125 749.636291503906 4 15 1.1.1.4230.5 1 48.975 4491.424 49.0646 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 0.056715801358223 2994.57275390625 999.1982 2994.51611328125 999.179321289063 3 20 1.1.1.4231.11 1 49.0094 1215.166 49.0646 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 -0.0110023003071547 2994.50537109375 500.0915 2994.51611328125 500.093292236328 6 17 1.1.1.4238.2 1 49.1661 4562.865 49.0646 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 AFDEKLFTFHADICTLPDTEKQIKK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24 0.031386598944664 2994.5478515625 749.6442 2994.51611328125 749.636291503906 4 18 1.1.1.4238.8 1 49.1786 4491.424 49.0646 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.8500015735626 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25 0.0312535986304283 3990.1484375 799.037 3990.11767578125 799.030822753906 5 13 1.1.1.4459.3 1 54.5936 930.0419 54.6883 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.0099995136261 AFDEKLFTFHADICTLPDTEKQIKKQTALVELLKHKPK Carbamidomethyl(C)@14 missed K-L@5; missed K-Q@21; missed K-K@24; missed K-Q@25; missed K-H@34 -0.0132643999531865 4480.4052734375 641.0652 4480.41943359375 641.067138671875 7 15 1.1.1.4355.2 1 52.0312 2283.632 51.9018 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Oxidation(W)@5 missed K-A@3 0.00496019003912807 1016.58166503906 509.2981 1016.57672119141 509.295623779297 2 9 1.1.1.3094.7 1 22.6658 260.8059 22.6775 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 -0.00407784013077617 1032.56762695313 517.2911 1032.57165527344 517.293090820313 2 10 1.1.1.3104.4 1 22.9118 148.8385 22.8447 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Trp->Kynurenin(W)@5 missed K-A@3 0.00235595996491611 1004.5791015625 503.2968 1004.57672119141 503.295623779297 2 9 1.1.1.3217.5 1 25.1507 446.1304 25.1658 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Oxidation(W)@5 missed K-A@3 0.00300716003403068 1016.57965087891 509.2971 1016.57672119141 509.295623779297 2 8 1.1.1.3237.6 1 25.6462 133.6336 25.6847 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 0.00275777000933886 1032.57446289063 517.2945 1032.57165527344 517.293090820313 2 15 1.1.1.3271.2 1 26.4738 10351.11 26.6917 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 0.00275777000933886 1032.57446289063 517.2945 1032.57165527344 517.293090820313 2 15 1.1.1.3279.5 1 26.6562 10161.33 26.668 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Dioxidation(W)@5 missed K-A@3 0.00275777000933886 1032.57446289063 517.2945 1032.57165527344 517.293090820313 2 12 1.1.1.3287.3 1 26.8524 10161.33 26.668 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR Trp->Kynurenin(W)@5 missed K-A@3 0.00455312011763453 1004.58129882813 503.2979 1004.57672119141 503.295623779297 2 14 1.1.1.3289.2 1 26.8915 3205.145 26.9525 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR missed K-A@3 0.00808027014136314 1000.58984375 501.3022 1000.58178710938 501.298187255859 2 11 1.1.1.3318.4 1 27.55 337.3798 27.512 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ALKAWSVAR missed K-A@3 0.00106156000401825 1000.58288574219 501.2987 1000.58178710938 501.298187255859 2 10 1.1.1.3303.6 1 27.2311 326.8503 27.2411 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 27.1899998188019 ALKAWSVAR Trp->Hydroxykynurenin(W)@5 missed K-A@3 0.00430209981277585 1020.57586669922 511.2952 1020.57165527344 511.293090820313 2 8 1.1.1.3233.4 1 25.5508 918.1412 25.6344 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK Oxidation(M)@10 missed K-T@7 0.0228349007666111 2214.11083984375 739.0442 2214.087890625 739.036560058594 3 23 1.1.1.4448.4 1 54.313 1411.531 54.3582 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK missed K-T@7 0.0280863996595144 2198.12109375 733.7143 2198.09301757813 733.704895019531 3 27 1.1.1.4871.3 1 64.6495 476.4751 64.7103 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDK Oxidation(M)@10 missed K-T@7 0.0208209007978439 2214.10864257813 739.0435 2214.087890625 739.036560058594 3 18 1.1.1.4456.4 1 54.5195 1164.206 54.5887 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.0280920993536711 4122.89599609375 825.5865 4122.8681640625 825.580932617188 5 20 1.1.1.4497.5 1 55.5332 855.1148 55.4545 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.0877368971705437 4122.95458984375 1031.746 4122.8681640625 1031.72436523438 4 26 1.1.1.4478.16 1 55.0814 1057.424 55.0652 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ATEEQLKTVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@10; Carbamidomethyl(C)@20; Carbamidomethyl(C)@21; Carbamidomethyl(C)@29 missed K-T@7; missed K-C@19; missed K-E@26 0.0696711018681526 4122.9384765625 1031.742 4122.8681640625 1031.72436523438 4 13 1.1.1.4495.5 1 55.4903 679.7989 55.4304 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 0.00848122034221888 1194.59008789063 598.3023 1194.58154296875 598.298034667969 2 15 1.1.1.3187.4 1 24.4425 2083.388 24.5497 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1; Deamidated(Q)@5; acrolein addition +56(K)@6 missed K-F@6 0.004437489900738 1251.59619140625 418.206 1251.591796875 418.204528808594 3 9 1.1.1.3189.3 1 24.4856 259.9247 24.5497 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CASIQKFGER Carbamidomethyl(C)@1 missed K-F@6 0.00848122034221888 1194.59008789063 598.3023 1194.58154296875 598.298034667969 2 15 1.1.1.3194.5 1 24.619 2083.388 24.5497 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 19.4499999284744 CASIQKFGER Carbamidomethyl(C)@1; Dehydrated(S)@3; Deamidated(Q)@5 missed K-F@6 0.00798358954489231 1177.56311035156 589.7888 1177.55493164063 589.784790039063 2 10 1.1.1.3628.5 1 34.6767 2295.114 34.5154 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 17.620000243187 CASIQKFGER Carbamidomethyl(C)@1; Dehydrated(S)@3; Deamidated(Q)@5 missed K-F@6 0.00798358954489231 1177.56311035156 589.7888 1177.55493164063 589.784790039063 2 10 1.1.1.3620.9 1 34.4865 2274.552 34.5392 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCAADDKEACFAVEGPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@10 missed K-E@7 0.0166119001805782 1926.8076171875 643.2765 1926.791015625 643.270935058594 3 22 1.1.1.3460.10 1 30.6754 2007.363 30.6086 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNR Carbamidomethyl(C)@1; Carbamidomethyl(C)@2 0.00640511000528932 1137.4970703125 569.7558 1137.49072265625 569.752624511719 2 13 1.1.1.3189.5 1 24.4923 8713.499 24.6241 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.1700000762939 CCTESLVNR Carbamidomethyl(C)@1; No Carbamidomethyl(C)@2 0.0106322998180985 1080.47985839844 541.2472 1080.46923828125 541.241882324219 2 11 1.1.1.3194.2 1 24.6065 143.1635 24.6241 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ser->Oxoalanine(S)@5; Carbamidomethyl(C)@12 missed R-R@9 0.0306292995810509 2997.40893554688 750.3595 2997.37841796875 750.351867675781 4 14 1.1.1.4019.10 1 43.8572 952.0187 43.9112 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 0.0263646002858877 2999.42065429688 750.8624 2999.39404296875 750.855773925781 4 20 1.1.1.4089.13 1 45.5611 8291.765 45.5481 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 0.053218100219965 2982.42065429688 995.1475 2982.36743164063 995.129760742188 3 13 1.1.1.4254.14 1 49.5677 11292.87 49.6737 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 0.053218100219965 2982.42065429688 995.1475 2982.36743164063 995.129760742188 3 16 1.1.1.4261.19 1 49.7405 11292.87 49.6737 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Ammonia-loss(N)@8; Carbamidomethyl(C)@12 missed R-R@9 0.0285225994884968 2982.39624023438 746.6063 2982.36743164063 746.59912109375 4 12 1.1.1.4260.3 1 49.7077 1194.984 49.6737 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.0499997138977 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 0.0545715987682343 2999.447265625 1000.823 2999.39404296875 1000.80523681641 3 11 1.1.1.4082.17 1 45.3931 3524.614 45.5728 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 18.5900002717972 CCTESLVNRRPCFSALTPDETYVPK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Carbamidomethyl(C)@12 missed R-R@9 0.0263646002858877 2999.42065429688 750.8624 2999.39404296875 750.855773925781 4 11 1.1.1.4081.12 1 45.3626 8185.337 45.5481 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; acrolein addition +56(K)@4; No Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 -0.0132371000945568 3749.75756835938 750.9588 3749.77075195313 750.96142578125 5 14 1.1.1.4701.5 1 60.4552 1036.161 60.5246 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.8500015735626 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 0.0183961000293493 3766.77978515625 754.3632 3766.76098632813 754.359436035156 5 13 1.1.1.4547.4 1 56.7666 1008.63 56.8841 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.6799972057343 CCTKPESERMPCTEDYLSLILNRLCVLHEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Lys->Allysine(K)@4; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23 0.023148400709033 3749.75756835938 750.9588 3749.734375 750.954162597656 5 11 1.1.1.4708.3 1 60.6348 1036.161 60.5246 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30 0.0107519002631307 4408.1103515625 735.6923 4408.099609375 735.690490722656 6 17 1.1.1.4488.2 1 55.313 1604.045 55.3089 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0102401999756694 4736.30029296875 677.6216 4736.310546875 677.623046875 7 16 1.1.1.4453.4 1 54.4428 3451.963 54.436 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 86.3699972629547 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 -0.0102401999756694 4736.30029296875 677.6216 4736.310546875 677.623046875 7 13 1.1.1.4453.3 1 54.4419 3451.963 54.436 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 86.3499999046326 CCTKPESERMPCTEDYLSLILNRLCVLHEKTPVSEKVTK Carbamidomethyl(C)@1; Carbamidomethyl(C)@2; Oxidation(M)@10; Carbamidomethyl(C)@12; Carbamidomethyl(C)@25 missed R-M@9; missed R-L@23; missed K-T@30; missed K-V@36 0.0585196018218994 4736.369140625 948.2811 4736.310546875 948.269348144531 5 9 1.1.1.4452.11 1 54.4226 1216.294 54.436 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.0235981997102499 1566.75903320313 784.3868 1566.73547363281 784.375 2 16 1.1.1.4626.3 1 58.6996 2272.648 58.8447 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAFLGSFLYEYSR 0.0271380990743637 1566.76245117188 784.3885 1566.73547363281 784.375 2 21 1.1.1.4643.2 1 59.1136 447.9555 59.1312 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 DAIPENLPPLTADFAEDKDVCK Carbamidomethyl(C)@21 missed K-D@18 0.0209116004407406 2457.1943359375 820.072 2457.17333984375 820.065063476563 3 19 1.1.1.4329.5 1 51.3961 1420.191 51.5309 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EKVLTSSAR Acetyl@N-term missed K-V@2 0.0264931004494429 1031.58764648438 516.8011 1031.56115722656 516.787841796875 2 11 1.1.1.2941.3 1 19.3364 211.6296 19.3672 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EKVLTSSAR Formyl(K)@2 missed K-V@2 0.00276871002279222 1017.54827880859 509.7814 1017.54547119141 509.779998779297 2 10 1.1.1.3130.6 1 23.3132 293.0733 23.3239 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 EKVLTSSAR Glu->pyro-Glu@N-term missed K-V@2 0.00085526000475511 971.540893554688 486.7777 971.539978027344 486.777282714844 2 12 1.1.1.3116.2 1 23.0522 120.1543 23.0812 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 46.6399997472763 EKVLTSSAR missed K-V@2 0.00304185994900763 989.553649902344 495.7841 989.550537109375 495.782562255859 2 11 1.1.1.2869.2 1 18.0892 1582.993 18.1515 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.7699999809265 EKVLTSSAR missed K-V@2 0.00365218007937074 989.554260253906 495.7844 989.550537109375 495.782562255859 2 11 1.1.1.2891.2 1 18.4237 974.8671 18.2289 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 ETYGDMADCCEK Oxidation(M)@6; Carbamidomethyl(C)@9; Carbamidomethyl(C)@10 0.0192518997937441 1493.53002929688 747.7723 1493.51086425781 747.7626953125 2 17 1.1.1.3001.2 1 20.73 327.4003 20.757 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK 0.0131008997559547 1304.72192382813 653.3682 1304.70886230469 653.361694335938 2 19 1.1.1.3641.8 1 34.9674 7047.778 35.0201 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK -0.00559382000938058 1304.70336914063 435.9084 1304.70886230469 435.910217285156 3 14 1.1.1.3642.4 1 34.9845 3194.083 34.9963 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIK Oxidation(P)@6 0.00452218996360898 1320.70849609375 661.3615 1320.70373535156 661.359130859375 2 16 1.1.1.3643.5 1 35.015 0 -1 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.0599985122681 HLVDEPQNLIK Deamidated(Q)@7 0.018062399700284 1305.71105957031 436.2443 1305.69287109375 436.238220214844 3 12 1.1.1.3642.5 1 34.9878 1610.038 34.9963 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HLVDEPQNLIKQNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@14 missed K-Q@11; missed K-L@19 0.0545815005898476 3814.96484375 954.7485 3814.91015625 954.734802246094 4 24 1.1.1.4477.9 1 55.0501 2611.214 55.1164 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.0599985122681 HPEYAVSVLLR 0.0165282003581524 1282.71984863281 642.3672 1282.70336914063 642.358947753906 2 10 1.1.1.4012.9 1 43.6846 591.8086 43.8136 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 0.0755430981516838 4356.0869140625 1090.029 4356.01171875 1090.01025390625 4 18 1.1.1.4564.7 1 57.19 754.7848 57.1774 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 95.7300007343292 HPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamyl@N-term; MDA adduct +54(K)@15; Carbamidomethyl(C)@23; Carbamidomethyl(C)@24; Carbamidomethyl(C)@32 missed K-Y@15; missed K-G@29 0.103881001472473 4453.13232421875 891.6337 4453.0283203125 891.612915039063 5 12 1.1.1.4392.2 1 52.9093 713.3853 52.9226 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 17.7200004458427 IETMREK missed R-E@5 0.000386633997550234 905.464477539063 453.7395 905.464050292969 453.739288330078 2 10 1.1.1.2841.2 1 17.6229 539.4481 17.5877 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 IETMREKVLTSSAR Oxidation(M)@4 missed R-E@5; missed K-V@7 -0.00135359005071223 1635.85986328125 546.2939 1635.86145019531 546.29443359375 3 19 1.1.1.3084.4 1 22.4313 1599.029 22.4853 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 IETMREKVLTSSAR Oxidation(M)@4; Carbamidomethyl(K)@7 missed R-E@5; missed K-V@7 -0.00387158989906311 1692.87902832031 565.3003 1692.8828125 565.301574707031 3 11 1.1.1.3087.10 1 22.5032 167.4935 22.4853 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 46.8100011348724 KECCDKPLLEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@4 cleaved L-K@N-term; missed K-E@1 -0.00347727001644671 1418.68627929688 473.9027 1418.68981933594 473.903869628906 3 8 1.1.1.3180.3 1 24.2658 163.0351 24.2792 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.0107744000852108 1141.71789550781 571.8662 1141.70703125 571.860778808594 2 15 1.1.1.3836.6 1 39.4609 5394.197 39.6869 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KQTALVELLK missed K-Q@1 0.010530199855566 1141.71765136719 571.8661 1141.70703125 571.860778808594 2 17 1.1.1.3852.8 1 39.8462 6875.094 39.7345 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00908733997493982 1638.93933105469 547.3204 1638.93041992188 547.317443847656 3 21 1.1.1.3810.7 1 38.8486 27472.88 39.0699 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Deamidated(Q)@4; Pro->pyro-Glu(P)@8 missed K-V@1 0.0469240993261337 1653.94067382813 827.9776 1653.89379882813 827.954162597656 2 12 1.1.1.3816.5 1 38.9869 365.7585 39.0461 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00908733997493982 1638.93933105469 547.3204 1638.93041992188 547.317443847656 3 21 1.1.1.3818.6 1 39.0361 32879.06 39.1175 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00908733997493982 1638.93933105469 547.3204 1638.93041992188 547.317443847656 3 16 1.1.1.3826.4 1 39.222 42061.85 39.3074 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00908733997493982 1638.93933105469 547.3204 1638.93041992188 547.317443847656 3 24 1.1.1.3826.5 1 39.2245 42061.85 39.3074 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR acrolein addition +56(K)@1; Deamidated(Q)@4 missed K-V@1 0.0366626009345055 1695.9775390625 566.3331 1695.94067382813 566.320861816406 3 17 1.1.1.3831.7 1 39.3431 451.5562 39.2837 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Pro->pyro-Glu(P)@3; Deamidated(Q)@4 missed K-V@1 0.0359511002898216 1653.92980957031 552.3172 1653.89379882813 552.30517578125 3 14 1.1.1.3832.6 1 39.3735 577.3931 39.4023 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00908733997493982 1638.93933105469 547.3204 1638.93041992188 547.317443847656 3 21 1.1.1.3834.5 1 39.4176 42061.85 39.3074 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.0278267003595829 1638.95849609375 820.4865 1638.93041992188 820.472534179688 2 24 1.1.1.3837.5 1 39.4921 21498.26 39.2837 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00908733997493982 1638.93933105469 547.3204 1638.93041992188 547.317443847656 3 21 1.1.1.3842.4 1 39.6107 34411.61 39.3549 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1; Deamidated(Q)@4; Dehydrated(S)@6 missed K-V@1 0.0212140996009111 1679.96704101563 560.9963 1679.94580078125 560.989196777344 3 17 1.1.1.3846.6 1 39.7056 2551.32 39.7583 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR reduced acrolein addition +58(K)@1; Deamidated(Q)@4; Dehydrated(S)@6 missed K-V@1 0.0212140996009111 1679.96704101563 560.9963 1679.94580078125 560.989196777344 3 18 1.1.1.3853.5 1 39.8692 2551.32 39.7583 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR missed K-V@1 0.00872115045785904 1638.93908691406 547.3203 1638.93041992188 547.317443847656 3 17 1.1.1.3857.4 1 39.9587 2533.174 39.7107 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Carbamyl@N-term missed K-V@1 0.0324652008712292 1681.96862792969 841.9916 1681.93627929688 841.975402832031 2 10 1.1.1.4059.9 1 44.8248 337.1553 44.8106 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Formyl(K)@1 missed K-V@1 0.029492300003767 1666.95483398438 834.4847 1666.92541503906 834.469970703125 2 13 1.1.1.4067.14 1 45.0204 788.0235 45.0796 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Formyl(K)@1 missed K-V@1 0.0292480997741222 1666.95471191406 834.4846 1666.92541503906 834.469970703125 2 13 1.1.1.4074.9 1 45.1907 776.7867 45.1041 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Acetyl@N-term missed K-V@1 0.0304432008415461 1680.97143554688 841.493 1680.94104003906 841.477783203125 2 12 1.1.1.4074.10 1 45.1924 713.7012 45.3009 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Acetyl@N-term missed K-V@1 0.0304432008415461 1680.97143554688 841.493 1680.94104003906 841.477783203125 2 9 1.1.1.4081.18 1 45.3676 713.7012 45.3009 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Butyryl(K)@1; Oxidation(P)@3 missed K-V@1 0.0299127995967865 1724.99731445313 863.5059 1724.96728515625 863.490905761719 2 18 1.1.1.4304.10 1 50.7866 1888.605 50.8176 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 KVPQVSTPTLVEVSR Butyryl(K)@1; Oxidation(P)@3 missed K-V@1 0.0257626008242369 1724.99304199219 863.5038 1724.96728515625 863.490905761719 2 16 1.1.1.4297.5 1 50.6096 2247.54 50.6969 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 29.2199999094009 KVPQVSTPTLVEVSR Methyl+Deamidated(Q)@4 missed K-V@1 0.00590017018839717 1653.93603515625 827.9753 1653.93017578125 827.972351074219 2 11 1.1.1.3819.5 1 39.0648 365.7585 39.0461 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.0599985122681 LCVLHEK Carbamidomethyl(C)@2 -0.000607703987043351 897.473693847656 449.7441 897.474243164063 449.744384765625 2 10 1.1.1.3155.5 1 23.6725 377.6245 23.798 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 27.8800010681152 LCVLHEK Carbamidomethyl(C)@2 -0.000607703987043351 897.473693847656 449.7441 897.474243164063 449.744384765625 2 8 1.1.1.3162.4 1 23.8348 377.6245 23.798 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.0161102991551161 1478.80432128906 740.4094 1478.78820800781 740.4013671875 2 22 1.1.1.4309.11 1 50.9019 15608.24 50.9153 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.0161102991551161 1478.80432128906 740.4094 1478.78820800781 740.4013671875 2 21 1.1.1.4311.7 1 50.9479 15608.24 50.9153 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR 0.0161102991551161 1478.80432128906 740.4094 1478.78820800781 740.4013671875 2 19 1.1.1.4316.10 1 51.0744 15608.24 50.9153 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Delta:H(2)C(2)@N-term 0.0239495001733303 1504.82763671875 753.4211 1504.80383300781 753.4091796875 2 18 1.1.1.4418.7 1 53.548 424.0426 53.6415 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR -0.00956638995558023 1478.77868652344 493.9335 1478.78820800781 493.936676025391 3 18 1.1.1.4308.3 1 50.8723 941.8672 50.9153 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Oxidation(Y)@4 0.0236780997365713 1494.806640625 748.4106 1494.78308105469 748.398803710938 2 18 1.1.1.4307.9 1 50.8528 313.8685 50.9646 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Oxidation(Y)@4 0.0236780997365713 1494.806640625 748.4106 1494.78308105469 748.398803710938 2 15 1.1.1.4314.12 1 51.0264 313.8685 50.9646 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LGEYGFQNALIVR Carbamidomethyl(Y)@4; Deamidated(N)@8 0.022859700024128 1536.81652832031 769.4155 1536.79370117188 769.404113769531 2 15 1.1.1.4279.10 1 50.178 2378.677 50.1133 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 86.3699972629547 LGEYGFQNALIVR 0.0161102991551161 1478.80432128906 740.4094 1478.78820800781 740.4013671875 2 11 1.1.1.4318.11 1 51.1253 15608.24 50.9153 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 80.1699995994568 LGEYGFQNALIVR 0.0161102991551161 1478.80432128906 740.4094 1478.78820800781 740.4013671875 2 10 1.1.1.4304.6 1 50.78 15608.24 50.9153 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 19.4499999284744 LKAWSVAR cleaved A-L@N-term; missed K-A@2 -0.0142099997028708 929.530456542969 465.7725 929.544677734375 465.779632568359 2 9 1.1.1.2911.2 1 18.8744 236.0433 18.8795 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKECCDKPLLEK Carbamidomethyl(C)@4; Carbamidomethyl(C)@5 missed K-E@2 -0.000131141001475044 1531.77368164063 511.5985 1531.77380371094 511.598541259766 3 19 1.1.1.3173.3 1 24.099 4818.696 24.2792 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 0.00070046097971499 2697.3115234375 540.4696 2697.31079101563 540.469421386719 5 13 1.1.1.4245.2 1 49.3375 744.2358 49.3811 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 0.0143275996670127 2697.32543945313 675.3386 2697.31079101563 675.3349609375 4 20 1.1.1.4246.6 1 49.3727 585.6429 49.3811 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 0.0211631990969181 2697.33203125 675.3403 2697.31079101563 675.3349609375 4 13 1.1.1.4257.6 1 49.6368 659.8598 49.5029 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 0.0064513199031353 2669.32250976563 668.3379 2669.31591796875 668.336242675781 4 15 1.1.1.4278.7 1 50.1487 1567.377 50.0155 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 93.9400017261505 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 0.0154296001419425 2665.33642578125 667.3414 2665.32104492188 667.337524414063 4 14 1.1.1.4279.7 1 50.173 446.7961 50.2355 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.7099990844727 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18 0.0143275996670127 2697.32543945313 675.3386 2697.31079101563 675.3349609375 4 8 1.1.1.4249.7 1 49.4375 585.6429 49.3811 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 34.5200002193451 LKPDPNTLCDEFKADEKKFWGK Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18 -0.00687040016055107 2665.31420898438 534.0701 2665.32104492188 534.071472167969 5 11 1.1.1.4281.5 1 50.2171 396.996 50.211 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 0.0147268995642662 3605.80102539063 722.1675 3605.78637695313 722.16455078125 5 18 1.1.1.4403.4 1 53.1703 1880.616 53.3124 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0097331004217267 3577.7822265625 597.3043 3577.79150390625 597.305847167969 6 14 1.1.1.4439.3 1 54.0811 1628.951 54.1779 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 0.0205377005040646 3577.81201171875 716.5697 3577.79150390625 716.565612792969 5 14 1.1.1.4439.5 1 54.0828 2071.412 54.1779 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0180568005889654 3605.7685546875 601.9687 3605.78637695313 601.9716796875 6 13 1.1.1.4410.3 1 53.3416 1530.947 53.2879 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.7399995326996 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 0.0147268995642662 3605.80102539063 722.1675 3605.78637695313 722.16455078125 5 11 1.1.1.4418.6 1 53.5472 1899.817 53.3124 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.1000015735626 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 0.0503174997866154 3605.8369140625 902.4665 3605.78637695313 902.453918457031 4 11 1.1.1.4407.6 1 53.2703 679.4614 53.3124 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.1000015735626 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 0.0503174997866154 3605.8369140625 902.4665 3605.78637695313 902.453918457031 4 11 1.1.1.4410.8 1 53.3458 679.4614 53.3124 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 93.9400017261505 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 0.00955448020249605 3573.80615234375 715.7685 3573.79663085938 715.7666015625 5 13 1.1.1.4471.6 1 54.895 1386.64 54.9635 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 89.92999792099 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Dioxidation(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0187892001122236 3605.76806640625 601.9686 3605.78637695313 601.9716796875 6 8 1.1.1.4418.4 1 53.5455 1564.287 53.2879 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 88.2700026035309 LKPDPNTLCDEFKADEKKFWGKYLYEIAR Carbamidomethyl(C)@9; Trp->Kynurenin(W)@20 missed K-A@13; missed K-K@17; missed K-F@18; missed K-Y@22 -0.0097331004217267 3577.7822265625 597.3043 3577.79150390625 597.305847167969 6 8 1.1.1.4447.4 1 54.2872 1628.951 54.1779 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 38.280001282692 LSQKFPK missed K-F@4 0.000576563004869968 846.496887207031 424.2557 846.496337890625 424.255432128906 2 11 1.1.1.3039.3 1 21.4379 28852.12 21.5641 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.0599985122681 LSQKFPK missed K-F@4 0.000576563004869968 846.496887207031 424.2557 846.496337890625 424.255432128906 2 11 1.1.1.3046.2 1 21.5922 28852.12 21.5641 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 30.1400005817413 LSQKFPK missed K-F@4 -0.00265813991427422 846.49365234375 424.2541 846.496337890625 424.255432128906 2 10 1.1.1.3077.2 1 22.2813 191.0799 22.2625 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 19.5299997925758 LSQKFPK missed K-F@4 0.000576563004869968 846.496887207031 424.2557 846.496337890625 424.255432128906 2 10 1.1.1.3049.3 1 21.6674 28852.12 21.5641 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 17.620000243187 LSQKFPK Oxidation(P)@6 missed K-F@4 -0.0023233899846673 862.488891601563 432.2517 862.491271972656 432.252899169922 2 8 1.1.1.3041.3 1 21.4779 679.9512 21.5641 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 0.00797118991613388 1749.97448730469 584.3321 1749.96655273438 584.329467773438 3 20 1.1.1.3663.5 1 35.4478 2424.391 35.531 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTK missed K-F@4; missed K-A@7 0.00797118991613388 1749.97448730469 584.3321 1749.96655273438 584.329467773438 3 27 1.1.1.3671.4 1 35.6449 2424.391 35.531 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 90.310001373291 LSQKFPKAEFVEVTK Formyl(K)@4; reduced acrolein addition +58(K)@7 missed K-F@4; missed K-A@7 0.00798305030912161 1836.01110839844 613.011 1836.00329589844 613.008361816406 3 9 1.1.1.4313.7 1 50.9973 428.3098 51.0141 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.000410703010857105 2520.4208984375 631.1125 2520.42041015625 631.112365722656 4 18 1.1.1.4547.3 1 56.7658 1292.255 56.7859 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 -7.75598018663004E-05 2520.42065429688 631.1124 2520.42041015625 631.112365722656 4 18 1.1.1.4564.2 1 57.1817 754.993 57.2018 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.0301409997045994 2520.45043945313 841.1574 2520.42041015625 841.147399902344 3 15 1.1.1.4549.4 1 56.8158 576.2803 56.8596 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.0301409997045994 2520.45043945313 841.1574 2520.42041015625 841.147399902344 3 16 1.1.1.4556.4 1 56.9899 576.2803 56.8596 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.00626986008137465 2520.42700195313 631.114 2520.42041015625 631.112365722656 4 15 1.1.1.4571.2 1 57.3524 703.6743 57.3483 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.8399982452393 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.00114309997297823 2520.42163085938 631.1127 2520.42041015625 631.112365722656 4 15 1.1.1.4540.3 1 56.5938 906.6234 56.6139 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.3699986934662 LSQKFPKAEFVEVTKLVTDLTK missed K-F@4; missed K-A@7; missed K-L@15 0.0405776984989643 2520.4609375 841.1609 2520.42041015625 841.147399902344 3 14 1.1.1.4540.6 1 56.5963 538.9982 56.6875 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LVNELTEFAK 0.012053900398314 1162.63549804688 582.325 1162.62341308594 582.318969726563 2 9 1.1.1.4065.4 1 44.9621 2185.418 45.2024 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 LVNELTEFAK 0.0119318002834916 1162.63549804688 582.325 1162.62341308594 582.318969726563 2 14 1.1.1.4072.7 1 45.1365 2149.617 45.178 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 41.3500010967255 LVVSTQTALA 0.00789589993655682 1001.58367919922 501.7991 1001.57568359375 501.795135498047 2 11 1.1.1.3918.8 1 41.416 4398.51 41.1648 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 MPCTEDYLSLILNR Oxidation(M)@1; Carbamidomethyl(C)@3 0.0318428985774517 1739.85412597656 870.9343 1739.822265625 870.918395996094 2 15 1.1.1.4552.4 1 56.8894 929.4136 56.9821 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 97.3699986934662 MPCTEDYLSLILNRLCVLHEKTPVSEK Oxidation(M)@1; Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 0.00791400019079447 3260.63232421875 653.1337 3260.62426757813 653.132141113281 5 15 1.1.1.4703.4 1 60.5054 718.4332 60.4226 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 93.9400017261505 MPCTEDYLSLILNRLCVLHEKTPVSEK Carbamidomethyl(C)@3; Carbamidomethyl(C)@16 missed R-L@14; missed K-T@21 0.0103847002610564 3244.63940429688 649.9352 3244.62939453125 649.933166503906 5 12 1.1.1.4722.2 1 60.9996 511.0639 60.9955 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEK Carbamidomethyl(C)@3 0.00291483988985419 1067.43713378906 534.7258 1067.43420410156 534.724365234375 2 13 1.1.1.2974.2 1 20.0858 961.8358 19.9948 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 85.0499987602234 QNCDQFEK Gln->pyro-Glu@N-term; Carbamidomethyl(C)@3 0.00719363987445831 1050.41491699219 526.2147 1050.40771484375 526.211120605469 2 12 1.1.1.3230.2 1 25.4703 298.5768 25.3894 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 19.8500007390976 QNCDQFEK Carbamidomethyl(C)@3 0.00291483988985419 1067.43713378906 534.7258 1067.43420410156 534.724365234375 2 10 1.1.1.2967.5 1 19.918 961.8358 19.9948 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 19.8500007390976 QNCDQFEK Carbamidomethyl(C)@3 0.0026707099750638 1067.43688964844 534.7257 1067.43420410156 534.724365234375 2 9 1.1.1.2981.3 1 20.2577 987.7671 19.9948 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.0372233986854553 2528.24926757813 843.757 2528.2119140625 843.744567871094 3 30 1.1.1.4408.4 1 53.2973 9938.882 53.214 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.0033130100928247 2528.21484375 633.061 2528.2119140625 633.060241699219 4 19 1.1.1.4404.3 1 53.1939 1163.128 53.214 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Oxidation(Y)@12 missed K-L@8 0.0418878011405468 2544.24853515625 849.0901 2544.20678710938 849.076171875 3 12 1.1.1.4405.13 1 53.2269 340.3514 53.214 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.7399995326996 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3; Carbamidomethyl(Y)@12; Deamidated(N)@16 missed K-L@8 0.0401571989059448 2586.25732421875 863.0931 2586.21728515625 863.079711914063 3 12 1.1.1.4363.9 1 52.2315 1359.845 52.2951 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 16.0300001502037 QNCDQFEKLGEYGFQNALIVR Carbamidomethyl(C)@3 missed K-L@8 0.0372233986854553 2528.24926757813 843.757 2528.2119140625 843.744567871094 3 9 1.1.1.4400.7 1 53.0996 9938.882 53.214 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 QTALVELLK 0.00835341960191727 1013.62048339844 507.8175 1013.61212158203 507.813323974609 2 12 1.1.1.4202.4 1 48.3008 21204.43 48.2484 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 96.7599987983704 QTALVELLK Gln->pyro-Glu@N-term 0.00261122011579573 996.588256835938 499.3014 996.585571289063 499.300048828125 2 14 1.1.1.4635.2 1 58.9269 1303.78 58.8929 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.0599985122681 QTALVELLK 0.00835341960191727 1013.62048339844 507.8175 1013.61212158203 507.813323974609 2 11 1.1.1.4209.3 1 48.4698 22202.82 48.2246 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPEYAVSVLLR missed R-H@1 0.000109296997834463 1438.80456542969 480.6088 1438.80444335938 480.608764648438 3 19 1.1.1.3712.3 1 36.5935 8860.848 36.5116 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0537470988929272 4512.16650390625 903.4406 4512.11279296875 903.429870605469 5 31 1.1.1.4453.10 1 54.4478 3770.122 54.5887 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Deamidated(N)@18; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0468720011413097 4513.1435546875 903.636 4513.09716796875 903.626647949219 5 20 1.1.1.4432.7 1 53.907 1173.339 53.9238 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.011273399926722 4512.12451171875 753.028 4512.11279296875 753.026123046875 6 19 1.1.1.4454.6 1 54.4701 1719.824 54.6137 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0892508998513222 4512.20263671875 1129.058 4512.11279296875 1129.03552246094 4 19 1.1.1.4457.13 1 54.5519 1373.521 54.5887 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0892508998513222 4512.20263671875 1129.058 4512.11279296875 1129.03552246094 4 19 1.1.1.4458.15 1 54.5786 1373.521 54.5887 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0892508998513222 4512.20263671875 1129.058 4512.11279296875 1129.03552246094 4 16 1.1.1.4460.11 1 54.6251 1373.521 54.5887 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK ONE addition +154(K)@16; Carbamidomethyl(Y)@17; Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0895973965525627 4723.32275390625 945.6719 4723.23388671875 945.654052734375 5 17 1.1.1.4458.8 1 54.5728 28601.79 54.8128 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 16.0300001502037 RHPYFYAPELLYYANKYNGVFQECCQAEDKGACLLPK Carbamidomethyl(C)@24; Carbamidomethyl(C)@25; Carbamidomethyl(C)@33 missed R-H@1; missed K-Y@16; missed K-G@30 0.0537470988929272 4512.16650390625 903.4406 4512.11279296875 903.429870605469 5 32 1.1.1.4460.5 1 54.6201 3770.122 54.5887 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 0.0174538996070623 1879.93151855469 627.6511 1879.91381835938 627.645202636719 3 22 1.1.1.3979.7 1 42.8826 4504.383 42.9426 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 0.0174538996070623 1879.93151855469 627.6511 1879.91381835938 627.645202636719 3 16 1.1.1.3982.5 1 42.9583 4504.383 42.9426 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 0.0174538996070623 1879.93151855469 627.6511 1879.91381835938 627.645202636719 3 22 1.1.1.3986.9 1 43.0558 4504.383 42.9426 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 RPCFSALTPDETYVPK Carbamidomethyl(C)@3 0.0174538996070623 1879.93151855469 627.6511 1879.91381835938 627.645202636719 3 15 1.1.1.3993.10 1 43.2225 4247.486 42.9667 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SHCIAEVEK Acetyl@N-term; Carbamidomethyl(C)@3 0.00746838981285691 1113.51989746094 557.7672 1113.51245117188 557.763488769531 2 14 1.1.1.3259.4 1 26.1897 249.459 26.2185 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 42.1700000762939 SLGKVGTR Acetyl(K)@4 missed K-V@4 -1.67347006936325E-05 858.492248535156 430.2534 858.492309570313 430.253448486328 2 9 1.1.1.3163.2 1 23.8531 1196.509 23.9428 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 33.390000462532 SLGKVGTR Acetyl(K)@4 missed K-V@4 -1.67347006936325E-05 858.492248535156 430.2534 858.492309570313 430.253448486328 2 10 1.1.1.3170.2 1 24.0206 1196.509 23.9428 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.0210158992558718 1418.70751953125 710.361 1418.68640136719 710.350463867188 2 15 1.1.1.4043.9 1 44.4375 4940.177 44.5673 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.0110624004155397 1418.69738769531 473.9064 1418.68640136719 473.902740478516 3 14 1.1.1.4045.6 1 44.4794 3347.878 44.543 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.0210158992558718 1418.70751953125 710.361 1418.68640136719 710.350463867188 2 19 1.1.1.4050.7 1 44.6044 4940.177 44.5673 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCK Carbamidomethyl(C)@11 0.0210158992558718 1418.70751953125 710.361 1418.68640136719 710.350463867188 2 17 1.1.1.4057.9 1 44.7787 4940.177 44.5673 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 SLHTLFGDELCKVASLR Carbamidomethyl(C)@11 missed K-V@12 0.0104168001562357 1945.01953125 649.3471 1945.00915527344 649.343627929688 3 21 1.1.1.4404.4 1 53.1956 1088.015 53.2387 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 0.0135505003854632 1462.59521484375 732.3049 1462.58166503906 732.298095703125 2 21 1.1.1.2892.5 1 18.4559 2280.595 18.5086 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 0.0135505003854632 1462.59521484375 732.3049 1462.58166503906 732.298095703125 2 13 1.1.1.2895.5 1 18.5274 2280.595 18.5086 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 0.0135505003854632 1462.59521484375 732.3049 1462.58166503906 732.298095703125 2 19 1.1.1.2900.5 1 18.6285 2280.496 18.5086 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 3.58403995051049E-05 1462.58166503906 488.5345 1462.58166503906 488.534515380859 3 13 1.1.1.2924.2 1 19.0278 206.4691 19.0391 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 46.6399997472763 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.00417537987232208 1462.57751464844 488.5331 1462.58166503906 488.534515380859 3 11 1.1.1.2902.2 1 18.6621 9425.091 18.5086 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 44.3800002336502 TCVADESHAGCEK Carbamidomethyl(C)@2; Carbamidomethyl(C)@11 -0.0044500301592052 1462.5771484375 488.533 1462.58166503906 488.534515380859 3 12 1.1.1.2910.3 1 18.8501 1622.188 18.6096 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TPVSEKVTK missed K-V@6 0.00181342998985201 987.561889648438 494.7882 987.56005859375 494.787292480469 2 15 1.1.1.2904.4 1 18.724 3084.321 18.6336 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TPVSEKVTK missed K-V@6 0.00181342998985201 987.561889648438 494.7882 987.56005859375 494.787292480469 2 14 1.1.1.2912.3 1 18.8987 2354.422 18.6574 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TPVSEKVTK Acetyl(K)@6 missed K-V@6 0.00243791006505489 1029.57312011719 515.7938 1029.57067871094 515.792602539063 2 11 1.1.1.3182.3 1 24.3177 170.6921 24.3286 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDK Oxidation(M)@3 0.0227045007050037 1414.703125 708.3588 1414.68029785156 708.347412109375 2 15 1.1.1.4238.6 1 49.1736 327.9385 49.2104 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 95.0800001621246 TVMENFVAFVDK 0.00670908996835351 1398.69201660156 700.3533 1398.68530273438 700.349975585938 2 11 1.1.1.4477.4 1 55.0459 378.8741 55.1164 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 46.6399997472763 TVMENFVAFVDK Oxidation(M)@3 0.0242913998663425 1414.70471191406 708.3596 1414.68029785156 708.347412109375 2 12 1.1.1.4230.4 1 48.9734 321.9421 48.9918 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.0264365002512932 3323.4873046875 831.8791 3323.46069335938 831.872436523438 4 21 1.1.1.4330.5 1 51.4177 1832.368 51.2885 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.0702619999647141 3323.53100585938 1108.851 3323.46069335938 1108.82751464844 3 27 1.1.1.4316.18 1 51.0836 739.5281 51.0887 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 98.8300025463104 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Deamidated(N)@5; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.0550815984606743 3324.49975585938 832.1322 3324.44482421875 832.118469238281 4 12 1.1.1.4322.7 1 51.2218 1352.327 51.3125 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 62.6699984073639 TVMENFVAFVDKCCAADDKEACFAVEGPK Oxidation(M)@3; Carbamidomethyl(C)@13; Carbamidomethyl(C)@14; Carbamidomethyl(C)@22 missed K-C@12; missed K-E@19 0.0315632000565529 3323.49243164063 831.8804 3323.46069335938 831.872436523438 4 12 1.1.1.4314.14 1 51.0281 2975.258 51.0887 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR 0.0266199000179768 1510.8623046875 756.4384 1510.83544921875 756.425048828125 2 21 1.1.1.4018.9 1 43.8279 2546.572 43.9112 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 VPQVSTPTLVEVSR Arg-add@N-term 0.0222869999706745 1666.95910644531 834.4868 1666.93664550781 834.4755859375 2 11 1.1.1.4118.14 1 46.2732 212.0157 46.2816 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 0.0182428006082773 1442.65307617188 722.3338 1442.634765625 722.324645996094 2 16 1.1.1.3219.8 1 25.2061 12513.24 25.365 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 0.0182428006082773 1442.65307617188 722.3338 1442.634765625 722.324645996094 2 21 1.1.1.3226.6 1 25.3768 12513.24 25.365 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Trioxidation(Y)@1; Carbamidomethyl(C)@3 0.020499000325799 1490.64001464844 746.3273 1490.61950683594 746.317016601563 2 10 1.1.1.3224.7 1 25.3328 169.4115 25.365 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 99.0000009536743 YICDNQDTISSK Carbamidomethyl(C)@3 0.0186090003699064 1442.65344238281 722.334 1442.634765625 722.324645996094 2 9 1.1.1.3196.11 1 24.669 121.9013 24.6492 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 43.2599991559982 YICDNQDTISSK Carbamidomethyl(C)@3 -0.00234774989075959 1442.63232421875 481.8847 1442.634765625 481.885528564453 3 12 1.1.1.3227.3 1 25.3987 476.6382 25.365 1 147.26 147.26 94.8899984359741 86.6599977016449 84.3500018119812 cont|000035 gi|2190337|emb|CAA41735.1| serum albumin [Bos taurus (contaminant)] 0 37.7099990844727 YICDNQDTISSK Dioxidation(Y)@1; Carbamidomethyl(C)@3 0.0186877995729446 1474.64331054688 738.3289 1474.62463378906 738.319580078125 2 11 1.1.1.3223.7 1 25.3082 357.5934 25.365 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 EQFINAAK cleaved N-E@N-term 0.00323767005465925 919.479675292969 460.7471 919.476318359375 460.745452880859 2 8 1.1.1.3242.3 0 25.7704 810.61 25.859 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term 0.0149069996550679 1345.7060546875 673.8603 1345.69116210938 673.852844238281 2 17 1.1.1.4236.3 1 49.124 605.0437 48.9918 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IDVLEGNEQFINAAK cleaved N-I@N-term 0.0275752991437912 1659.87451171875 830.9445 1659.84680175781 830.9306640625 2 17 1.1.1.4166.9 1 47.4423 303.8886 47.4081 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IITHPNFNGN cleaved N-T@C-term 0.00709279021248221 1125.56384277344 563.7892 1125.55676269531 563.78564453125 2 14 1.1.1.3414.4 1 29.5737 490.6596 29.5788 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IITHPNFNGNTLDND cleaved D-I@C-term 0.0330154001712799 1683.81823730469 842.9164 1683.78527832031 842.89990234375 2 21 1.1.1.3787.8 1 38.322 479.2164 38.3059 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.0167126003652811 2282.189453125 761.7371 2282.1728515625 761.731567382813 3 27 1.1.1.4370.3 1 52.3793 41569.14 52.4677 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00291978009045124 3308.7158203125 662.7504 3308.71875 662.751037597656 5 21 1.1.1.4478.4 1 55.0714 2856.452 54.9891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IMLIKLSSPATLNSR Methyl(K)@5 cleaved D-I@N-term; missed K-L@5 0.0147582003846765 1656.97448730469 553.3321 1656.95971679688 553.3271484375 3 20 1.1.1.4168.3 1 47.4857 1064.587 47.5058 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNID cleaved D-V@C-term; missed R-L@4 0.00840375013649464 1292.69201660156 647.3533 1292.68371582031 647.34912109375 2 11 1.1.1.3564.9 1 33.1585 364.5622 33.1902 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 0.0099920304492116 2706.4189453125 677.612 2706.40893554688 677.609497070313 4 20 1.1.1.4280.6 1 50.1943 35259.21 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR missed R-L@4; missed K-I@24; missed K-L@44 0.0376268997788429 5997.1552734375 857.7437 5997.1171875 857.73828125 7 28 1.1.1.4721.5 1 60.9771 783.6548 60.9955 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVL cleaved L-E@C-term 0.0200819000601768 1008.54406738281 505.2793 1008.52398681641 505.269287109375 2 10 1.1.1.3841.6 1 39.5836 991.3007 39.5683 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGN cleaved N-E@C-term 0.0168046001344919 1308.64782714844 655.3312 1308.63098144531 655.32275390625 2 14 1.1.1.3825.3 1 39.2073 886.9422 39.1887 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.0267080999910831 1565.75891113281 783.8867 1565.73217773438 783.873352050781 2 19 1.1.1.3821.6 1 39.1124 1484.992 39.26 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQF cleaved F-I@C-term 0.0304761007428169 1712.8310546875 857.4228 1712.80053710938 857.407592773438 2 15 1.1.1.4162.11 1 47.345 497.2538 47.3831 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0194773003458977 1939.94714355469 647.6563 1939.92761230469 647.649780273438 3 14 1.1.1.4254.10 1 49.5619 3073.626 49.5029 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LGEHNIDVLEGNEQFINAAK Dehydrated(E)@10 0.0232781004160643 2192.109375 731.7104 2192.08618164063 731.702697753906 3 16 1.1.1.4150.6 1 47.0475 457.7085 47.0405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 [trypsin fragment, 50 aa] missed K-I@20; missed K-L@40 0.0543861016631126 5500.85888671875 917.8171 5500.8046875 917.80810546875 6 30 1.1.1.4740.5 1 61.4434 2129.813 61.4371 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 LSSPATLNSR 0.00463051022961736 1044.56103515625 523.2878 1044.55639648438 523.285461425781 2 13 1.1.1.3264.5 1 26.3082 73643.72 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.0336514003574848 1773.92346191406 887.969 1773.88977050781 887.9521484375 2 23 1.1.1.4250.10 1 49.4668 873.043 49.3811 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAK Gln->pyro-Glu@N-term; Dehydrated(E)@6 cleaved I-Q@N-term; missed R-L@3 -0.00779287982732058 2558.28002929688 853.7673 2558.28784179688 853.769836425781 3 13 1.1.1.4152.13 1 47.1027 355.9198 47.1878 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 RIQVRLGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term cleaved S-R@N-term; missed R-I@1; missed R-L@5 0.0299050994217396 2888.55541992188 963.8591 2888.52563476563 963.849182128906 3 15 1.1.1.4155.9 1 47.176 632.6055 47.2365 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 SPATLNSR cleaved S-S@N-term -0.00350572005845606 844.436889648438 423.2257 844.440307617188 423.227416992188 2 10 1.1.1.2929.2 1 19.0835 442.4028 19.1256 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 SQWVVSAAHCYKSRIQVRLGEHNIDVLEGNEQFINAAK Carbamidomethyl(C)@10; MDA adduct +54(K)@12 cleaved N-S@N-term; missed K-S@12; missed R-I@14; missed R-L@18 0.0371811017394066 4420.25048828125 885.0574 4420.21337890625 885.049987792969 5 17 1.1.1.4151.14 1 47.0789 937.0499 47.1388 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 SSPATLNSR cleaved L-S@N-term -0.000337092991685495 931.472045898438 466.7433 931.472290039063 466.743438720703 2 10 1.1.1.2970.2 1 19.9814 1219.103 19.8753 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VATVSLPR Dehydrated(T)@3 -0.000925919972360134 823.490661621094 412.7526 823.491577148438 412.753082275391 2 11 1.1.1.3456.2 0 30.5645 28730.51 30.4887 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VLEGNEQFINAAK cleaved D-V@N-term 0.0176704004406929 1431.75341796875 716.884 1431.73583984375 716.875183105469 2 23 1.1.1.3712.4 0 36.5976 1386.948 36.6307 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 2 99.0000009536743 VRLGEHNIDVLEGNEQFINAAK Carbamyl@N-term cleaved Q-V@N-term; missed R-L@2 0.00356384995393455 2508.27563476563 837.0992 2508.27221679688 837.097961425781 3 15 1.1.1.4156.12 1 47.1995 4664.746 47.1633 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.21467018127441 99.0000009536743 YVNWIQQTIAAN cleaved N-Y@N-term 0.0155595997348428 1419.73022460938 710.8724 1419.71472167969 710.864624023438 2 17 1.1.1.4448.2 1 54.3113 3369.39 54.4101 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.16749095916748 99.0000009536743 VNWIQQTIAAN cleaved Y-V@N-term 0.00655532022938132 1256.65783691406 629.3362 1256.6513671875 629.332946777344 2 18 1.1.1.4329.3 1 51.3911 819.4114 51.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 1.09151518344879 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0746228024363518 4813.34765625 963.6768 4813.27294921875 963.661804199219 5 13 1.1.1.4410.13 1 53.35 3529.741 53.2879 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.83564704656601 99.0000009536743 LGEHNIDVLEGNEQFINA cleaved A-A@C-term 0.0459372997283936 2011.01147460938 1006.513 2010.96472167969 1006.48962402344 2 22 1.1.1.4289.4 1 50.427 1418.482 50.4561 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.496209323406219 99.0000009536743 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term 0.0349268987774849 3807.83764648438 762.5748 3807.80249023438 762.567810058594 5 18 1.1.1.4331.9 1 51.4421 17460.79 51.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.447331786155701 96.4800000190735 VATVSLPRSCAAAGTECLISGWGNTK Carbamidomethyl(C)@10; Carbamidomethyl(C)@17; acrolein addition +56(K)@26 missed R-S@8 0.0531740002334118 2761.40576171875 921.4759 2761.35278320313 921.458190917969 3 10 1.1.1.4469.8 1 54.8466 1181.826 54.8128 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.402304798364639 99.0000009536743 IVGGYTCAANSIPYQVSLNSG Carbamidomethyl(C)@7 cleaved G-S@C-term 0.0487382002174854 2170.08544921875 1086.05 2170.03637695313 1086.02551269531 2 22 1.1.1.4290.8 1 50.4485 709.6832 50.4803 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.382999688386917 99.0000009536743 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.0502731986343861 2082.05126953125 1042.033 2082.00170898438 1042.00817871094 2 21 1.1.1.4297.8 1 50.6147 1967.416 50.673 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.322393029928207 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24 missed K-I@20 0.0612756013870239 4488.3359375 898.6745 4488.27490234375 898.662231445313 5 30 1.1.1.4714.14 1 60.8029 3479.627 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.247951552271843 94.8099970817566 PYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSRI Carbamidomethyl(C)@13; Carbamidomethyl(C)@29 cleaved I-P@N-term; cleaved I-Q@C-term; missed K-S@31; missed R-I@33 0.00899741984903812 3808.82885742188 762.7731 3808.8203125 762.771301269531 5 10 1.1.1.4356.4 1 52.0626 1737.467 52.0744 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.236571997404099 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Formyl(K)@24 missed R-L@4; missed K-I@24 0.0846083015203476 4998.65087890625 834.1157 4998.56640625 834.101623535156 6 22 1.1.1.4707.9 1 60.6183 412.4672 60.6284 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.202040359377861 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +62(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 0.00225626002065837 2895.50415039063 724.8833 2895.50170898438 724.882751464844 4 19 1.1.1.4450.6 1 54.3667 4543.231 54.436 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.152427345514297 33.0099999904633 NKPGVYTK 0.00014624600589741 905.497253417969 453.7559 905.4970703125 453.755798339844 2 9 1.1.1.2646.2 1 16.0177 133.2419 15.9924 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.136677145957947 99.0000009536743 NDIMLIKLSSPATLNSR cleaved D-N@N-term; missed K-L@7 0.0307672005146742 1872.04467773438 937.0296 1872.01391601563 937.014221191406 2 13 1.1.1.4282.20 1 50.2544 170.8815 50.2603 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0690509676933289 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 0.00521459011361003 3156.62963867188 790.1647 3156.62451171875 790.163391113281 4 21 1.1.1.4546.2 1 56.7409 4855.785 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0594835169613361 99.0000009536743 NYVNWIQQTIAAN Dioxidation(W)@5 cleaved C-N@N-term 0.0260751992464066 1565.7734375 783.894 1565.74743652344 783.880981445313 2 19 1.1.1.4357.8 1 52.0915 218.1301 52.099 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.057991947978735 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.0197889991104603 2229.2236328125 744.0818 2229.20385742188 744.075256347656 3 24 1.1.1.4430.7 1 53.8565 18102.7 53.7714 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0550240911543369 99.0000009536743 IKLSSPATLNSRVATVSLPR Formyl@N-term cleaved L-I@N-term; missed K-L@2; missed R-V@12 0.0538435988128185 2137.27563476563 535.3262 2137.22192382813 535.312744140625 4 10 1.1.1.3455.8 1 30.5556 0 -1 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.052076380699873 96.9900012016296 LGEHNIDVLEGNEQFINAAKIITHPNFNGNT hexanoyl addition +98(K)@20; reduced HNE(H)@24 cleaved T-L@C-term; missed K-I@20 -0.00427100993692875 3674.89013671875 919.7298 3674.89453125 919.730895996094 4 11 1.1.1.4570.5 1 57.3298 2928.66 57.3733 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0467236638069153 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20 cleaved N-T@C-term; missed K-I@20 0.0345936007797718 3345.70849609375 837.4344 3345.67431640625 837.425842285156 4 29 1.1.1.4504.3 1 55.7041 2445.902 55.6737 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0395292229950428 95.5600023269653 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL reduced acrolein addition +58(K)@24; reduced HNE(H)@28; ONE addition +154(K)@44 cleaved L-N@C-term; missed R-L@4; missed K-I@24; missed K-L@44 0.00179004995152354 6010.21630859375 1002.71 6010.212890625 1002.70941162109 6 11 1.1.1.4726.13 1 61.1082 2781.507 61.0452 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0305840894579887 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20 cleaved N-G@C-term; missed K-I@20 0.0318710990250111 3174.64184570313 794.6677 3174.60986328125 794.659729003906 4 23 1.1.1.4525.6 1 56.2208 3373.891 56.2891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0296531245112419 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.0275794006884098 2400.2958984375 801.1059 2400.26831054688 801.0966796875 3 28 1.1.1.4458.4 1 54.5694 30948.5 54.5132 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0250280071049929 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL MDA adduct +54(K)@20; reduced HNE(H)@24; Oxidation(M)@37; HPNE addition +172(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.0776882991194725 5543.95361328125 1109.798 5543.875 1109.7822265625 5 19 1.1.1.4843.3 1 63.9622 5148.775 63.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0209070984274149 98.3699977397919 EGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@31 cleaved L-E@N-term; missed K-I@11; missed K-L@31 0.0913249030709267 4566.4091796875 914.2891 4566.31787109375 914.270812988281 5 12 1.1.1.4698.6 1 60.384 3401.963 60.4481 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0154726868495345 23.3799993991852 SSYPGQITGN cleaved N-M@C-term 0.00592477014288306 1022.47290039063 512.2437 1022.46691894531 512.24072265625 2 9 1.1.1.3405.13 1 29.3584 256.5254 29.3634 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0145735256373882 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN hexanoyl addition +98(K)@24; Dehydrated(T)@27; reduced HNE(H)@28; MDA adduct +62(K)@44 cleaved N-S@C-term; missed R-L@4; missed K-I@24; missed K-L@44 0.0434021018445492 6054.23828125 1010.047 6054.19287109375 1010.03942871094 6 23 1.1.1.4779.4 1 62.4088 3760.844 62.4904 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0136762224137783 83.5500001907349 NFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@15 cleaved P-N@N-term; missed K-L@15 0.035239901393652 2823.4580078125 942.1599 2823.42260742188 942.148132324219 3 9 1.1.1.4744.7 1 61.544 332.6563 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0127807697281241 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.0295818001031876 3634.9658203125 728.0004 3634.93579101563 727.994445800781 5 26 1.1.1.4421.9 1 53.6264 9551.991 53.7196 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0127807697281241 71.1600005626678 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Trp->Kynurenin(W)@34; Carbamidomethyl(C)@41 missed K-S@43 0.0363962016999722 4906.3388671875 1227.592 4906.30126953125 1227.58264160156 4 9 1.1.1.4466.16 1 54.7786 1567.811 54.7133 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0118871601298451 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@24; Delta:H(2)C(2)(H)@28 cleaved F-N@C-term; missed R-L@4; missed K-I@24 0.0277986004948616 3652.96459960938 914.2484 3652.9365234375 914.241394042969 4 15 1.1.1.4532.8 1 56.4006 588.5964 56.4165 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0109953843057156 99.0000009536743 NTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@8; acrolein addition +76(K)@11 cleaved G-N@N-term; missed K-L@11 0.0340724997222424 2343.27758789063 782.0998 2343.24340820313 782.088439941406 3 20 1.1.1.4454.7 1 54.4709 1720.183 54.5132 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0101054366677999 74.7900009155273 KIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@21 cleaved A-K@N-term; missed K-I@1; missed K-L@21 0.0448491014540195 3492.884765625 699.5842 3492.83984375 699.575256347656 5 9 1.1.1.4417.7 1 53.5223 669.4048 53.4882 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00788851175457239 98.8699972629547 IQVRLGEHNIDVLEGNEQFINAAKII Deamidated(Q)@18; Deamidated(N)@21; MDA adduct +62(K)@24 cleaved I-T@C-term; missed R-L@4; missed K-I@24 -0.0307215992361307 2996.53002929688 750.1398 2996.56079101563 750.1474609375 4 13 1.1.1.4284.6 0 50.3011 368.0207 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00700490176677704 94.379997253418 PYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Deamidated(N)@7; reduced HNE(H)@11; Carbamidomethyl(C)@13; reduced HNE(H)@28; Carbamidomethyl(C)@29; MDA adduct +54(K)@31 cleaved I-P@N-term -0.0211126003414392 3823.83740234375 765.7748 3823.85888671875 765.779052734375 5 11 1.1.1.4328.4 1 51.3754 972.6798 51.3846 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00656376918777823 20.3899994492531 IITHPNFN cleaved N-G@C-term 0.00613682018592954 954.498474121094 478.2565 954.492309570313 478.253448486328 2 8 1.1.1.3426.5 1 29.8594 199.8999 29.8168 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00656376918777823 43.299999833107 LGEHNIDVLEG cleaved G-N@C-term 0.0125756999477744 1194.60070800781 598.3076 1194.58801269531 598.301330566406 2 10 1.1.1.3864.5 1 40.1343 1862.452 40.0205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00656376918777823 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +94(K)@20; reduced HNE(H)@24; Dethiomethyl(M)@37; reduced acrolein addition +96(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0698574036359787 5557.96826171875 1112.601 5557.8984375 1112.5869140625 5 21 1.1.1.4829.12 1 63.6211 13734.2 63.6064 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00656376918777823 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +56(K)@2; MDA adduct +62(K)@8; No Carbamidomethyl(C)@10 missed K-V@8 0.0326958000659943 2741.39624023438 914.806 2741.36352539063 914.795104980469 3 22 1.1.1.4932.2 1 66.1587 514.2992 66.2322 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00612308504059911 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(K)@20 cleaved N-F@C-term; missed K-I@20 0.0205886997282505 2913.51904296875 729.387 2913.49853515625 729.381896972656 4 19 1.1.1.4426.8 1 53.7555 7456.582 53.8479 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00612308504059911 97.6100027561188 VLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@33 cleaved D-V@N-term; missed K-I@13; missed K-L@33 0.1059740036726 4778.576171875 956.7225 4778.47021484375 956.701293945313 5 12 1.1.1.4717.11 1 60.88 4568.417 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00568284746259451 98.2400000095367 PYQVSLNSG cleaved I-P@N-term; cleaved G-S@C-term -4.00025987625122 959.4658203125 960.4731 963.466186523438 964.473449707031 1 8 1.1.1.4420.12 0 53.6057 5556.52 53.6935 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0048037082888186 97.4200010299683 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.122082002460957 5006.70361328125 1002.348 5006.5810546875 1002.32348632813 5 12 1.1.1.4883.7 1 64.9524 1471.414 64.9075 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.0048037082888186 62.8700017929077 PYQVSLNSGSHFCGGSLINSQWVVSAAHCYKSR Carbamidomethyl(C)@13; Deamidated(N)@19; Carbamidomethyl(C)@29; hexanoyl addition +98(K)@31 cleaved I-P@N-term; missed K-S@31 0.0220931004732847 3794.81494140625 759.9703 3794.79345703125 759.965942382813 5 9 1.1.1.4280.9 0 50.1993 942.2129 50.1865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00436480529606342 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@19; Delta:H(4)C(2)(H)@23 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.0655381008982658 5513.890625 919.9891 5513.8251953125 919.978149414063 6 22 1.1.1.4754.2 1 61.7851 879.8738 61.7302 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00436480529606342 99.0000009536743 IKLSSPATLNSR Delta:H(4)C(2)(K)@2 cleaved L-I@N-term; missed K-L@2 -0.000896788027603179 1313.76574707031 438.9292 1313.76672363281 438.929504394531 3 12 1.1.1.3431.12 1 29.972 1343.957 29.9601 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00436480529606342 98.1000006198883 PNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Deamidated(N)@10; HPNE addition +172(K)@16 cleaved H-P@N-term; missed K-L@16 0.0573147982358933 3018.57934570313 755.6521 3018.52197265625 755.637756347656 4 12 1.1.1.4739.2 1 61.4162 711.7255 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00392634514719248 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.0439631007611752 2661.42333984375 888.1484 2661.37963867188 888.1337890625 3 21 1.1.1.4529.8 1 56.3241 6733.168 56.2635 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00348832807503641 97.2100019454956 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLI cleaved I-K@C-term; missed R-L@4; missed K-I@24 0.968828976154327 4843.44677734375 1211.869 4842.47607421875 1211.62634277344 4 12 1.1.1.4782.5 1 62.4853 1339.56 62.3226 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00305075151845813 30.2500009536743 GNEQFINAAK cleaved E-G@N-term 0.00591281009837985 1090.54663085938 546.2806 1090.54077148438 546.277648925781 2 7 1.1.1.3292.11 0 26.9697 106.5174 26.9764 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00261361571028829 78.8100004196167 LGEHNIDVLEGNEQFINAAKIITHP acrolein addition +112(K)@20 cleaved P-N@C-term; missed K-I@20 0.0562292002141476 2883.53271484375 962.1849 2883.4765625 962.166137695313 3 9 1.1.1.4742.9 1 61.4963 244.2409 61.5114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00261361571028829 99.0000009536743 TKVCNYVNWIQQTIAAN Carbamyl@N-term; MDA adduct +62(K)@2; Carbamidomethyl(C)@4 cleaved Y-T@N-term; missed K-V@2 -0.0175535995513201 2127.00341796875 710.0084 2127.02075195313 710.014221191406 3 14 1.1.1.4714.3 1 60.7938 438.7016 60.7611 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00217691925354302 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATL Methyl(K)@20 cleaved L-N@C-term; missed K-L@20 0.0557628013193607 2965.61401367188 989.5453 2965.55834960938 989.526733398438 3 29 1.1.1.4712.10 1 60.7469 2200.76 60.7611 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00217691925354302 81.6399991512299 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPA reduced acrolein addition +96(K)@20; reduced HNE(H)@24; acrolein addition +112(K)@40 cleaved A-T@C-term; missed K-I@20; missed K-L@40 0.0561105012893677 5295.7939453125 883.6396 5295.73779296875 883.630249023438 6 10 1.1.1.4922.6 1 65.9301 562.0223 65.965 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00174066168256104 57.2300016880035 IQQTIAAN cleaved W-I@N-term -0.00153481995221227 857.459045410156 429.7368 857.460693359375 429.737609863281 2 10 1.1.1.3173.2 1 24.0932 1169.889 24.2061 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00174066168256104 85.8299970626831 IQVRLGEHNIDVLEGNEQFINAAKIIT Deamidated(N)@21 cleaved T-H@C-term; missed R-L@4; missed K-I@24 -0.0268587004393339 3034.58203125 759.6528 3034.60864257813 759.659484863281 4 10 1.1.1.4714.8 1 60.7979 362.9821 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00130484171677381 91.6999995708466 EQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@22; acrolein addition +56(K)@28 cleaved N-E@N-term; missed K-I@8; missed K-L@28 0.0766429007053375 4267.27099609375 854.4615 4267.19482421875 854.446228027344 5 11 1.1.1.4692.3 1 60.2296 1878.096 60.2976 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.00130484171677381 50.8099973201752 SSYPSLLQCLKAPVLSNSSCKSSYPGQITGN Carbamidomethyl(C)@9; Carbamidomethyl(C)@20; HPNE addition +172(K)@21 cleaved G-S@N-term; cleaved N-M@C-term; missed K-A@11; missed K-S@21 0.0460569001734257 3514.77807617188 1172.6 3514.732421875 1172.58471679688 3 9 1.1.1.4470.16 1 54.8782 3689.613 54.9379 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000869458774104714 41.6599988937378 AAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@3; Deamidated(N)@9 cleaved N-A@N-term; missed K-I@3; missed K-L@23 0.052724801003933 3635.95043945313 728.1974 3635.89819335938 728.186889648438 5 9 1.1.1.4457.2 1 54.5428 2164.065 54.5887 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000869458774104714 98.2999980449677 VCNYVNWIQQTIAAN Carbamidomethyl@N-term; Carbamidomethyl(C)@2; Trp->Hydroxykynurenin(W)@7 -0.000715797999873757 1869.86730957031 935.9409 1869.86791992188 935.941223144531 2 12 1.1.1.4882.4 1 64.9232 696.3161 64.7596 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 48.2400000095367 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSRVAT reduced HNE(H)@28; Deamidated(N)@38; reduced acrolein addition +58(K)@44 cleaved T-V@C-term; missed R-L@4; missed K-I@24; missed K-L@44; missed R-V@54 0.0319440998136997 6485.45849609375 1081.917 6485.4267578125 1081.91174316406 6 10 1.1.1.4727.9 1 61.1372 309.8542 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 99.0000009536743 PGVYTKVCNYVNWIQQTIAAN Octanoyl(T)@5; HPNE addition +172(K)@6; Carbamidomethyl(C)@8 cleaved K-P@N-term; missed K-V@6 0.0387527011334896 2736.45849609375 913.1601 2736.41967773438 913.147155761719 3 13 1.1.1.4621.8 1 58.5779 309.3439 58.6433 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; Deamidated(N)@20; reduced HNE(H)@27; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.109077997505665 6054.2626953125 1010.051 6054.15234375 1010.03271484375 6 20 1.1.1.4750.5 1 61.6978 2476.376 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0.000434511806815863 96.7499971389771 SSGSSYPSLLQCLK Pro->pyro-Glu(P)@7; Deamidated(Q)@11; Carbamidomethyl(C)@12; MDA adduct +62(K)@14 0.0117722004652023 1602.73522949219 802.3749 1602.7236328125 802.369079589844 2 10 1.1.1.4532.2 1 56.3956 495.7753 56.3911 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 36.6200000047684 AAGTECLISGWGNTK HexNAc(T)@4; Carbamidomethyl(C)@6 cleaved A-A@N-term -0.00276592001318932 1766.81164550781 884.4131 1766.814453125 884.41455078125 2 12 1.1.1.4166.10 1 47.4431 74971.09 47.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2 cleaved A-A@N-term; missed K-I@2; missed K-L@22 -0.0168689005076885 3605.9072265625 902.4841 3605.92407226563 902.48828125 4 15 1.1.1.4475.8 1 54.9985 736.2258 55.1164 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 AKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@2; Deamidated(N)@8; Dethiomethyl(M)@19; acrolein addition +76(K)@22 cleaved A-A@N-term; missed K-I@2; missed K-L@22 0.00264405994676054 3634.93872070313 606.8304 3634.93579101563 606.829956054688 6 15 1.1.1.4424.3 1 53.6995 750.2055 53.7196 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.1300022602081 EQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@8 cleaved N-E@N-term; missed K-I@8; missed K-L@28 0.0512568987905979 4266.2626953125 712.051 4266.21044921875 712.042419433594 6 10 1.1.1.4624.2 1 58.6477 379.5882 58.694 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.0133948000147939 2661.39306640625 666.3555 2661.37963867188 666.352172851563 4 16 1.1.1.4527.2 1 56.2682 627.4651 56.2635 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 FNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@14 cleaved N-F@N-term; missed K-L@14 0.0439631007611752 2661.42333984375 888.1484 2661.37963867188 888.1337890625 3 14 1.1.1.4522.8 1 56.1462 6733.168 56.2635 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 FNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@14 cleaved N-F@N-term; missed K-L@14 0.0440898016095161 2647.40795898438 883.4766 2647.36401367188 883.4619140625 3 13 1.1.1.4520.6 1 56.095 392.7799 56.1373 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@23; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.0234846994280815 5573.90625 797.2796 5573.8828125 797.276245117188 7 22 1.1.1.4793.3 1 62.7397 1140.773 62.6828 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@23; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.042671199887991 5573.92578125 929.9949 5573.8828125 929.987731933594 6 21 1.1.1.4809.6 1 63.1345 2049.006 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@19; Methyl(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.079585500061512 5513.86865234375 919.9854 5513.7890625 919.972106933594 6 19 1.1.1.4746.2 1 61.5894 6202.779 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@23; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.0294879991561174 5573.91259765625 929.9927 5573.8828125 929.987731933594 6 19 1.1.1.4792.5 1 62.7191 4302.034 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@19; reduced HNE(H)@23; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.0336314998567104 5669.9736328125 811.0035 5669.9404296875 810.998779296875 7 18 1.1.1.4712.3 1 60.741 248.839 60.7345 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@19; Dethiomethyl(M)@36; acrolein addition +76(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.0996811985969543 5527.90087890625 922.3241 5527.80126953125 922.307495117188 6 18 1.1.1.4788.2 1 62.6181 2417.207 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@19; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.0229409001767635 5477.7880859375 1096.565 5477.767578125 1096.56079101563 5 17 1.1.1.4887.2 1 65.0563 442.2395 65.0352 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@23; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.00425929017364979 5573.8876953125 797.2769 5573.8828125 797.276245117188 7 17 1.1.1.4862.5 1 64.4206 228.6273 64.3356 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced HNE(H)@23; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.00682266987860203 5573.8896484375 797.2772 5573.8828125 797.276245117188 7 14 1.1.1.4709.2 1 60.6606 169.2473 60.6549 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@19; Delta:H(4)C(2)(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.0431999005377293 5513.86865234375 919.9854 5513.8251953125 919.978149414063 6 14 1.1.1.4744.5 1 61.5423 6202.779 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 GEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@19; hexanoyl addition +98(K)@39 cleaved L-G@N-term; missed K-I@19; missed K-L@39 0.0200846996158361 5581.87158203125 798.4175 5581.8515625 798.414611816406 7 11 1.1.1.4833.3 1 63.711 626.11 63.8278 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term 0.0149069996550679 1345.7060546875 673.8603 1345.69116210938 673.852844238281 2 13 1.1.1.4229.4 1 48.9484 605.0437 48.9918 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term 0.0195454992353916 1345.71069335938 673.8626 1345.69116210938 673.852844238281 2 12 1.1.1.4243.4 1 49.2912 400.3762 49.2592 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term 0.0197896007448435 1345.71081542969 673.8627 1345.69116210938 673.852844238281 2 14 1.1.1.4250.7 1 49.4618 292.8512 49.4298 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIK cleaved N-G@N-term 0.0217425990849733 1345.712890625 673.8637 1345.69116210938 673.852844238281 2 10 1.1.1.4264.9 1 49.8129 321.8125 49.5518 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12; Deamidated(N)@20 cleaved N-G@N-term; missed K-L@12 0.0255245007574558 2401.27783203125 801.4332 2401.25219726563 801.424682617188 3 23 1.1.1.4469.3 1 54.8424 3601.201 54.7878 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@2; Dethiomethyl(M)@9; acrolein addition +76(K)@12 cleaved N-G@N-term; missed K-L@12 0.0389657989144325 2401.28784179688 801.4366 2401.2490234375 801.423583984375 3 21 1.1.1.4492.2 1 55.4118 886.9553 55.5029 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@9; reduced acrolein addition +58(K)@12 cleaved N-G@N-term; missed K-L@12 0.0282052997499704 2416.29125976563 806.4377 2416.26318359375 806.428344726563 3 21 1.1.1.4400.4 1 53.0971 1828.089 53.0432 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Methyl(K)@12 cleaved N-G@N-term; missed K-L@12 0.0282735005021095 2386.28125 796.4343 2386.25268554688 796.4248046875 3 21 1.1.1.4450.8 1 54.3684 3138.745 54.436 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR cleaved N-G@N-term; missed K-L@12 0.0251234993338585 2372.26196289063 791.7613 2372.23706054688 791.7529296875 3 18 1.1.1.4446.7 1 54.2641 1061.321 54.2808 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@9; reduced acrolein addition +58(K)@12 cleaved N-G@N-term; missed K-L@12 0.0282052997499704 2416.29125976563 806.4377 2416.26318359375 806.428344726563 3 18 1.1.1.4393.5 1 52.9316 1828.089 53.0432 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@12 cleaved N-G@N-term; missed K-L@12 0.0275794006884098 2400.2958984375 801.1059 2400.26831054688 801.0966796875 3 18 1.1.1.4451.6 1 54.3926 30948.5 54.5132 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Dethiomethyl(M)@9; acrolein addition +76(K)@12 cleaved N-G@N-term; missed K-L@12 0.0389657989144325 2401.28784179688 801.4366 2401.2490234375 801.423583984375 3 18 1.1.1.4499.4 1 55.5836 886.9553 55.5029 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Dethiomethyl(M)@9; acrolein addition +76(K)@12 cleaved N-G@N-term; missed K-L@12 0.0309094004333019 2401.27978515625 801.4339 2401.2490234375 801.423583984375 3 16 1.1.1.4427.7 1 53.7802 1970.707 53.7196 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 GNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Dethiomethyl(M)@9; acrolein addition +76(K)@12 cleaved N-G@N-term; missed K-L@12 0.0288952998816967 2401.27783203125 801.4332 2401.2490234375 801.423583984375 3 15 1.1.1.4476.2 1 55.0189 3791.601 54.763 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.8699991703033 GNTLDNDIMLIKLSSPATLNSR Met->Hcy(M)@9; reduced acrolein addition +58(K)@12 cleaved N-G@N-term; missed K-L@12 0.0272898003458977 2416.29028320313 806.4374 2416.26318359375 806.428344726563 3 12 1.1.1.4455.4 1 54.4939 1659.769 54.4877 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IDVLEGNEQFINAAK cleaved N-I@N-term 3.00059008598328 1662.84753417969 832.431 1659.84680175781 830.9306640625 2 12 1.1.1.4155.6 1 47.171 206.9187 47.1633 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.3200023174286 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.122082002460957 5006.70361328125 1002.348 5006.5810546875 1002.32348632813 5 12 1.1.1.4876.5 1 64.7724 1471.414 64.9075 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.6800003051758 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@9; acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.121615998446941 5007.6884765625 1002.545 5007.56494140625 1002.52032470703 5 12 1.1.1.4917.3 1 65.8016 878.9542 65.8067 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.1300022602081 IDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@35 cleaved N-I@N-term; missed K-I@15; missed K-L@35 0.0747248977422714 5006.65625 835.45 5006.5810546875 835.4375 6 10 1.1.1.4884.3 1 64.9666 294.979 64.9325 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.0169619992375374 2298.1845703125 767.0688 2298.16772460938 767.063232421875 3 27 1.1.1.4294.4 1 50.5357 4657.042 50.6007 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Oxidation(M)@17 0.0226380992680788 2298.19018554688 767.0707 2298.16772460938 767.063232421875 3 23 1.1.1.4372.4 1 52.4345 1937.179 52.4437 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK 0.0167126003652811 2282.189453125 761.7371 2282.1728515625 761.731567382813 3 29 1.1.1.4377.2 1 52.5464 41569.14 52.4677 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10 0.0245443992316723 2283.18115234375 762.0677 2283.15698242188 762.0595703125 3 26 1.1.1.4390.3 1 52.8561 954.001 52.8745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0254599004983902 2283.1826171875 762.0681 2283.15698242188 762.0595703125 3 25 1.1.1.4397.3 1 53.0248 4913.072 53.0432 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0236288998275995 2283.18041992188 762.0674 2283.15698242188 762.0595703125 3 30 1.1.1.4404.6 1 53.1989 12171.9 53.2632 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0236288998275995 2283.18041992188 762.0674 2283.15698242188 762.0595703125 3 24 1.1.1.4411.4 1 53.3671 12171.9 53.2632 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Methyl(K)@20 0.022052900865674 2296.21069335938 766.4108 2296.1884765625 766.403442382813 3 28 1.1.1.4384.2 1 52.7138 3071.947 52.7546 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@14 0.0188682992011309 2283.17602539063 762.0659 2283.15698242188 762.0595703125 3 18 1.1.1.4315.11 1 51.0504 769.5673 51.0887 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.0253430996090174 2299.17724609375 767.3997 2299.15185546875 767.391235351563 3 19 1.1.1.4332.5 1 51.4648 394.6051 51.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Ammonia-loss(N)@10 0.0221955999732018 2265.16870117188 756.0635 2265.14624023438 756.056091308594 3 19 1.1.1.4400.3 1 53.0962 2062.616 53.1163 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.0200332999229431 2299.171875 767.3979 2299.15185546875 767.391235351563 3 18 1.1.1.4352.9 1 51.9609 953.4326 51.9018 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Methyl(K)@20 0.0256734006106853 2297.19848632813 766.7401 2297.17260742188 766.7314453125 3 19 1.1.1.4416.9 1 53.4986 638.3141 53.4627 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Oxidation(M)@17 0.0200332999229431 2299.171875 767.3979 2299.15185546875 767.391235351563 3 17 1.1.1.4345.8 1 51.7895 953.4326 51.9018 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@6; Deamidated(N)@8 0.0223057009279728 2284.16333007813 762.395 2284.14086914063 762.387573242188 3 16 1.1.1.4425.6 1 53.7278 413.2257 53.7453 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIK Deamidated(N)@14 0.036811999976635 2283.19360351563 762.0718 2283.15698242188 762.0595703125 3 14 1.1.1.4378.2 1 52.5669 21693.81 52.4677 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.6800003051758 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8; Deamidated(N)@14; Dethiomethyl(M)@17; MDA adduct +62(K)@20 0.0337634012103081 2298.18701171875 767.0696 2298.1533203125 767.058349609375 3 11 1.1.1.4405.10 1 53.2244 408.7052 53.2387 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.8500015735626 IITHPNFNGNTLDNDIMLIK Deamidated(N)@8 0.0245443992316723 2283.18115234375 762.0677 2283.15698242188 762.0595703125 3 13 1.1.1.4393.4 1 52.93 954.001 52.8745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.2700026035309 IITHPNFNGNTLDNDIMLIK Deamidated(N)@10; Oxidation(M)@17 0.031751599162817 2299.18359375 767.4018 2299.15185546875 767.391235351563 3 7 1.1.1.4313.8 1 50.9982 162.707 51.0638 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATL Deamidated(N)@8; Dethiomethyl(M)@17; MDA adduct +62(K)@20 cleaved L-N@C-term; missed K-L@20 0.0475599989295006 2966.58642578125 989.8694 2966.53881835938 989.853576660156 3 18 1.1.1.4737.4 1 61.3831 596.5042 61.3882 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATL Dethiomethyl(M)@17; acrolein addition +76(K)@20 cleaved L-N@C-term; missed K-L@20 0.0648846998810768 2979.63549804688 994.2191 2979.57055664063 994.197448730469 3 19 1.1.1.4714.18 1 60.8063 3455.357 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATL Formyl(K)@20 cleaved L-N@C-term; missed K-L@20 0.0650793984532356 2979.60302734375 745.908 2979.53759765625 745.891662597656 4 16 1.1.1.4714.5 1 60.7954 1367.468 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.0328519009053707 3308.75170898438 828.1952 3308.71875 828.186950683594 4 32 1.1.1.4469.5 1 54.844 33640.59 54.9891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.0328519009053707 3308.75170898438 828.1952 3308.71875 828.186950683594 4 37 1.1.1.4476.6 1 55.0223 33640.59 54.9891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.0328519009053707 3308.75170898438 828.1952 3308.71875 828.186950683594 4 21 1.1.1.4476.7 1 55.0231 33640.59 54.9891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.0328519009053707 3308.75170898438 828.1952 3308.71875 828.186950683594 4 20 1.1.1.4479.8 1 55.1005 33640.59 54.9891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.0340724997222424 3308.7529296875 828.1955 3308.71875 828.186950683594 4 21 1.1.1.4483.2 1 55.1926 1317.471 55.2127 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@28 missed K-L@20 0.0383043996989727 3309.74096679688 828.4425 3309.70263671875 828.432983398438 4 26 1.1.1.4492.4 1 55.4202 1221.605 55.4053 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.0152743998914957 3308.73413085938 828.1908 3308.71875 828.186950683594 4 22 1.1.1.4508.5 1 55.8027 2496.322 55.771 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8 missed K-L@20 0.0375720001757145 3309.740234375 828.4423 3309.70263671875 828.432983398438 4 35 1.1.1.4529.3 1 56.3199 10906.66 56.3657 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0394124016165733 3336.78979492188 835.2047 3336.75 835.194763183594 4 22 1.1.1.4427.11 1 53.7835 594.8469 53.7969 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.0373753011226654 3338.7666015625 835.6989 3338.72924804688 835.689575195313 4 30 1.1.1.4433.9 1 53.9339 3910.19 54.1779 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0366286002099514 3352.78125 839.2026 3352.74487304688 839.193481445313 4 29 1.1.1.4438.7 1 54.0588 3097.91 54.0499 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0358471982181072 3323.75463867188 831.9459 3323.71826171875 831.936889648438 4 22 1.1.1.4442.7 1 54.1612 1809.631 54.0755 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.0373753011226654 3338.7666015625 835.6989 3338.72924804688 835.689575195313 4 22 1.1.1.4442.8 1 54.162 4183.772 54.1779 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0363845005631447 3352.78125 839.2026 3352.74487304688 839.193481445313 4 33 1.1.1.4445.6 1 54.2374 5162.266 54.255 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 0.0281975008547306 3322.76245117188 831.6979 3322.734375 831.690856933594 4 30 1.1.1.4476.8 1 55.0239 144914.8 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.0456757992506027 3338.77490234375 835.701 3338.72924804688 835.689575195313 4 24 1.1.1.4477.7 1 55.0484 23646.85 55.2848 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00297693000175059 3322.73120117188 665.5535 3322.734375 665.554138183594 5 28 1.1.1.4478.5 1 55.0723 14227.48 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00297693000175059 3322.73120117188 665.5535 3322.734375 665.554138183594 5 28 1.1.1.4479.3 1 55.0963 14227.48 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 -0.00297693000175059 3322.73120117188 665.5535 3322.734375 665.554138183594 5 36 1.1.1.4481.2 1 55.1469 14227.48 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0679102018475533 3324.77026367188 832.1998 3324.70239257813 832.182861328125 4 25 1.1.1.4482.3 1 55.1717 28027.99 55.1164 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0274333991110325 3353.75659179688 839.4464 3353.72900390625 839.439514160156 4 25 1.1.1.4482.4 1 55.1742 2471.417 55.1164 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 0.0689688995480537 3322.80224609375 1108.608 3322.734375 1108.58544921875 3 35 1.1.1.4482.5 1 55.1767 33600.8 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0663150027394295 3336.8154296875 1113.279 3336.75 1113.25732421875 3 31 1.1.1.4483.10 1 55.206 29387.61 55.3089 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0318442992866039 3336.7822265625 835.2028 3336.75 835.194763183594 4 35 1.1.1.4485.3 1 55.2473 107124.3 55.3331 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00608489010483027 3336.74389648438 668.3561 3336.75 668.357299804688 5 30 1.1.1.4487.2 1 55.2888 11906.76 55.3089 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 0.0281975008547306 3322.76245117188 831.6979 3322.734375 831.690856933594 4 31 1.1.1.4488.3 1 55.3147 144914.8 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0283281002193689 3352.7734375 839.2006 3352.74487304688 839.193481445313 4 30 1.1.1.4489.3 1 55.3404 6015.184 55.3089 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0318442992866039 3336.7822265625 835.2028 3336.75 835.194763183594 4 34 1.1.1.4492.5 1 55.4244 107124.3 55.3331 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0283281002193689 3352.7734375 839.2006 3352.74487304688 839.193481445313 4 27 1.1.1.4494.4 1 55.4603 6015.184 55.3089 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.035114798694849 3323.75366210938 831.9457 3323.71826171875 831.936889648438 4 25 1.1.1.4495.3 1 55.4853 7981.314 55.6003 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.035114798694849 3323.75366210938 831.9457 3323.71826171875 831.936889648438 4 23 1.1.1.4496.2 1 55.5071 7981.314 55.6003 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0461824983358383 3324.74853515625 832.1944 3324.70239257813 832.182861328125 4 22 1.1.1.4496.3 1 55.5087 5100.729 55.6003 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.036710400134325 3353.76586914063 839.4487 3353.72900390625 839.439514160156 4 24 1.1.1.4496.4 1 55.5104 3462.149 55.4053 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0663150027394295 3336.8154296875 1113.279 3336.75 1113.25732421875 3 29 1.1.1.4496.9 1 55.5187 29387.61 55.3089 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0313559994101524 3336.78125 835.2026 3336.75 835.194763183594 4 32 1.1.1.4499.7 1 55.5886 106395.2 55.3331 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.035114798694849 3323.75366210938 831.9457 3323.71826171875 831.936889648438 4 26 1.1.1.4503.3 1 55.6797 7981.314 55.6003 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Methyl(K)@20 missed K-L@20 0.0277408007532358 3305.73583984375 827.4412 3305.70776367188 827.434204101563 4 28 1.1.1.4508.4 1 55.8011 3258.16 55.771 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 0.0297288000583649 3337.763671875 835.4482 3337.73413085938 835.440795898438 4 34 1.1.1.4508.6 1 55.8044 7813.36 55.771 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0353589989244938 3323.75366210938 831.9457 3323.71826171875 831.936889648438 4 26 1.1.1.4510.5 1 55.8511 8174.654 55.6003 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 0.0350016988813877 3319.7548828125 830.946 3319.71997070313 830.937316894531 4 26 1.1.1.4514.3 1 55.9481 3868.922 55.9407 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0297288000583649 3337.763671875 835.4482 3337.73413085938 835.440795898438 4 29 1.1.1.4515.5 1 55.9707 7827.84 55.7468 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20; Deamidated(N)@28 missed K-L@20 0.0309494994580746 3337.76489257813 835.4485 3337.73413085938 835.440795898438 4 22 1.1.1.4519.7 1 56.0712 6154.369 55.8195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0365644991397858 3337.77099609375 835.45 3337.73413085938 835.440795898438 4 27 1.1.1.4523.9 1 56.1724 15705.42 56.2891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.00565122021362185 3337.73950195313 668.5552 3337.73413085938 668.554077148438 5 25 1.1.1.4525.2 1 56.2174 1851.409 56.2891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0343823991715908 3323.7529296875 831.9455 3323.71826171875 831.936889648438 4 29 1.1.1.4529.5 1 56.3216 33101.43 56.4668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0660021975636482 3323.78344726563 1108.935 3323.71826171875 1108.91345214844 3 24 1.1.1.4533.17 1 56.4334 8861.059 56.4668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0309494994580746 3337.76489257813 835.4485 3337.73413085938 835.440795898438 4 23 1.1.1.4534.8 1 56.4509 26474.15 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0343823991715908 3323.7529296875 831.9455 3323.71826171875 831.936889648438 4 27 1.1.1.4537.5 1 56.522 33101.43 56.4668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 -0.00258821994066238 3337.7314453125 668.5536 3337.73413085938 668.554077148438 5 28 1.1.1.4538.2 1 56.5447 3329.472 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0714047029614449 3337.80517578125 1113.609 3337.73413085938 1113.58532714844 3 25 1.1.1.4538.7 1 56.5572 7344.792 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0418372005224228 3353.77099609375 839.45 3353.72900390625 839.439514160156 4 26 1.1.1.4540.5 1 56.5955 982.9645 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0459383018314838 3324.748046875 832.1943 3324.70239257813 832.182861328125 4 29 1.1.1.4542.3 1 56.6445 17987.49 56.4668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0343823991715908 3323.7529296875 831.9455 3323.71826171875 831.936889648438 4 26 1.1.1.4544.3 1 56.692 34521.03 56.4668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0309494994580746 3337.76489257813 835.4485 3337.73413085938 835.440795898438 4 35 1.1.1.4545.5 1 56.7198 26703.9 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0418372005224228 3353.77099609375 839.45 3353.72900390625 839.439514160156 4 24 1.1.1.4547.8 1 56.7699 982.9645 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0454500988125801 3324.74780273438 832.1942 3324.70239257813 832.182861328125 4 26 1.1.1.4551.4 1 56.8673 1453.437 56.835 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0309494994580746 3337.76489257813 835.4485 3337.73413085938 835.440795898438 4 31 1.1.1.4552.3 1 56.8885 26703.9 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0285081993788481 3337.76245117188 835.4479 3337.73413085938 835.440795898438 4 30 1.1.1.4565.4 1 57.2078 1536.735 57.2018 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0197193995118141 3337.75366210938 835.4457 3337.73413085938 835.440795898438 4 22 1.1.1.4586.4 1 57.7221 773.583 57.6441 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0455811992287636 3362.81127929688 841.7101 3362.765625 841.698669433594 4 25 1.1.1.4715.12 1 60.8282 669.6615 60.8408 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -0.00291978009045124 3308.7158203125 662.7504 3308.71875 662.751037597656 5 19 1.1.1.4477.3 1 55.0451 2856.452 54.9891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0542387999594212 3324.75659179688 832.1964 3324.70239257813 832.182861328125 4 22 1.1.1.4519.5 1 56.0695 6924.17 56.1622 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0459383018314838 3324.748046875 832.1943 3324.70239257813 832.182861328125 4 22 1.1.1.4534.6 1 56.4492 17987.49 56.4668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0453533008694649 3337.779296875 835.4521 3337.73413085938 835.440795898438 4 21 1.1.1.4478.10 1 55.0764 61698.81 55.3089 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20; Deamidated(N)@28 missed K-L@20 -0.00161646003834903 3323.71655273438 665.7506 3323.71826171875 665.7509765625 5 21 1.1.1.4499.2 1 55.5803 905.8206 55.6003 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.036905400454998 3324.7392578125 832.1921 3324.70239257813 832.182861328125 4 21 1.1.1.4459.7 1 54.597 533.3604 54.6385 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0365796014666557 3323.7548828125 831.946 3323.71826171875 831.936889648438 4 21 1.1.1.4522.4 1 56.1429 12177.75 56.1622 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0337807983160019 3353.76245117188 839.4479 3353.72900390625 839.439514160156 4 21 1.1.1.4526.7 1 56.2468 747.946 56.2891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0366286002099514 3352.78125 839.2026 3352.74487304688 839.193481445313 4 20 1.1.1.4431.8 1 53.8828 3097.91 54.0499 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0309494994580746 3337.76489257813 835.4485 3337.73413085938 835.440795898438 4 20 1.1.1.4550.3 1 56.8412 26703.9 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0360762998461723 3337.77026367188 835.4498 3337.73413085938 835.440795898438 4 20 1.1.1.4573.7 1 57.4064 1978.796 57.3483 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Methyl(K)@20 missed K-L@20 0.0277408007532358 3305.73583984375 827.4412 3305.70776367188 827.434204101563 4 21 1.1.1.4501.5 1 55.6307 3258.16 55.771 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10 missed K-L@20 0.0326894000172615 3309.7353515625 828.4411 3309.70263671875 828.432983398438 4 17 1.1.1.4505.3 1 55.73 2383.75 55.771 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10 missed K-L@20 0.0375720001757145 3309.740234375 828.4423 3309.70263671875 828.432983398438 4 17 1.1.1.4532.4 1 56.3973 10906.66 56.3657 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8 missed K-L@20 0.0375720001757145 3309.740234375 828.4423 3309.70263671875 828.432983398438 4 17 1.1.1.4536.2 1 56.4958 10906.66 56.3657 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0391025990247726 3324.74145507813 832.1926 3324.70239257813 832.182861328125 4 20 1.1.1.4581.5 1 57.6046 1105.797 57.3483 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.06041070073843 3352.80517578125 1118.609 3352.74487304688 1118.5888671875 3 19 1.1.1.4489.6 1 55.3487 1719.323 55.2848 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17; Methyl(K)@20 missed K-L@20 0.0373753011226654 3338.7666015625 835.6989 3338.72924804688 835.689575195313 4 19 1.1.1.4435.7 1 53.9825 4145.234 54.1779 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20 missed K-L@20 0.0689688995480537 3322.80224609375 1108.608 3322.734375 1108.58544921875 3 19 1.1.1.4489.5 1 55.3454 33600.8 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0526923984289169 3323.77124023438 831.9501 3323.71826171875 831.936889648438 4 18 1.1.1.4427.10 1 53.7827 696.7035 53.7969 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@17 missed K-L@20 0.0412965007126331 3324.7548828125 832.196 3324.71362304688 832.185668945313 4 17 1.1.1.4434.4 1 53.9548 1222.295 54.0499 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0436443984508514 3337.77783203125 835.4517 3337.73413085938 835.440795898438 4 18 1.1.1.4457.7 1 54.5469 472.7236 54.5637 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Hex(N)@14; MDA adduct +62(K)@20 missed K-L@20 0.0759591981768608 3532.86303710938 707.5799 3532.787109375 707.564697265625 5 18 1.1.1.4479.4 1 55.0972 1203.129 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0365644991397858 3337.77099609375 835.45 3337.73413085938 835.440795898438 4 18 1.1.1.4526.6 1 56.2459 15705.42 56.2891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0660021975636482 3323.78344726563 1108.935 3323.71826171875 1108.91345214844 3 19 1.1.1.4540.15 1 56.6039 8861.059 56.4668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@4; Methyl(K)@20 missed K-L@20 0.0404682010412216 3348.79052734375 838.2049 3348.75 838.194763183594 4 19 1.1.1.4714.12 1 60.8013 566.3024 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Carbamidomethyl(S)@22 missed K-L@20 0.0413416996598244 3519.880859375 880.9775 3519.83959960938 880.967163085938 4 17 1.1.1.4474.4 1 54.9698 451.9645 54.9891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dehydrated(D)@15; Oxidation(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0420361012220383 3368.76049804688 843.1974 3368.71875 843.186950683594 4 17 1.1.1.4481.3 1 55.1511 1307.723 55.3089 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 -1.96634995937347 3306.75244140625 827.6954 3308.71875 828.186950683594 4 17 1.1.1.4484.2 1 55.2199 1337.941 55.1164 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; reduced acrolein addition +58(K)@20 missed K-L@20 0.0176545009016991 3367.76220703125 842.9478 3367.74462890625 842.943420410156 4 16 1.1.1.4487.5 1 55.2938 956.1608 55.2848 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Decanoyl(S)@22 missed K-L@20 -0.0258971005678177 3616.92822265625 905.2393 3616.95385742188 905.245727539063 4 18 1.1.1.4487.6 1 55.2955 1550.844 55.3571 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR GlnThrGlyGly(K)@20; Dehydrated(S)@22 missed K-L@20 0.0651838034391403 3633.92260742188 909.4879 3633.857421875 909.471618652344 4 18 1.1.1.4487.7 1 55.2972 590.6964 55.2848 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Palmitoyl(K)@20 missed K-L@20 -0.00604610005393624 3547.92651367188 887.9889 3547.93237304688 887.990356445313 4 18 1.1.1.4490.7 1 55.3737 538.3037 55.2848 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; reduced acrolein addition +58(K)@20 missed K-L@20 0.0261991005390882 3367.77099609375 842.95 3367.74462890625 842.943420410156 4 16 1.1.1.4494.5 1 55.4619 883.5849 55.4304 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@14; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0307870991528034 3338.7490234375 835.6945 3338.71801757813 835.686767578125 4 17 1.1.1.4580.7 1 57.5786 1000.997 57.5954 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0362221002578735 3353.76489257813 839.4485 3353.72900390625 839.439514160156 4 17 1.1.1.4453.8 1 54.4461 828.1335 54.436 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@20; Dehydrated(S)@22 missed K-L@20 -0.00860240031033754 3348.74145507813 838.1926 3348.75 838.194763183594 4 16 1.1.1.4487.4 1 55.2922 716.616 55.2848 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Ammonia-loss(N)@10; Dethiomethyl(M)@17; acrolein addition +76(K)@20 missed K-L@20 0.0350016988813877 3319.7548828125 830.946 3319.71997070313 830.937316894531 4 17 1.1.1.4507.3 1 55.7752 3868.922 55.9407 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Deamidated(N)@14 missed K-L@20 0.048395399004221 3310.73486328125 828.691 3310.68676757813 828.678955078125 4 15 1.1.1.4528.4 1 56.2953 6237.397 56.3657 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0714047029614449 3337.80517578125 1113.609 3337.73413085938 1113.58532714844 3 17 1.1.1.4550.6 1 56.8462 7344.792 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0358320996165276 3337.77026367188 835.4498 3337.73413085938 835.440795898438 4 16 1.1.1.4557.6 1 57.0184 18826.37 56.7611 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dehydrated(D)@15; Methyl(K)@20 missed K-L@20 0.0386452004313469 3304.76245117188 827.1979 3304.72387695313 827.188232421875 4 17 1.1.1.4455.9 1 54.4981 408.1608 54.5132 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Deamidated(N)@14; Formyl(K)@20 missed K-L@20 0.0701021999120712 3338.75170898438 835.6952 3338.681640625 835.677673339844 4 15 1.1.1.4464.5 1 54.7198 785.2972 54.6137 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR CHDH(D)@15 missed K-L@20 0.00340994005091488 3602.9052734375 901.7336 3602.90185546875 901.732727050781 4 16 1.1.1.4478.11 1 55.0773 1878.707 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0395091995596886 3323.75805664063 831.9468 3323.71826171875 831.936889648438 4 16 1.1.1.4561.2 1 57.1087 647.0375 57.0801 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Oxidation(M)@17; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0274333991110325 3353.75659179688 839.4464 3353.72900390625 839.439514160156 4 16 1.1.1.4475.4 1 54.9952 2377.504 55.1885 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0449617989361286 3324.74731445313 832.1941 3324.70239257813 832.182861328125 4 16 1.1.1.4572.6 1 57.3807 1079.704 57.3483 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0679102018475533 3324.77026367188 832.1998 3324.70239257813 832.182861328125 4 16 1.1.1.4483.4 1 55.196 28027.99 55.1164 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14 missed K-L@20 0.0734172984957695 3309.77612304688 1104.266 3309.70263671875 1104.24157714844 3 14 1.1.1.4532.15 1 56.4065 2698.475 56.3657 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@20; Deamidated(N)@28 missed K-L@20 0.0729599967598915 3323.79223632813 1108.938 3323.71826171875 1108.91345214844 3 15 1.1.1.4496.8 1 55.5171 1701.117 55.6248 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(D)@15; ONE addition +154(K)@20 missed K-L@20 0.0415857993066311 3519.880859375 880.9775 3519.83959960938 880.967163085938 4 14 1.1.1.4473.7 1 54.9467 450.7141 55.0145 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0666811987757683 3336.818359375 1113.28 3336.75 1113.25732421875 3 14 1.1.1.4498.7 1 55.5642 29521.26 55.3089 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0827568992972374 3337.8173828125 1113.613 3337.73413085938 1113.58532714844 3 15 1.1.1.4514.6 1 55.9564 1919.153 55.771 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Deamidated(N)@10; Dethiomethyl(M)@17; MDA adduct +62(K)@20 missed K-L@20 0.0502857007086277 3324.74926757813 832.1946 3324.69897460938 832.182006835938 4 14 1.1.1.4546.5 1 56.7459 16789.57 56.4913 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Methyl(K)@20 missed K-L@20 0.0277909003198147 3323.74609375 831.9438 3323.71826171875 831.936889648438 4 14 1.1.1.4568.4 1 57.2801 700.9426 57.2993 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IITHPNFNGNTLDNDIMLIKLSSPATLNSR CHDH(D)@15; Oxidation(M)@17 missed K-L@20 0.0267632007598877 3618.923828125 905.7382 3618.89672851563 905.7314453125 4 14 1.1.1.4483.8 1 55.2026 975.6013 55.2848 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@20; Decanoyl(S)@22 missed K-L@20 -0.0258971005678177 3616.92822265625 905.2393 3616.95385742188 905.245727539063 4 14 1.1.1.4494.6 1 55.4636 1550.844 55.3571 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0729599967598915 3323.79223632813 1108.938 3323.71826171875 1108.91345214844 3 14 1.1.1.4504.7 1 55.7108 1701.117 55.6248 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Methyl(K)@20 missed K-L@20 0.0780868008732796 3323.79516601563 1108.939 3323.71826171875 1108.91345214844 3 14 1.1.1.4519.12 1 56.0753 2840.829 56.1622 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; hexanoyl addition +98(K)@20; Octanoyl(S)@22 missed K-L@20 0.0171608999371529 3533.8974609375 884.4816 3533.88037109375 884.477355957031 4 14 1.1.1.4534.10 1 56.4525 230.4784 56.4668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0706723034381866 3337.80517578125 1113.609 3337.73413085938 1113.58532714844 3 13 1.1.1.4568.14 1 57.2892 534.6364 57.3483 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8399982452393 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14 missed K-L@20 0.0326894000172615 3309.7353515625 828.4411 3309.70263671875 828.432983398438 4 16 1.1.1.4432.4 1 53.9045 438.6638 53.974 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Dethiomethyl(M)@17; reduced acrolein addition +58(K)@20; Deamidated(N)@28 missed K-L@20 0.0383672006428242 3320.763671875 831.1982 3320.72534179688 831.188598632813 4 13 1.1.1.4529.4 1 56.3208 744.1985 56.3145 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Deamidated(N)@14; Dioxidation(M)@17 missed K-L@20 0.0745628997683525 3342.75146484375 836.6951 3342.67651367188 836.676391601563 4 13 1.1.1.4483.5 1 55.1976 1302.205 55.1645 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@17; acrolein addition +94(K)@20 missed K-L@20 -0.0035498000215739 3354.75366210938 839.6957 3354.75732421875 839.696594238281 4 12 1.1.1.4483.6 1 55.1993 2213.774 55.1645 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.4300017356873 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Hex(N)@14; acrolein addition +76(K)@20 missed K-L@20 0.0781914964318275 3547.865234375 710.5803 3547.78686523438 710.564636230469 5 13 1.1.1.4479.5 1 55.098 767.3771 55.2607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.4300017356873 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; CHDH(D)@15 missed K-L@20 0.00227191997691989 3603.88818359375 901.9793 3603.8857421875 901.978759765625 4 13 1.1.1.4534.12 1 56.4542 349.6456 56.4913 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.2999980449677 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0318442992866039 3336.7822265625 835.2028 3336.75 835.194763183594 4 12 1.1.1.4488.4 1 55.3163 107124.3 55.3331 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.1700003147125 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@20 missed K-L@20 0.0420977994799614 3336.79223632813 835.2053 3336.75 835.194763183594 4 12 1.1.1.4471.8 1 54.8967 339.3423 54.9126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.869998216629 IITHPNFNGNTLDNDIMLIKLSSPATLNSR HexNAc(N)@14; reduced acrolein addition +58(K)@20 missed K-L@20 0.0168194007128477 3569.85693359375 893.4715 3569.83984375 893.46728515625 4 12 1.1.1.4479.14 1 55.1055 315.5311 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.869998216629 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@8; Delta:H(4)C(2)(K)@20 missed K-L@20 0.0714047029614449 3337.80517578125 1113.609 3337.73413085938 1113.58532714844 3 13 1.1.1.4559.9 1 57.0683 3121.932 56.8105 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.3699986934662 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@28 missed K-L@20 0.0312245991080999 3309.73364257813 828.4407 3309.70263671875 828.432983398438 4 15 1.1.1.4498.2 1 55.5559 1158.555 55.5029 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.0152743998914957 3308.73413085938 828.1908 3308.71875 828.186950683594 4 14 1.1.1.4501.6 1 55.6316 2496.322 55.771 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.0235747992992401 3308.74243164063 828.1929 3308.71875 828.186950683594 4 14 1.1.1.4522.3 1 56.1421 504.6858 56.1875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.6800003051758 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; reduced acrolein addition +58(K)@20 missed K-L@20 0.0176545009016991 3367.76220703125 842.9478 3367.74462890625 842.943420410156 4 9 1.1.1.4479.11 1 55.103 943.6971 55.2848 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.1300022602081 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14; Dethiomethyl(M)@17; reduced acrolein addition +58(K)@20 missed K-L@20 0.0531775988638401 3319.79443359375 830.9559 3319.7412109375 830.942565917969 4 10 1.1.1.4470.4 1 54.8682 254.0878 54.8874 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.940000295639 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@10; Oxidation(M)@17 missed K-L@20 0.0533406995236874 3325.7509765625 832.445 3325.69775390625 832.431701660156 4 9 1.1.1.4519.6 1 56.0703 3103.613 56.1875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 77.2700011730194 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@6; Deamidated(N)@14; reduced acrolein addition +58(K)@20 missed K-L@20 0.0389758981764317 3368.76782226563 843.1992 3368.728515625 843.189453125 4 9 1.1.1.4543.4 1 56.6681 340.1018 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 73.9099979400635 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@14 missed K-L@20 0.0734172984957695 3309.77612304688 1104.266 3309.70263671875 1104.24157714844 3 9 1.1.1.4533.16 1 56.4326 2698.475 56.3657 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 70.2000021934509 IITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@20; Dehydrated(S)@22 missed K-L@20 0.0399363003671169 3352.763671875 839.1982 3352.72387695313 839.188232421875 4 9 1.1.1.4519.8 1 56.072 307.1071 56.0137 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.6899995803833 IITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@17; acrolein addition +94(K)@20 missed K-L@20 0.0453846007585526 3354.80322265625 1119.275 3354.75732421875 1119.25964355469 3 9 1.1.1.4480.5 1 55.1279 807.6448 55.1405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 20.890000462532 IITHPNFNGNTLDNDIMLIKLSSPATLNSR missed K-L@20 0.0723557993769646 3308.79223632813 1103.938 3308.71875 1103.91357421875 3 7 1.1.1.4479.18 1 55.1089 6896.67 54.9891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IMLIKLSSPATLNSR Dethiomethyl(M)@2; acrolein addition +76(K)@5 cleaved D-I@N-term; missed K-L@5 0.011957099661231 1670.98388671875 558.0019 1670.97192382813 557.997924804688 3 18 1.1.1.4168.4 1 47.4865 8737.704 47.5301 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 IMLIKLSSPATLNSR Carbamidomethyl@N-term; Oxidation(M)@2; acrolein addition +56(K)@5 cleaved D-I@N-term; missed K-L@5 -0.000442324992036447 1771.98608398438 591.6693 1771.98657226563 591.669494628906 3 10 1.1.1.4340.6 1 51.6631 403.0424 51.7536 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.8100011348724 IMLIKLSSPATLNSR MDA adduct +62(K)@5; Dehydrated(S)@7 cleaved D-I@N-term; missed K-L@5 0.0330789983272552 1686.98229980469 563.3347 1686.94909667969 563.323669433594 3 12 1.1.1.4101.8 1 45.8576 326.7014 45.8676 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 0.0395068004727364 2706.4482421875 903.1567 2706.40893554688 903.143615722656 3 21 1.1.1.4280.12 1 50.2043 19448.18 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 0.0395068004727364 2706.4482421875 903.1567 2706.40893554688 903.143615722656 3 30 1.1.1.4288.13 1 50.396 19448.18 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 0.0395068004727364 2706.4482421875 903.1567 2706.40893554688 903.143615722656 3 30 1.1.1.4289.3 1 50.4211 19448.18 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 -0.0243436992168427 2706.38452148438 542.2842 2706.40893554688 542.2890625 5 18 1.1.1.4283.9 1 50.27 723.1198 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 0.0099920304492116 2706.4189453125 677.612 2706.40893554688 677.609497070313 4 18 1.1.1.4290.3 1 50.4377 35259.21 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAK Oxidation(F)@19 missed R-L@4 0.0511422008275986 2722.45483398438 908.4922 2722.40380859375 908.475219726563 3 21 1.1.1.4282.18 1 50.2527 228.6483 50.3095 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8399982452393 IQVRLGEHNIDVLEGNEQFINAAK missed R-L@4 0.0099920304492116 2706.4189453125 677.612 2706.40893554688 677.609497070313 4 15 1.1.1.4280.7 1 50.1959 35259.21 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.6799972057343 IQVRLGEHNIDVLEGNEQFINAAK Methyl(D)@11 missed R-L@4 0.0164963006973267 2720.44116210938 907.821 2720.42456054688 907.815490722656 3 9 1.1.1.4286.7 0 50.342 173.7239 50.3341 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.7099981307983 IQVRLGEHNIDVLEGNEQFINAAKI Hex(N)@21; acrolein addition +38(K)@24 cleaved I-I@C-term; missed R-L@4; missed K-I@24 0.0109465997666121 3019.57250976563 755.9004 3019.5615234375 755.897644042969 4 11 1.1.1.4724.3 1 61.0498 573.7547 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.869998216629 IQVRLGEHNIDVLEGNEQFINAAKII Oxidation(N)@21; acrolein addition +56(K)@24 cleaved I-T@C-term; missed R-L@4; missed K-I@24 -0.0303687993437052 3004.56762695313 752.1492 3004.59814453125 752.156799316406 4 13 1.1.1.4284.7 1 50.3044 388.6494 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.6799972057343 IQVRLGEHNIDVLEGNEQFINAAKII Oxidation(N)@21; acrolein addition +56(K)@24 cleaved I-T@C-term; missed R-L@4; missed K-I@24 0.0116940001025796 3004.61010742188 1002.544 3004.59814453125 1002.53997802734 3 11 1.1.1.4283.20 1 50.2792 301.393 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 70.2000021934509 IQVRLGEHNIDVLEGNEQFINAAKII Deamidated(N)@21; acrolein addition +94(K)@24 cleaved I-T@C-term; missed R-L@4; missed K-I@24 -0.0132296001538634 3027.58984375 757.9047 3027.60302734375 757.908020019531 4 9 1.1.1.4714.7 1 60.7971 307.2678 60.7875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Pro->pyro-Glu(P)@29 missed R-L@4; missed K-I@24 0.0777878016233444 4984.62841796875 831.7787 4984.55029296875 831.765686035156 6 16 1.1.1.4708.6 1 60.6399 283.7894 60.6284 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN hexanoyl addition +98(K)@24; Dehydrated(T)@27; reduced HNE(H)@28; MDA adduct +62(K)@44 cleaved N-S@C-term; missed R-L@4; missed K-I@24; missed K-L@44 0.0547542981803417 6054.25048828125 1010.049 6054.19287109375 1010.03942871094 6 20 1.1.1.4793.5 1 62.7464 5812.271 62.7069 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN MDA adduct +62(K)@24; Dehydrated(T)@27; reduced HNE(H)@28; hexanoyl addition +98(K)@44 cleaved N-S@C-term; missed R-L@4; missed K-I@24; missed K-L@44 0.0452331006526947 6054.23828125 1010.047 6054.19287109375 1010.03942871094 6 19 1.1.1.4807.6 1 63.086 7304.863 63.0478 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN reduced HNE(H)@28; Carbamyl(M)@41; hexanoyl addition +98(K)@44 cleaved N-S@C-term; missed R-L@4; missed K-I@24; missed K-L@44 0.0707809999585152 6053.2666015625 1009.885 6053.193359375 1009.87286376953 6 22 1.1.1.4733.5 1 61.2784 59344.29 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.3200023174286 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN hexanoyl addition +98(K)@24; HPNE addition +172(K)@44 cleaved N-S@C-term; missed R-L@4; missed K-I@24; missed K-L@44 0.0720101967453957 6024.23828125 1005.047 6024.1669921875 1005.03509521484 6 13 1.1.1.4731.4 1 61.2258 5239.362 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.1499984264374 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN reduced acrolein addition +96(K)@24; HPNE addition +172(K)@44 cleaved N-S@C-term; missed R-L@4; missed K-I@24; missed K-L@44 0.0838180035352707 6022.234375 1004.713 6022.1513671875 1004.69915771484 6 12 1.1.1.4729.5 1 61.1818 892.1674 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dehydrated(T)@35; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0654018968343735 6069.21875 868.0385 6069.1533203125 868.029174804688 7 24 1.1.1.4712.4 1 60.7419 3890.934 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24 missed R-L@4; missed K-I@24; missed K-L@44 0.0810727030038834 6025.19287109375 861.7491 6025.11181640625 861.737548828125 7 22 1.1.1.4720.4 1 60.951 10785.05 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 0.0411567986011505 6011.173828125 859.7464 6011.1328125 859.740539550781 7 26 1.1.1.4721.6 1 60.9779 3756.382 61.0452 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 0.0922349020838737 6025.240234375 1005.214 6025.1484375 1005.19866943359 6 26 1.1.1.4721.15 1 60.9854 12395.42 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0346597991883755 6053.21435546875 865.7522 6053.1796875 865.747253417969 7 30 1.1.1.4723.7 1 61.0285 59670.89 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0411567986011505 6011.173828125 859.7464 6011.1328125 859.740539550781 7 23 1.1.1.4724.5 1 61.0515 3756.382 61.0452 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0375371016561985 6039.2021484375 863.7504 6039.1640625 863.744995117188 7 29 1.1.1.4724.6 1 61.0523 8612.807 61.0948 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0868481025099754 6011.21826171875 1002.877 6011.1328125 1002.86273193359 6 37 1.1.1.4724.9 1 61.0565 4828.094 61.0452 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0922349020838737 6025.240234375 1005.214 6025.1484375 1005.19866943359 6 29 1.1.1.4724.10 1 61.0582 12395.42 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0446872003376484 6025.19287109375 861.7491 6025.1484375 861.742736816406 7 24 1.1.1.4725.6 1 61.0773 10785.05 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@24; Deamidated(N)@34; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0677542984485626 6082.22607421875 869.8967 6082.15869140625 869.887084960938 7 23 1.1.1.4725.7 1 61.0781 699.1749 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; reduced HNE(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0330695994198322 6259.34375 895.1992 6259.310546875 895.194458007813 7 25 1.1.1.4725.10 1 61.0806 522.4839 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0375371016561985 6039.2021484375 863.7504 6039.1640625 863.744995117188 7 24 1.1.1.4726.3 1 61.0999 8612.807 61.0948 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0710453018546104 6053.21435546875 865.7522 6053.14306640625 865.742004394531 7 23 1.1.1.4726.4 1 61.1007 60297.72 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0380305983126163 6053.21435546875 865.7522 6053.17626953125 865.746765136719 7 27 1.1.1.4726.5 1 61.1015 60297.72 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(D)@37; Methyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0446872003376484 6025.19287109375 861.7491 6025.1484375 861.742736816406 7 32 1.1.1.4727.2 1 61.1246 10785.05 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0856126025319099 6039.244140625 1007.548 6039.16064453125 1007.53405761719 6 26 1.1.1.4727.5 1 61.1296 10014.33 61.0948 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dehydrated(T)@35; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0611295998096466 6069.21435546875 868.0379 6069.1533203125 868.029174804688 7 25 1.1.1.4731.2 1 61.2225 3414.284 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0375371016561985 6039.2021484375 863.7504 6039.1640625 863.744995117188 7 28 1.1.1.4732.3 1 61.2492 8612.807 61.0948 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0880704969167709 6053.2666015625 1009.885 6053.17626953125 1009.86999511719 6 30 1.1.1.4732.6 1 61.2567 59344.29 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0710453018546104 6053.21435546875 865.7522 6053.14306640625 865.742004394531 7 29 1.1.1.4733.3 1 61.2734 60297.72 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(H)@28; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0380305983126163 6053.21435546875 865.7522 6053.17626953125 865.746765136719 7 32 1.1.1.4734.3 1 61.3017 60297.72 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0542705990374088 6068.20849609375 867.8942 6068.154296875 867.886474609375 7 27 1.1.1.4735.5 1 61.3244 2468.105 61.291 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; reduced acrolein addition +58(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0331778004765511 6084.20703125 870.1797 6084.17431640625 870.175048828125 7 24 1.1.1.4735.6 1 61.3261 1054.625 61.291 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0335790999233723 6025.1826171875 861.7476 6025.1484375 861.742736816406 7 23 1.1.1.4738.3 1 61.3925 1550.114 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 0.0754958987236023 6011.20654296875 1002.875 6011.1328125 1002.86273193359 6 22 1.1.1.4738.6 1 61.3958 690.4066 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0672841966152191 6036.18408203125 863.3193 6036.11669921875 863.309692382813 7 21 1.1.1.4739.4 1 61.4179 5470.202 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0601381994783878 6054.19873046875 865.8928 6054.138671875 865.884216308594 7 22 1.1.1.4785.2 1 62.5488 4215.016 62.6828 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; Deamidated(N)@34; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00615034997463226 6124.2119140625 875.8947 6124.20556640625 875.893798828125 7 22 1.1.1.4727.3 1 61.1263 291.3477 61.1447 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0614199005067348 6054.2001953125 865.893 6054.138671875 865.884216308594 7 21 1.1.1.4809.3 1 63.127 6001.047 63.0238 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Oxidation(P)@29; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.016831299290061 6099.20166015625 872.3218 6099.18505859375 872.319458007813 7 22 1.1.1.4735.7 1 61.3278 513.5813 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@24; Deamidated(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.0739350020885468 6054.201171875 865.8932 6054.12744140625 865.882629394531 7 20 1.1.1.4800.4 1 62.9106 6109.472 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0726533010601997 6054.2001953125 865.893 6054.12744140625 865.882629394531 7 20 1.1.1.4816.3 1 63.2985 5924.113 63.0478 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0713716000318527 6054.19873046875 865.8928 6054.12744140625 865.882629394531 7 20 1.1.1.4792.3 1 62.7141 4215.016 62.6828 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0584388002753258 6039.22021484375 1007.544 6039.1640625 1007.53460693359 6 22 1.1.1.4813.6 1 63.236 429.4403 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0548105016350746 6053.1982421875 865.7499 6053.14306640625 865.742004394531 7 22 1.1.1.4710.6 1 60.6903 1307.742 60.7875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0729084014892578 6087.236328125 870.6125 6087.1640625 870.602111816406 7 21 1.1.1.4726.6 1 61.1024 650.9433 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.040599200874567 6068.19482421875 867.8923 6068.154296875 867.886474609375 7 22 1.1.1.4728.2 1 61.1492 2580.368 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Hex(N)@16; reduced acrolein addition +96(K)@24; reduced HNE(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 0.0844772011041641 6413.44287109375 917.2134 6413.35791015625 917.201293945313 7 21 1.1.1.4738.4 1 61.3933 698.8616 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0628886967897415 6084.23828125 1015.047 6084.17431640625 1015.03631591797 6 21 1.1.1.4738.7 1 61.3975 1245.751 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; acrolein addition +76(K)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0819984003901482 6103.22802734375 1018.212 6103.1474609375 1018.19854736328 6 21 1.1.1.4726.15 1 61.1099 684.2216 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dethiomethyl(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0821487978100777 6069.25048828125 1012.549 6069.17138671875 1012.53582763672 6 20 1.1.1.4732.7 1 61.2592 3517.039 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0827789977192879 6079.24169921875 869.4704 6079.1591796875 869.458557128906 7 20 1.1.1.4868.3 1 64.57 521.0893 64.6104 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR missed R-L@4; missed K-I@24; missed K-L@44 0.0924476981163025 5997.20849609375 1000.542 5997.1171875 1000.52679443359 6 18 1.1.1.4719.15 1 60.9347 1196.501 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Methyl(H)@28 missed R-L@4; missed K-I@24; missed K-L@44 0.138478994369507 6011.2685546875 1203.261 6011.1328125 1203.23376464844 5 20 1.1.1.4722.16 1 61.0113 1834.467 61.0205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; Delta:H(2)C(2)(H)@28; Deamidated(N)@34; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0436442010104656 6128.22314453125 876.4677 6128.17919921875 876.461486816406 7 21 1.1.1.4726.9 1 61.1049 303.1674 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.160429000854492 6036.2783203125 1208.263 6036.11669921875 1208.23059082031 5 20 1.1.1.4739.20 1 61.4312 2403.371 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0755184963345528 6054.21435546875 865.895 6054.138671875 865.884216308594 7 19 1.1.1.4741.7 1 61.4697 37349.05 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.121085003018379 6053.2666015625 1009.885 6053.14306640625 1009.86450195313 6 22 1.1.1.4726.14 1 61.109 59344.29 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0726533010601997 6054.2001953125 865.893 6054.12744140625 865.882629394531 7 18 1.1.1.4826.3 1 63.5387 2723.277 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0763858035206795 6069.21435546875 868.0379 6069.13818359375 868.027038574219 7 18 1.1.1.4723.8 1 61.0293 3414.284 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Cation:Na(D)@39 missed R-L@4; missed K-I@24; missed K-L@44 0.0198375005275011 6019.1201171875 1004.194 6019.09912109375 1004.1904296875 6 19 1.1.1.4721.14 1 60.9846 399.454 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Oxidation(P)@29; HPNE addition +172(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0789375975728035 6243.3427734375 892.9134 6243.263671875 892.902099609375 7 18 1.1.1.4726.10 1 61.1057 213.9057 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; reduced HNE(H)@28; Dicarbamidomethyl(D)@39; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0466771982610226 6429.42578125 919.4967 6429.37939453125 919.490051269531 7 19 1.1.1.4732.4 1 61.2517 5103.977 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0765815004706383 6101.25439453125 1017.883 6101.1796875 1017.87054443359 6 18 1.1.1.4733.7 1 61.2834 546.9279 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dehydrated(T)@35; Deamidated(N)@38; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0937435030937195 6034.19482421875 863.0351 6034.10107421875 863.021728515625 7 19 1.1.1.4734.2 1 61.2976 1707.039 61.3395 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24; Deamidated(N)@34 missed R-L@4; missed K-I@24; missed K-L@44 0.117229998111725 6026.21240234375 1005.376 6026.09619140625 1005.35662841797 6 19 1.1.1.4741.14 1 61.4764 2055.891 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dimethyl(N)@34; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0748448967933655 6053.24853515625 1211.657 6053.17626953125 1211.642578125 5 20 1.1.1.4751.6 1 61.7251 852.0273 61.7545 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.109081000089645 6054.25048828125 1010.049 6054.138671875 1010.03039550781 6 18 1.1.1.4786.3 1 62.5753 5812.271 62.7069 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.153228998184204 6054.29345703125 1211.866 6054.138671875 1211.8349609375 5 19 1.1.1.4811.8 1 63.1877 2760.797 62.9273 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.110793001949787 6054.23828125 1010.047 6054.12744140625 1010.02850341797 6 18 1.1.1.4814.5 1 63.2566 7304.863 63.0478 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0858974009752274 6054.21337890625 865.8949 6054.12744140625 865.882629394531 7 16 1.1.1.4703.5 1 60.5062 502.2312 60.5246 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0818099975585938 6036.19873046875 863.3214 6036.11669921875 863.309692382813 7 16 1.1.1.4717.5 1 60.875 776.9976 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@24; reduced HNE(H)@28; Hex(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.0624860003590584 6429.41552734375 919.4952 6429.35302734375 919.486267089844 7 18 1.1.1.4725.12 1 61.0823 4983.557 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@16; Didehydroretinylidene(K)@24; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0568153001368046 6318.37158203125 903.6318 6318.31494140625 903.623718261719 7 18 1.1.1.4727.4 1 61.128 536.5099 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.132737994194031 6025.2783203125 1206.063 6025.14501953125 1206.03625488281 5 18 1.1.1.4728.10 1 61.1642 4423.668 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@18; Oxidation(M)@41; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.108681000769138 6076.220703125 869.0388 6076.11181640625 869.023254394531 7 17 1.1.1.4731.3 1 61.2242 950.8604 61.2426 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Deamidated(N)@38; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.101517997682095 6080.2421875 1014.381 6080.14306640625 1014.36444091797 6 18 1.1.1.4732.8 1 61.2617 583.0394 61.2668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0862068012356758 6087.25048828125 1015.549 6087.1640625 1015.53460693359 6 18 1.1.1.4740.13 1 61.4501 890.1391 61.291 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.155059993267059 6054.29345703125 1211.866 6054.138671875 1211.8349609375 5 18 1.1.1.4789.7 1 62.6537 2163.621 62.6828 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.146614998579025 6122.33837890625 1021.397 6122.18994140625 1021.37225341797 6 18 1.1.1.4730.3 1 61.213 252.5853 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Oxidation(P)@29; Deamidated(N)@30; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0886707007884979 6104.23046875 1018.379 6104.14306640625 1018.36444091797 6 18 1.1.1.4734.5 1 61.3101 756.9088 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.111891999840736 6054.23828125 1010.047 6054.12744140625 1010.02850341797 6 16 1.1.1.4757.5 1 61.8817 2198.846 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.121046997606754 6054.25048828125 1010.049 6054.12744140625 1010.02850341797 6 16 1.1.1.4772.5 1 62.2417 3351.594 62.3226 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@34; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.120315000414848 6054.25048828125 1010.049 6054.12744140625 1010.02850341797 6 16 1.1.1.4800.9 1 62.9198 7540.585 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.128712996840477 6069.2685546875 1012.552 6069.13818359375 1012.53033447266 6 16 1.1.1.4716.17 1 60.8584 4536.297 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR PyridoxalPhosphate(K)@24; reduced HNE(H)@28; reduced acrolein addition +96(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 -0.0560479983687401 6022.234375 1004.713 6022.291015625 1004.72247314453 6 17 1.1.1.4729.5 1 61.1818 892.1674 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Dethiomethyl(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0821487978100777 6069.25048828125 1012.549 6069.17138671875 1012.53582763672 6 16 1.1.1.4731.5 1 61.2275 3517.039 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@21; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.134963005781174 6054.2626953125 1010.051 6054.12744140625 1010.02850341797 6 16 1.1.1.4740.12 1 61.4493 42558.84 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.138541996479034 6079.30029296875 1014.224 6079.1591796875 1014.20043945313 6 17 1.1.1.4868.6 1 64.58 773.8019 64.5851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.121779002249241 6054.25048828125 1010.049 6054.12744140625 1010.02850341797 6 15 1.1.1.4712.13 1 60.7494 2473.117 60.7875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.122313998639584 6024.23828125 1005.047 6024.11669921875 1005.02673339844 6 16 1.1.1.4731.4 1 61.2258 5239.362 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.119254000484943 6053.26025390625 1009.884 6053.14306640625 1009.86450195313 6 15 1.1.1.4743.17 1 61.5277 56698.73 61.2668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.119216002523899 6054.244140625 1010.048 6054.12744140625 1010.02850341797 6 15 1.1.1.4821.6 1 63.4296 5479.202 63.1687 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.0851441025733948 6024.20166015625 861.6075 6024.11669921875 861.595397949219 7 15 1.1.1.4735.4 1 61.3228 1113.28 61.3882 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.152619004249573 6054.28857421875 1211.865 6054.138671875 1211.8349609375 5 16 1.1.1.4797.6 1 62.8458 2522.672 62.8028 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)@N-term; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.143303006887436 6079.30029296875 1014.224 6079.1591796875 1014.20043945313 6 16 1.1.1.4884.6 1 64.975 393.5169 64.9834 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +38(K)@24; Deamidated(N)@38; Dethiomethyl(M)@41; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0628746002912521 6086.24853515625 1015.382 6086.1865234375 1015.37170410156 6 15 1.1.1.4729.6 1 61.1851 1137.454 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Deamidated(N)@34; Dethiomethyl(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0638488009572029 6034.21630859375 1006.71 6034.1552734375 1006.69982910156 6 16 1.1.1.4734.4 1 61.3059 1724.18 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; reduced HNE(H)@28; Hex(N)@38; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.116797998547554 6429.47265625 1072.586 6429.35302734375 1072.56616210938 6 16 1.1.1.4740.16 1 61.4526 5543.036 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.10801599919796 6036.22607421875 1007.045 6036.11669921875 1007.02673339844 6 14 1.1.1.4742.15 1 61.5013 5298.53 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.156891003251076 6054.29345703125 1211.866 6054.138671875 1211.8349609375 5 16 1.1.1.4819.4 1 63.3811 2362.469 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.109480999410152 6036.22607421875 1007.045 6036.11669921875 1007.02673339844 6 14 1.1.1.4720.13 0 60.9585 1003.219 60.9955 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Ammonia-loss(N)@38 missed R-L@4; missed K-I@24; missed K-L@44 0.0969408974051476 6038.23046875 1007.379 6038.13232421875 1007.36267089844 6 15 1.1.1.4721.16 1 60.9863 5849.567 61.0948 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@24; reduced HNE(H)@28; Carbamidomethyl(D)@39; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0814384967088699 6428.46435546875 1072.418 6428.38427734375 1072.40466308594 6 15 1.1.1.4728.8 1 61.1592 2575.906 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.115163996815681 6069.25048828125 1012.549 6069.13818359375 1012.53033447266 6 13 1.1.1.4739.14 1 61.4262 3513.785 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Formyl(K)@24 missed R-L@4; missed K-I@24; missed K-L@44 0.0810727030038834 6025.19287109375 861.7491 6025.11181640625 861.737548828125 7 14 1.1.1.4719.5 1 60.9264 10785.05 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.108634002506733 6053.25439453125 1009.883 6053.14306640625 1009.86450195313 6 13 1.1.1.4719.16 1 60.9355 1375.418 60.7875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.114513002336025 6076.22802734375 1013.712 6076.11181640625 1013.69256591797 6 13 1.1.1.4725.17 1 61.0864 816.1909 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.101497001945972 6040.22216796875 1007.711 6040.123046875 1007.69439697266 6 14 1.1.1.4804.8 1 63.0163 556.4791 62.9519 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.163605004549026 6054.3037109375 1211.868 6054.138671875 1211.8349609375 5 15 1.1.1.4775.5 1 62.3175 1341.789 62.3704 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(M)@41; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.115163996815681 6069.25048828125 1012.549 6069.13818359375 1012.53033447266 6 13 1.1.1.4723.12 1 61.0335 3517.039 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(P)@29; Deamidated(N)@34; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.112473003566265 6072.25048828125 1013.049 6072.1376953125 1013.0302734375 6 14 1.1.1.4723.13 1 61.0352 1598.431 61.1693 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@24; Hex(N)@38; HPNE addition +172(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0731668025255203 6429.42578125 919.4967 6429.35302734375 919.486267089844 7 14 1.1.1.4739.5 1 61.4187 5103.977 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0508421994745731 6083.2421875 1014.881 6083.1904296875 1014.87231445313 6 12 1.1.1.4725.18 1 61.0873 856.1942 61.1693 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; reduced HNE(H)@28; Dicarbamidomethyl(D)@39; hexanoyl addition +98(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0903085991740227 6429.47265625 1072.586 6429.37939453125 1072.57055664063 6 14 1.1.1.4726.18 1 61.1124 5288.525 61.291 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR PyridoxalPhosphate(K)@24; reduced HNE(H)@28; acrolein addition +112(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.00509390980005264 6038.29345703125 1208.666 6038.2861328125 1208.66455078125 5 14 1.1.1.4731.9 1 61.235 2208.921 61.0948 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR hexanoyl addition +98(K)@44; Arg->Orn(R)@54 missed R-L@4; missed K-I@24; missed K-L@44 0.0959331020712852 6053.2666015625 1009.885 6053.16845703125 1009.86871337891 6 21 1.1.1.4733.5 1 61.2784 59344.29 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.109016001224518 6073.25830078125 1013.217 6073.1484375 1013.19866943359 6 12 1.1.1.4733.6 1 61.2809 1387.847 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.106980003416538 6072.244140625 1013.048 6072.1376953125 1013.0302734375 6 13 1.1.1.4742.16 1 61.5021 1449.377 61.291 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +76(K)@24; Dethiomethyl(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 0.132737994194031 6025.2783203125 1206.063 6025.14501953125 1206.03625488281 5 11 1.1.1.4720.20 1 60.9643 4423.668 61.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Trimethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.132462993264198 6039.29833984375 1208.867 6039.1640625 1208.84008789063 5 14 1.1.1.4725.21 1 61.0898 3552.822 61.0948 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(2)C(2)(H)@28; Dethiomethyl(M)@41; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0963969007134438 6033.2685546875 1207.661 6033.17138671875 1207.64147949219 5 12 1.1.1.4726.19 1 61.1132 406.4651 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.155059993267059 6054.29345703125 1211.866 6054.138671875 1211.8349609375 5 14 1.1.1.4804.9 1 63.0188 2639.524 63.072 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.111525997519493 6054.23828125 1010.047 6054.12744140625 1010.02850341797 6 12 1.1.1.4835.5 1 63.7659 1254.583 63.5079 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.2999980449677 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; Deamidated(N)@38; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.103454001247883 6098.236328125 1017.38 6098.13232421875 1017.36267089844 6 12 1.1.1.4724.11 1 61.0598 490.8932 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.2999980449677 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; MDA adduct +62(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.123731002211571 6060.23828125 1011.047 6060.11669921875 1011.02673339844 6 12 1.1.1.4728.6 1 61.1559 1122.108 61.1938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.869998216629 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +112(K)@24; reduced HNE(H)@28; Oxidation(M)@41 missed R-L@4; missed K-I@24; missed K-L@44 0.101398997008801 6283.396484375 1048.24 6283.294921875 1048.22314453125 6 10 1.1.1.4726.16 1 61.1107 215.9636 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.869998216629 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@44; Amidated@C-term missed R-L@4; missed K-I@24; missed K-L@44 0.0631745979189873 6054.23828125 1010.047 6054.1748046875 1010.03643798828 6 17 1.1.1.4807.6 1 63.086 7304.863 63.0478 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.8699991703033 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0837173983454704 6097.234375 1017.213 6097.1484375 1017.19866943359 6 10 1.1.1.4731.6 1 61.2292 501.491 61.2181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR ONE addition +154(K)@24; reduced HNE(H)@28; Carboxy(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.101542003452778 6429.47265625 1072.586 6429.3681640625 1072.56860351563 6 16 1.1.1.4733.8 1 61.2859 5543.036 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.3800022602081 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; Oxidation(P)@29; Delta:H(4)C(2)(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0844708979129791 6099.2685546875 1017.552 6099.18505859375 1017.53814697266 6 13 1.1.1.4738.8 1 61.3992 494.1321 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0445860996842384 6055.20361328125 866.0364 6055.1591796875 866.029968261719 7 14 1.1.1.4715.13 1 60.8291 1610.817 60.7875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR missed R-L@4; missed K-I@24; missed K-L@44 0.0924476981163025 5997.20849609375 1000.542 5997.1171875 1000.52679443359 6 14 1.1.1.4723.11 1 61.0318 1196.501 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0282077994197607 6093.20263671875 871.4648 6093.1748046875 871.460815429688 7 13 1.1.1.4725.8 1 61.0789 475.6205 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0770519971847534 6055.234375 1010.213 6055.1591796875 1010.20043945313 6 14 1.1.1.4835.6 1 63.7684 1246.165 63.5079 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.6800003051758 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.119947999715805 6054.244140625 1010.048 6054.12744140625 1010.02850341797 6 11 1.1.1.4705.14 1 60.5695 651.4196 60.5246 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.6800003051758 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.121817998588085 6053.2666015625 1009.885 6053.14306640625 1009.86450195313 6 10 1.1.1.5705.8 1 77.0394 193.9714 76.9947 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.1699991226196 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; MDA adduct +54(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.133221000432968 6052.24658203125 1009.715 6052.11181640625 1009.69256591797 6 11 1.1.1.4721.17 1 60.9871 22531.13 61.1447 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.1699991226196 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Oxidation(P)@29; Deamidated(N)@38; Dethiomethyl(M)@41; acrolein addition +76(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.121871002018452 6042.244140625 1008.048 6042.1240234375 1008.02795410156 6 13 1.1.1.4725.16 1 61.0856 2583.257 61.0948 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.1699991226196 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +54(K)@24; reduced HNE(H)@28; Dioxidation(M)@41; HPNE addition +172(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.112456001341343 6413.47021484375 1069.919 6413.35791015625 1069.90026855469 6 12 1.1.1.4738.9 1 61.4008 594.7531 61.3882 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.6799972057343 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@44; Amidated@C-term missed R-L@4; missed K-I@24; missed K-L@44 0.0726957991719246 6054.25048828125 1010.049 6054.1748046875 1010.03643798828 6 17 1.1.1.4793.5 1 62.7464 5812.271 62.7069 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@38; Oxidation(M)@41; acrolein addition +112(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.129489004611969 6126.2802734375 1022.054 6126.1484375 1022.03204345703 6 11 1.1.1.4727.6 1 61.1313 342.079 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.3699972629547 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@24; acrolein addition +56(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0225683990865946 6111.20849609375 1019.542 6111.18505859375 1019.53814697266 6 13 1.1.1.4724.12 1 61.0615 313.4669 61.0948 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.3699972629547 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.07448860257864 6055.234375 1010.213 6055.1591796875 1010.20043945313 6 13 1.1.1.4828.8 1 63.5964 1927.463 63.3378 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.2800011634827 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.11760900169611 6040.240234375 1007.714 6040.123046875 1007.69439697266 6 11 1.1.1.4714.20 1 60.808 702.9261 60.7875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.2800011634827 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Carbamidomethyl(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.122997000813484 6054.2626953125 1010.051 6054.138671875 1010.03039550781 6 16 1.1.1.4750.5 1 61.6978 2476.376 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 81.6399991512299 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@9; reduced acrolein addition +58(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0735369026660919 6056.21630859375 866.181 6056.14306640625 866.170532226563 7 9 1.1.1.4714.13 1 60.8021 1098.307 60.7875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 34.5200002193451 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR reduced acrolein addition +96(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0684937015175819 6093.244140625 1016.548 6093.1748046875 1016.53637695313 6 12 1.1.1.4728.7 1 61.1575 453.3003 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.8299987316132 IQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@24; acrolein addition +38(K)@44 missed R-L@4; missed K-I@24; missed K-L@44 0.0524571985006332 6097.2001953125 872.0359 6097.1484375 872.028442382813 7 11 1.1.1.4726.7 1 61.1032 427.3793 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Ammonia-loss(N)@31; reduced HNE(H)@40; Carbamidomethyl(C)@41 0.0383725985884666 4800.3154296875 961.0704 4800.27734375 961.062744140625 5 14 1.1.1.4378.7 1 52.577 4552.608 52.6108 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Dehydrated(T)@6; Carbamidomethyl(C)@7; Dehydrated(S)@17; Carbamidomethyl(C)@25; reduced HNE(H)@40; Carbamidomethyl(C)@41; acrolein addition +56(K)@43 -0.033093698322773 4837.2763671875 968.4625 4837.30908203125 968.469116210938 5 15 1.1.1.4452.14 1 54.4251 4614.226 54.436 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.6400008201599 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Ser->LacticAcid(S)@11; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0763870030641556 4799.322265625 960.8717 4799.24560546875 960.8564453125 5 14 1.1.1.4397.5 1 53.0281 3276.94 52.9226 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; reduced HNE(H)@23; Carbamidomethyl(C)@25; Deamidated(Q)@33; FormaldehydeAdduct(W)@34; Carbamidomethyl(C)@41 0.057353101670742 4830.345703125 967.0764 4830.2880859375 967.064880371094 5 12 1.1.1.4408.7 1 53.3048 660.0505 53.3124 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK No Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.072324700653553 4757.3076171875 952.4688 4757.2353515625 952.454345703125 5 13 1.1.1.4541.5 1 56.6235 944.96 56.6629 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK No Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Deamidated(N)@31; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0823952034115791 4757.31787109375 952.4708 4757.2353515625 952.454345703125 5 13 1.1.1.4548.5 1 56.7952 777.2311 56.8105 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; reduced HNE(H)@23; Carbamidomethyl(C)@25; Deamidated(N)@31; Dehydrated(S)@37; Carbamidomethyl(C)@41 0.0947334989905357 4800.37060546875 1201.1 4800.27734375 1201.07666015625 4 12 1.1.1.4378.9 1 52.582 882.2141 52.6108 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 84.1499984264374 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Deamidated(N)@19; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.0545637011528015 4814.3115234375 803.3925 4814.2568359375 803.383422851563 6 9 1.1.1.4404.8 1 53.2023 763.6824 53.2632 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 49.5299994945526 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Dehydrated(S)@32; reduced HNE(H)@40; Carbamidomethyl(C)@41 0.0631545037031174 4799.3544921875 1200.846 4799.29345703125 1200.83068847656 4 10 1.1.1.4392.3 1 52.9176 789.1344 52.9226 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.3600005507469 IVGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@7; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 0.104953996837139 4813.37890625 1204.352 4813.27294921875 1204.32543945313 4 9 1.1.1.4409.12 1 53.3319 1252.668 53.2879 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.8100011348724 LGEHNIDVL cleaved L-E@C-term 0.00909609999507666 1008.53308105469 505.2738 1008.52398681641 505.269287109375 2 10 1.1.1.3864.3 1 40.1259 2408.851 40.0681 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.4499999284744 LGEHNIDVL cleaved L-E@C-term 0.00885196961462498 1008.53289794922 505.2737 1008.52398681641 505.269287109375 2 9 1.1.1.3856.5 1 39.9407 2421.015 39.9729 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.1700000762939 LGEHNIDVLEG cleaved G-N@C-term 0.0125756999477744 1194.60070800781 598.3076 1194.58801269531 598.301330566406 2 10 1.1.1.3856.6 1 39.944 1862.452 40.0205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGN cleaved N-E@C-term 0.0205885991454124 1308.65173339844 655.3331 1308.63098144531 655.32275390625 2 13 1.1.1.3816.4 1 38.9843 463.3569 39.0224 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGN cleaved N-E@C-term 0.0237623006105423 1308.65490722656 655.3347 1308.63098144531 655.32275390625 2 13 1.1.1.3836.8 1 39.4659 653.6901 39.4498 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGN Deamidated(N)@12 cleaved N-E@C-term 0.0207812990993261 1309.63586425781 655.8252 1309.61499023438 655.814758300781 2 13 1.1.1.3897.6 1 40.9174 363.2045 40.9018 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 50.6200015544891 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term 0.0143932001665235 1290.63488769531 646.3247 1290.62048339844 646.317504882813 2 12 1.1.1.3844.6 1 39.6548 3571.17 39.7345 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 25.2000004053116 LGEHNIDVLEGN Dehydrated(E)@10 cleaved N-E@C-term 0.0143932001665235 1290.63488769531 646.3247 1290.62048339844 646.317504882813 2 11 1.1.1.3852.9 1 39.8487 3571.17 39.7345 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQ cleaved Q-F@C-term 0.0267080999910831 1565.75891113281 783.8867 1565.73217773438 783.873352050781 2 20 1.1.1.3829.5 1 39.3024 1484.992 39.26 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQF Delta:H(4)C(2)@N-term cleaved F-I@C-term 0.0325058996677399 1740.86450195313 871.4395 1740.83190917969 871.423217773438 2 15 1.1.1.4233.8 1 49.0528 244.5426 48.9434 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0194773003458977 1939.94714355469 647.6563 1939.92761230469 647.649780273438 3 14 1.1.1.4246.5 1 49.3694 3073.626 49.5029 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0412975996732712 1939.96887207031 970.9917 1939.92761230469 970.971069335938 2 21 1.1.1.4247.10 1 49.4004 11236.8 49.4785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0412975996732712 1939.96887207031 970.9917 1939.92761230469 970.971069335938 2 22 1.1.1.4254.13 1 49.5661 11236.8 49.4785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0412975996732712 1939.96887207031 970.9917 1939.92761230469 970.971069335938 2 13 1.1.1.4261.18 1 49.7396 11578.06 49.4785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Deamidated(N)@12 cleaved N-A@C-term 0.0468638017773628 1940.95849609375 971.4865 1940.91162109375 971.463073730469 2 17 1.1.1.4266.9 1 49.8618 267.9397 49.7961 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.0362977981567383 1921.95324707031 961.9839 1921.9169921875 961.965759277344 2 20 1.1.1.4291.8 1 50.4702 4088.376 50.5765 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN cleaved N-A@C-term 0.0437049008905888 1939.97131347656 970.9929 1939.92761230469 970.971069335938 2 16 1.1.1.4278.12 1 50.157 369.4265 50.0888 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Dehydrated(E)@13 cleaved N-A@C-term 0.0362977981567383 1921.95324707031 961.9839 1921.9169921875 961.965759277344 2 17 1.1.1.4298.10 1 50.6421 4088.376 50.5765 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFIN Deamidated(N)@12 cleaved N-A@C-term 0.0424457006156445 1940.9541015625 971.4843 1940.91162109375 971.463073730469 2 13 1.1.1.4291.9 1 50.4727 2176.962 50.3095 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 LGEHNIDVLEGNEQFIN Deamidated(N)@17 cleaved N-A@C-term 0.00930036976933479 1940.9208984375 647.9809 1940.91162109375 647.977783203125 3 11 1.1.1.4283.10 1 50.2708 584.0826 50.3095 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.2700026035309 LGEHNIDVLEGNEQFINAA cleaved A-K@C-term 0.0502731986343861 2082.05126953125 1042.033 2082.00170898438 1042.00817871094 2 9 1.1.1.4304.11 1 50.7883 1967.416 50.673 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.0543788000941277 2211.13525390625 1106.575 2211.08081054688 1106.54760742188 2 18 1.1.1.4133.11 1 46.6443 2629.086 46.7475 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK HexNAc(N)@17; reduced acrolein addition +96(K)@20 0.0276287999004126 2509.26123046875 837.4277 2509.23364257813 837.418518066406 3 14 1.1.1.4136.9 1 46.7112 564.2239 46.7229 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.0307209007441998 2211.111328125 738.0444 2211.08081054688 738.0341796875 3 25 1.1.1.4140.6 1 46.8105 9451.529 46.7475 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.0543788000941277 2211.13525390625 1106.575 2211.08081054688 1106.54760742188 2 15 1.1.1.4142.15 1 46.8642 2629.086 46.7475 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17; Methyl(K)@20 0.057429701089859 2225.1533203125 1113.584 2225.09643554688 1113.55554199219 2 14 1.1.1.4144.10 1 46.9132 228.4366 46.8938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0269264001399279 2210.12353515625 737.7151 2210.0966796875 737.706176757813 3 13 1.1.1.4147.4 1 46.9749 54489.54 47.1633 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0525958016514778 2210.1494140625 1106.082 2210.0966796875 1106.0556640625 2 26 1.1.1.4148.10 1 47.011 59972.3 47.1633 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00662823999300599 2210.10327148438 553.5331 2210.0966796875 553.531494140625 4 19 1.1.1.4149.6 1 47.0229 4725.56 47.1144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.0442700982093811 2211.12524414063 738.049 2211.08081054688 738.0341796875 3 19 1.1.1.4149.10 1 47.0262 43534.22 47.1878 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(F)@15 0.0251973997801542 2226.11669921875 743.0462 2226.091796875 743.037841796875 3 25 1.1.1.4149.12 1 47.0279 2547.964 47.1144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@13 0.0327741988003254 2232.111328125 745.0444 2232.07861328125 745.033508300781 3 12 1.1.1.4149.13 1 47.0287 818.3945 47.0898 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Deamidated(N)@17 0.0145945996046066 2239.12670898438 747.3828 2239.11206054688 747.377990722656 3 16 1.1.1.4149.14 0 47.0296 404.187 47.0405 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Oxidation(N)@5 0.027131199836731 2242.11352539063 748.3785 2242.08666992188 748.369445800781 3 16 1.1.1.4149.15 1 47.0304 2039.602 47.1144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(E)@13 -0.00448202015832067 2224.10791015625 742.3766 2224.1123046875 742.378051757813 3 18 1.1.1.4150.9 0 47.05 1289.668 47.0898 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0263771004974842 2210.12329101563 737.715 2210.0966796875 737.706176757813 3 22 1.1.1.4152.8 1 47.0985 56921.16 47.2365 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:K(E)@10 0.037925198674202 2248.09057617188 750.3708 2248.052734375 750.358154296875 3 10 1.1.1.4152.9 1 47.0993 348.1315 47.1144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -9.98799991607666 2200.109375 1101.062 2210.0966796875 1106.0556640625 2 15 1.1.1.4152.18 1 47.1093 140.6717 47.1144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0263771004974842 2210.12329101563 737.715 2210.0966796875 737.706176757813 3 23 1.1.1.4153.4 1 47.1195 56921.16 47.2365 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0525958016514778 2210.1494140625 1106.082 2210.0966796875 1106.0556640625 2 23 1.1.1.4155.11 1 47.1794 59972.3 47.1633 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00760474987328053 2210.1044921875 553.5334 2210.0966796875 553.531494140625 4 18 1.1.1.4156.4 1 47.1929 4650.435 47.1878 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14 0.0442700982093811 2211.12524414063 738.049 2211.08081054688 738.0341796875 3 21 1.1.1.4156.7 1 47.1954 43534.22 47.1878 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5; Deamidated(N)@17 0.0630785003304482 2212.12768554688 738.3832 2212.06469726563 738.362182617188 3 20 1.1.1.4156.8 1 47.1962 21938.82 47.1633 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@10 0.0331403985619545 2232.11206054688 745.0446 2232.07861328125 745.033508300781 3 22 1.1.1.4156.9 1 47.197 814.1815 47.1878 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(I)@6 0.000827805022709072 2224.11352539063 742.3784 2224.1123046875 742.378051757813 3 25 1.1.1.4157.7 0 47.2264 1249.719 47.2365 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Dimethyl(N)@12; Cation:Na(E)@13 0.00621325988322496 2260.11596679688 754.3793 2260.11010742188 754.377258300781 3 15 1.1.1.4159.7 1 47.27 825.8647 47.2607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0263771004974842 2210.12329101563 737.715 2210.0966796875 737.706176757813 3 24 1.1.1.4160.7 1 47.2927 56921.16 47.2365 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(F)@15 0.0242819003760815 2226.11596679688 743.0459 2226.091796875 743.037841796875 3 18 1.1.1.4160.9 1 47.296 1846.061 47.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Hydroxymethyl(N)@12 -0.00419620983302593 2240.10302734375 747.7083 2240.107421875 747.709716796875 3 15 1.1.1.4160.10 0 47.2977 393.8165 47.3095 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0525958016514778 2210.1494140625 1106.082 2210.0966796875 1106.0556640625 2 25 1.1.1.4162.20 1 47.3534 59972.3 47.1633 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(N)@17 0.0237150005996227 2224.13623046875 742.386 2224.1123046875 742.378051757813 3 22 1.1.1.4164.13 1 47.3963 3286.365 47.6266 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.0563790015876293 2224.16943359375 1113.092 2224.1123046875 1113.0634765625 2 12 1.1.1.4167.12 1 47.4731 2244.239 47.6985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0265602003782988 2210.12329101563 737.715 2210.0966796875 737.706176757813 3 27 1.1.1.4169.10 1 47.5159 52773.47 47.2607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(N)@17 0.0480786003172398 2224.16137695313 1113.088 2224.1123046875 1113.0634765625 2 12 1.1.1.4170.18 1 47.5469 2886.846 47.7703 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.0279261991381645 2224.14038085938 742.3874 2224.1123046875 742.378051757813 3 24 1.1.1.4171.3 1 47.5586 9551.914 47.7943 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0256446991115808 2210.12231445313 737.7147 2210.0966796875 737.706176757813 3 28 1.1.1.4176.4 1 47.6817 28513.23 47.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.0229825992137194 2224.13525390625 742.3857 2224.1123046875 742.378051757813 3 27 1.1.1.4178.4 1 47.7296 13266.16 47.8423 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0250953994691372 2210.12158203125 737.7145 2210.0966796875 737.706176757813 3 23 1.1.1.4183.5 1 47.8511 12668.54 47.6026 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.0229825992137194 2224.13525390625 742.3857 2224.1123046875 742.378051757813 3 27 1.1.1.4185.3 1 47.8939 13266.16 47.8423 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)(K)@20 0.0287436004728079 2238.15698242188 747.0596 2238.12817382813 747.049987792969 3 24 1.1.1.4187.3 1 47.9484 5199.378 48.1769 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0472249016165733 2210.14331054688 1106.079 2210.0966796875 1106.0556640625 2 19 1.1.1.4188.6 1 47.9758 2067.883 47.7224 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.021433399990201 2210.1181640625 737.7133 2210.0966796875 737.706176757813 3 26 1.1.1.4190.3 1 48.0169 4016.226 47.7703 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.0229825992137194 2224.13525390625 742.3857 2224.1123046875 742.378051757813 3 27 1.1.1.4192.3 1 48.0646 13512.41 47.8183 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term 0.0243493001908064 2238.15258789063 747.0581 2238.12817382813 747.049987792969 3 28 1.1.1.4194.6 0 48.1157 6677.309 48.2246 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0482014007866383 2210.14526367188 1106.08 2210.0966796875 1106.0556640625 2 13 1.1.1.4194.11 1 48.1241 608.3657 48.1053 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.0548669993877411 2211.13525390625 1106.575 2211.08081054688 1106.54760742188 2 19 1.1.1.4196.6 1 48.1685 1187.582 48.2484 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.027292599901557 2210.1240234375 737.7153 2210.0966796875 737.706176757813 3 25 1.1.1.4197.3 1 48.1857 1664.279 48.1053 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term 0.0486886985599995 2238.17724609375 1120.096 2238.12817382813 1120.0712890625 2 22 1.1.1.4197.6 0 48.1957 1429.49 48.153 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term 0.0243493001908064 2238.15258789063 747.0581 2238.12817382813 747.049987792969 3 31 1.1.1.4201.5 1 48.2878 6677.309 48.2246 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.0548669993877411 2211.13525390625 1106.575 2211.08081054688 1106.54760742188 2 22 1.1.1.4203.5 1 48.3356 1187.582 48.2484 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@17 0.0230308007448912 2211.10375976563 738.0419 2211.08081054688 738.0341796875 3 24 1.1.1.4204.5 1 48.3594 3320.64 48.2724 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term 0.0243493001908064 2238.15258789063 747.0581 2238.12817382813 747.049987792969 3 30 1.1.1.4208.3 1 48.4583 6802.647 48.2246 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.0575525015592575 2211.13745117188 1106.576 2211.08081054688 1106.54760742188 2 17 1.1.1.4210.7 1 48.5038 827.0842 48.4394 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(Q)@14 0.0230308007448912 2211.10375976563 738.0419 2211.08081054688 738.0341796875 3 23 1.1.1.4211.5 1 48.5235 3242.298 48.2724 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Methyl(K)@20 0.0273643992841244 2252.17114257813 751.731 2252.14379882813 751.721862792969 3 29 1.1.1.4217.2 1 48.6606 965.8189 48.6791 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0302220992743969 2210.12670898438 737.7162 2210.0966796875 737.706176757813 3 26 1.1.1.4218.4 1 48.6888 599.5421 48.6791 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0247291997075081 2210.12133789063 737.7144 2210.0966796875 737.706176757813 3 25 1.1.1.4228.4 1 48.9267 737.5816 48.9918 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0247291997075081 2210.12133789063 737.7144 2210.0966796875 737.706176757813 3 24 1.1.1.4236.4 1 49.1281 737.5816 48.9918 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Deamidated(Q)@14 0.0167918000370264 2239.12866210938 747.3835 2239.11206054688 747.377990722656 3 18 1.1.1.4238.7 0 49.1761 168.1741 49.1617 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.0582849010825157 2211.13940429688 1106.577 2211.08081054688 1106.54760742188 2 14 1.1.1.4242.12 1 49.2769 408.0737 49.3324 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 1.01529002189636 2211.11206054688 738.0446 2210.0966796875 737.706176757813 3 24 1.1.1.4249.9 1 49.4391 1997.836 49.3324 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl(K)@20 0.0396659001708031 2238.13134765625 1120.073 2238.091796875 1120.05310058594 2 13 1.1.1.4249.15 1 49.4458 363.5737 49.4785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.0543788000941277 2211.13525390625 1106.575 2211.08081054688 1106.54760742188 2 17 1.1.1.4254.16 1 49.5711 1701.792 49.6494 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Ammonia-loss(N)@12 0.0256076995283365 2193.095703125 732.0392 2193.0703125 732.030700683594 3 25 1.1.1.4257.7 1 49.6393 477.8361 49.625 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(L)@9 0.0119967004284263 2224.12451171875 742.3821 2224.1123046875 742.378051757813 3 13 1.1.1.4259.8 0 49.6882 275.5388 49.6737 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.0226645991206169 2211.10327148438 738.0417 2211.08081054688 738.0341796875 3 26 1.1.1.4261.13 1 49.7355 8230.626 49.6494 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Dehydrated(D)@7 0.0285879001021385 2192.11474609375 731.7122 2192.08618164063 731.702697753906 3 19 1.1.1.4262.8 1 49.7641 379.0465 49.7228 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.014376999810338 2224.12670898438 742.3829 2224.1123046875 742.378051757813 3 15 1.1.1.4267.6 1 49.8886 172.2159 49.8936 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0280249007046223 2210.12475585938 737.7155 2210.0966796875 737.706176757813 3 22 1.1.1.4268.9 1 49.9064 340.4606 49.9181 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term 0.0168423000723124 2238.14501953125 747.0556 2238.12817382813 747.049987792969 3 15 1.1.1.4273.6 0 50.0266 1959.295 50.2603 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0252825003117323 2210.1220703125 737.7146 2210.0966796875 737.706176757813 3 22 1.1.1.4275.6 1 50.0762 395.2679 50.0155 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 0.0142603004351258 2236.12670898438 746.3828 2236.1123046875 746.378051757813 3 26 1.1.1.4275.7 1 50.0787 9667.058 50.2603 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 0.0142603004351258 2236.12670898438 746.3828 2236.1123046875 746.378051757813 3 28 1.1.1.4282.14 1 50.2494 9630.496 50.2603 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Methyl(K)@20 0.021610900759697 2250.14965820313 751.0572 2250.12817382813 751.049987792969 3 25 1.1.1.4287.6 1 50.3682 1355.003 50.432 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -1.00244998931885 2209.09448242188 737.3721 2210.0966796875 737.706176757813 3 22 1.1.1.4333.4 1 51.4918 226.0398 51.5558 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Formyl@N-term 0.0597894005477428 2238.1513671875 1120.083 2238.091796875 1120.05310058594 2 22 1.1.1.4393.10 1 52.94 1505.054 52.9949 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0258317999541759 2210.12255859375 737.7148 2210.0966796875 737.706176757813 3 15 1.1.1.4352.7 1 51.9593 223.1576 51.9018 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.0196065008640289 2210.1162109375 737.7127 2210.0966796875 737.706176757813 3 16 1.1.1.4282.12 1 50.2477 360.7349 50.2603 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK 0.00843743979930878 2210.10522460938 737.709 2210.0966796875 737.706176757813 3 18 1.1.1.4308.4 1 50.874 316.0003 50.94 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term; Delta:H(2)C(2)(H)@4 0.0189886000007391 2262.14697265625 755.0563 2262.12817382813 755.049987792969 3 21 1.1.1.4419.7 1 53.5736 1043.894 53.4882 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 0.0572027005255222 2209.12133789063 1105.568 2209.06518554688 1105.53979492188 2 21 1.1.1.4494.10 1 55.4703 1300.479 55.4545 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)(H)@4 -0.0156299006193876 2236.09692382813 560.0315 2236.1123046875 560.035400390625 4 14 1.1.1.4282.6 1 50.2427 499.3606 50.2603 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Deamidated(N)@5 0.0568713992834091 2211.13745117188 1106.576 2211.08081054688 1106.54760742188 2 14 1.1.1.4287.12 1 50.3782 354.4254 50.3832 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Oxidation(H)@4; Ammonia-loss(N)@5 0.0569586008787155 2209.12133789063 1105.568 2209.06518554688 1105.53979492188 2 17 1.1.1.4487.9 1 55.3005 1344.3 55.4053 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK -1.00244998931885 2209.09448242188 737.3721 2210.0966796875 737.706176757813 3 14 1.1.1.4340.7 1 51.6647 226.0398 51.5558 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAK Cation:Na(E)@3 0.053413100540638 2232.13134765625 1117.073 2232.07861328125 1117.04663085938 2 13 1.1.1.4450.20 1 54.3784 404.0911 54.3582 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 LGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Delta:H(2)C(2)(H)@4 0.0264877006411552 2264.16943359375 1133.092 2264.14379882813 1133.0791015625 2 10 1.1.1.4476.16 1 55.0306 383.6763 55.0398 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 LGEHNIDVLEGNEQFINAAK 0.019972700625658 2210.11669921875 737.7128 2210.0966796875 737.706176757813 3 11 1.1.1.4525.3 1 56.2183 132.5175 56.2635 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 72.1599996089935 LGEHNIDVLEGNEQFINAAK 0.0249163005501032 2210.12158203125 737.7145 2210.0966796875 737.706176757813 3 9 1.1.1.4363.5 1 52.2282 264.7317 52.2219 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.6699984073639 LGEHNIDVLEGNEQFINAAK Deamidated(N)@12 0.0252406001091003 2211.10595703125 738.0426 2211.08081054688 738.0341796875 3 10 1.1.1.4319.8 1 51.1478 180.2441 51.1387 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.4499999284744 LGEHNIDVLEGNEQFINAAK Carbamyl@N-term; Cation:Na(E)@3 0.0179363992065191 2275.10131835938 1138.558 2275.08447265625 1138.54956054688 2 12 1.1.1.4151.20 1 47.0839 369.2869 47.1144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.1700000762939 LGEHNIDVLEGNEQFINAAK Carbamidomethyl@N-term; Methyl(D)@7 -0.00814902037382126 2281.12573242188 761.3825 2281.1337890625 761.38525390625 3 13 1.1.1.4157.8 0 47.2289 457.2366 47.1388 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 LGEHNIDVLEGNEQFINAAK Methyl(K)@20 0.051911998540163 2224.16430664063 742.3954 2224.1123046875 742.378051757813 3 12 1.1.1.4142.13 1 46.8609 466.8333 46.8938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 LGEHNIDVLEGNEQFINAAK Ammonia-loss(N)@17; reduced acrolein addition +58(K)@20 -0.000951642985455692 2251.11108398438 751.3776 2251.11206054688 751.377990722656 3 11 1.1.1.4150.10 1 47.0509 349.1457 47.0898 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 LGEHNIDVLEGNEQFINAAK Phosphoadenosine(H)@4; Deamidated(N)@5 -0.00709107983857393 2540.12622070313 847.716 2540.13330078125 847.718383789063 3 12 1.1.1.4153.6 1 47.1221 303.0844 47.1144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH acrolein addition +56(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 0.00241293990984559 2888.53076171875 963.8509 2888.5283203125 963.85009765625 3 11 1.1.1.4769.4 1 62.1691 522.1399 62.2022 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 0.0420140996575356 2887.53881835938 963.5202 2887.49682617188 963.506164550781 3 11 1.1.1.4778.6 1 62.3842 569.6321 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 0.0374366007745266 2887.5341796875 963.5187 2887.49682617188 963.506164550781 3 10 1.1.1.4787.2 1 62.5935 526.5624 62.6588 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.3500022888184 LGEHNIDVLEGNEQFINAAKIITH acrolein addition +112(K)@20; Oxidation(H)@24 cleaved H-P@C-term; missed K-I@20 0.0348710007965565 2802.45361328125 935.1585 2802.41870117188 935.146911621094 3 11 1.1.1.4765.4 1 62.073 647.6877 62.1783 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.6199972629547 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 0.0491550005972385 2887.5458984375 963.5226 2887.49682617188 963.506164550781 3 10 1.1.1.4823.5 1 63.4685 153.0966 63.5325 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +62(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 0.0250124000012875 2895.52685546875 966.1829 2895.50170898438 966.174560546875 3 10 1.1.1.4742.11 1 61.498 254.3854 61.5114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 LGEHNIDVLEGNEQFINAAKIITH reduced acrolein addition +96(K)@20; Delta:H(2)C(2)(H)@24 cleaved H-P@C-term; missed K-I@20 -0.00228854990564287 2796.4423828125 933.1547 2796.44458007813 933.155517578125 3 10 1.1.1.4766.3 1 62.0886 889.0524 62.1305 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 LGEHNIDVLEGNEQFINAAKIITH hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved H-P@C-term; missed K-I@20 0.00549363996833563 2798.4658203125 933.8292 2798.46020507813 933.827392578125 3 10 1.1.1.4782.3 1 62.477 526.7381 62.4665 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.2800011634827 LGEHNIDVLEGNEQFINAAKIITH Deamidated(N)@17; MDA adduct +54(K)@20; reduced HNE(H)@24 cleaved H-P@C-term; missed K-I@20 0.0295634008944035 2887.52661132813 963.5161 2887.49682617188 963.506164550781 3 9 1.1.1.4830.5 1 63.6406 175.0842 63.6064 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.6899995803833 LGEHNIDVLEGNEQFINAAKIITHP acrolein addition +38(K)@20 cleaved P-N@C-term; missed K-I@20 0.0199196003377438 2809.4599609375 937.4939 2809.43994140625 937.487243652344 3 8 1.1.1.4770.7 1 62.1946 412.7251 62.1544 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPN Delta:H(4)C(2)(H)@24 cleaved N-F@C-term; missed K-I@20 0.00496427016332746 2913.50341796875 729.3831 2913.49853515625 729.381896972656 4 16 1.1.1.4448.3 1 54.3121 477.1069 54.3322 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 LGEHNIDVLEGNEQFINAAKIITHPN acrolein addition +112(K)@20; reduced HNE(H)@24; Deamidated(N)@26 cleaved N-F@C-term; missed K-I@20 -0.00468137999996543 3156.62963867188 790.1647 3156.63427734375 790.165832519531 4 12 1.1.1.4537.2 1 56.5195 4855.785 56.6875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.6799972057343 LGEHNIDVLEGNEQFINAAKIITHPN MDA adduct +62(K)@20 cleaved N-F@C-term; missed K-I@20 0.0259824991226196 2947.5087890625 983.5102 2947.48291015625 983.501525878906 3 9 1.1.1.4821.5 1 63.4263 149.1214 63.4347 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.9300001859665 LGEHNIDVLEGNEQFINAAKIITHPN MDA adduct +62(K)@20 cleaved N-F@C-term; missed K-I@20 0.0142641002312303 2947.4970703125 983.5063 2947.48291015625 983.501525878906 3 8 1.1.1.4829.9 1 63.6161 152.0766 63.5817 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 20.890000462532 LGEHNIDVLEGNEQFINAAKIITHPN MDA adduct +62(K)@20 cleaved N-F@C-term; missed K-I@20 0.0301399007439613 2947.51293945313 737.8855 2947.48291015625 737.877990722656 4 8 1.1.1.4454.4 1 54.4684 2130.623 54.5637 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF HPNE addition +172(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@26 cleaved F-N@C-term; missed K-I@20 0.0201492998749018 3231.66528320313 808.9236 3231.64526367188 808.918579101563 4 17 1.1.1.4523.6 1 56.1699 496.2142 56.1875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 0.038222398608923 3156.66235351563 1053.228 3156.62451171875 1053.21545410156 3 15 1.1.1.4548.7 1 56.7986 2244.151 56.7121 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 LGEHNIDVLEGNEQFINAAKIITHPNF hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24 cleaved F-N@C-term; missed K-I@20 0.038222398608923 3156.66235351563 1053.228 3156.62451171875 1053.21545410156 3 12 1.1.1.4539.6 1 56.5792 2244.151 56.7121 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.6199994087219 LGEHNIDVLEGNEQFINAAKIITHPNF ONE addition +154(K)@20; reduced HNE(H)@24; Deamidated(N)@26 cleaved F-N@C-term; missed K-I@20 -0.00392097979784012 3345.74609375 1116.256 3345.74975585938 1116.25720214844 3 11 1.1.1.4501.13 1 55.6424 980.4159 55.6737 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 0.021942799910903 3175.61572265625 794.9112 3175.59375 794.90576171875 4 23 1.1.1.4543.2 1 56.6665 6748.146 56.5893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFN ONE addition +154(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@28 cleaved N-G@C-term; missed K-I@20 0.0296561997383833 3327.70727539063 832.9341 3327.67749023438 832.926635742188 4 15 1.1.1.4505.4 1 55.7325 2418.228 55.7468 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 LGEHNIDVLEGNEQFINAAKIITHPNFN Methyl(E)@13 cleaved N-G@C-term; missed K-I@20 0.0448339991271496 3160.63940429688 791.1671 3160.59423828125 791.155822753906 4 12 1.1.1.4527.5 1 56.2707 196.0397 56.2891 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20 cleaved N-T@C-term; missed K-I@20 0.0345936007797718 3345.70849609375 837.4344 3345.67431640625 837.425842285156 4 17 1.1.1.4497.6 1 55.534 2445.902 55.6737 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20; Deamidated(N)@30 cleaved N-T@C-term; missed K-I@20 0.0405345000326633 3346.69848632813 837.6819 3346.658203125 837.671813964844 4 16 1.1.1.4525.9 1 56.2233 1632.05 56.2383 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 LGEHNIDVLEGNEQFINAAKIITHPNFNGN Delta:H(4)C(2)(K)@20; Deamidated(N)@28 cleaved N-T@C-term; missed K-I@20 0.0405345000326633 3346.69848632813 837.6819 3346.658203125 837.671813964844 4 13 1.1.1.4522.6 1 56.1446 1632.05 56.2383 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.6199972629547 LGEHNIDVLEGNEQFINAAKIITHPNFNGNT hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@30 cleaved T-L@C-term; missed K-I@20 -0.003211610019207 3675.87524414063 919.9761 3675.87841796875 919.976867675781 4 10 1.1.1.4591.3 1 57.8433 910.927 57.8878 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24 missed K-I@20 0.064630500972271 4502.35498046875 901.4783 4502.29052734375 901.46533203125 5 25 1.1.1.4713.8 1 60.7716 3983.998 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24; Deamidated(N)@28 missed K-I@20 0.0550087988376617 4503.32958984375 901.6732 4503.2744140625 901.662170410156 5 27 1.1.1.4723.9 1 61.0302 1174.41 61.0452 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20 0.0548776984214783 4516.357421875 904.2788 4516.302734375 904.267822265625 5 19 1.1.1.4716.10 1 60.8526 738.042 60.8408 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24 missed K-I@20 0.00692088017240167 4502.296875 751.3901 4502.29052734375 751.389038085938 6 17 1.1.1.4715.8 1 60.8249 473.9426 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24; Deamidated(N)@28 missed K-I@20 0.0608089007437229 4489.31982421875 898.8712 4489.2587890625 898.859008789063 5 16 1.1.1.4722.5 1 61.0021 935.9556 61.0205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Delta:H(4)C(2)(H)@24; Deamidated(N)@28 missed K-I@20 0.109227001667023 4503.3828125 1126.853 4503.2744140625 1126.82592773438 4 16 1.1.1.4723.16 1 61.0402 491.8875 61.0452 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24 missed K-I@20 0.0202600993216038 4488.29541015625 749.0565 4488.27490234375 749.053039550781 6 13 1.1.1.4714.6 1 60.7963 332.4916 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.2999980449677 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24 missed K-I@20 0.103982001543045 4488.37890625 1123.102 4488.27490234375 1123.07592773438 4 12 1.1.1.4713.17 1 60.7791 1547.645 60.8139 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Methyl(H)@24; Deamidated(N)@34 missed K-I@20 0.0872220024466515 4489.3466796875 1123.344 4489.2587890625 1123.32202148438 4 10 1.1.1.4722.14 1 61.0096 358.6449 61.0205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK Formyl(K)@20; Deamidated(N)@30 missed K-I@20 0.0436309017241001 4503.28173828125 751.5542 4503.23779296875 751.546936035156 6 11 1.1.1.4723.2 1 61.0243 135.2884 61.0452 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.940000295639 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIK acrolein addition +112(K)@20; HexNAc(N)@34; acrolein addition +38(K)@40 missed K-I@20 -0.0530119016766548 4827.353515625 966.478 4827.40673828125 966.488586425781 5 11 1.1.1.4452.13 1 54.4243 4533.816 54.3582 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.9800003767014 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPA reduced acrolein addition +96(K)@20; reduced HNE(H)@24; acrolein addition +112(K)@40 cleaved A-T@C-term; missed K-I@20; missed K-L@40 0.0921223014593124 5295.82861328125 1060.173 5295.73779296875 1060.15478515625 5 10 1.1.1.4921.4 1 65.9071 1955.582 65.965 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.1500006914139 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPA hexanoyl addition +98(K)@20; HPNE addition +172(K)@40 cleaved A-T@C-term; missed K-I@20; missed K-L@40 0.0718012005090714 5199.751953125 867.6326 5199.68017578125 867.620666503906 6 9 1.1.1.4941.3 1 66.3528 362.8891 66.3115 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL acrolein addition +56(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.143869996070862 5199.798828125 1040.967 5199.6552734375 1040.93823242188 5 12 1.1.1.4937.4 1 66.2536 1221.288 66.3375 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL acrolein addition +56(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.0969533026218414 5199.751953125 867.6326 5199.6552734375 867.616455078125 6 11 1.1.1.4941.3 1 66.3528 362.8891 66.3115 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.3800022602081 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL MDA adduct +54(K)@20; hexanoyl addition +98(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.0812627002596855 5295.7939453125 883.6396 5295.71240234375 883.626037597656 6 11 1.1.1.4922.6 1 65.9301 562.0223 65.965 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.1300022602081 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL hexanoyl addition +98(K)@20; reduced HNE(H)@24; HPNE addition +172(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.0230564996600151 5571.9638671875 1115.4 5571.94287109375 1115.39575195313 5 10 1.1.1.4786.4 1 62.5811 1698.473 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.2700026035309 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATL hexanoyl addition +98(K)@20; reduced HNE(H)@24; HPNE addition +172(K)@40 cleaved L-N@C-term; missed K-I@20; missed K-L@40 0.0230564996600151 5571.9638671875 1115.4 5571.94287109375 1115.39575195313 5 10 1.1.1.4795.5 1 62.7977 1159.194 62.7788 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN Carbamyl(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0853315964341164 5556.96875 1112.401 5556.88134765625 1112.38354492188 5 21 1.1.1.4773.7 1 62.269 60009.02 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +94(K)@20; reduced HNE(H)@24; Dethiomethyl(M)@37; reduced acrolein addition +96(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0704677030444145 5557.96826171875 1112.601 5557.8984375 1112.5869140625 5 18 1.1.1.4843.4 1 63.968 29456.58 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +56(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.144603997468948 5313.84375 1063.776 5313.69775390625 1063.74682617188 5 17 1.1.1.4897.5 1 65.3011 1408.889 65.3319 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +94(K)@20; reduced HNE(H)@24; Dethiomethyl(M)@37; reduced acrolein addition +96(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0692469999194145 5557.96826171875 1112.601 5557.8984375 1112.5869140625 5 17 1.1.1.4857.6 1 64.3063 23004.74 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN hexanoyl addition +98(K)@20; reduced HNE(H)@24; Formyl(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0753308981657028 5541.943359375 1109.396 5541.87060546875 1109.38134765625 5 14 1.1.1.4778.7 1 62.3867 5200.246 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN Deamidated(N)@34; acrolein addition +56(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.149937003850937 5314.83349609375 1063.974 5314.68212890625 1063.94372558594 5 14 1.1.1.4926.4 1 66.0342 419.5023 65.9913 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +56(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.144603997468948 5313.84375 1063.776 5313.69775390625 1063.74682617188 5 13 1.1.1.4904.5 1 65.4736 1408.889 65.3319 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.869998216629 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN HPNE addition +172(K)@20; hexanoyl addition +98(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.096051000058651 5527.94873046875 1106.597 5527.85498046875 1106.57824707031 5 16 1.1.1.4759.3 1 61.9271 2200.101 61.9141 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.2700026035309 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Oxidation(M)@37 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0856754034757614 5527.9384765625 1106.595 5527.85498046875 1106.57824707031 5 13 1.1.1.4773.6 1 62.2656 1904.641 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.2800011634827 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN reduced acrolein addition +58(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0469878986477852 5571.9638671875 1115.4 5571.91748046875 1115.39074707031 5 10 1.1.1.4764.4 1 62.0533 2379.282 62.0345 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.2800011634827 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN acrolein addition +56(K)@20; reduced HNE(H)@24; Oxidation(M)@37; acrolein addition +56(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0955165028572083 5543.94384765625 1109.796 5543.849609375 1109.77722167969 5 12 1.1.1.4850.4 1 64.1328 3532.844 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 72.1000015735626 LGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLN reduced HNE(H)@24; acrolein addition +112(K)@40 cleaved N-S@C-term; missed K-I@20; missed K-L@40 0.0856754034757614 5527.9384765625 1106.595 5527.85498046875 1106.57824707031 5 10 1.1.1.4793.6 1 62.7497 1332.638 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0777157992124558 5672.9921875 946.506 5672.9150390625 946.493103027344 6 21 1.1.1.4904.4 1 65.4711 1447.169 65.3832 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0575612001121044 5557.869140625 794.9886 5557.8115234375 794.980407714844 7 23 1.1.1.4708.4 1 60.6365 889.5251 60.6549 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0536151006817818 5556.91748046875 927.1602 5556.8642578125 927.151306152344 6 29 1.1.1.4714.15 1 60.8038 6135.466 60.8668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0251697991043329 5556.89306640625 794.8491 5556.86767578125 794.845520019531 7 28 1.1.1.4715.10 1 60.8266 1679.85 60.8668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0683479011058807 5544.89990234375 925.1572 5544.8310546875 925.145812988281 6 23 1.1.1.4719.6 1 60.9272 4587.764 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0488545000553131 5556.9130859375 927.1594 5556.8642578125 927.151306152344 6 26 1.1.1.4728.4 1 61.1525 4833.339 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0812577977776527 5572.9189453125 929.8271 5572.837890625 929.813598632813 6 24 1.1.1.4732.5 1 61.2542 1890.43 61.2426 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0638687014579773 5556.927734375 927.1619 5556.8642578125 927.151306152344 6 33 1.1.1.4735.8 1 61.3294 70884.43 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24 missed K-I@20; missed K-L@40 0.060004498809576 5528.896484375 922.49 5528.83642578125 922.47998046875 6 26 1.1.1.4737.3 1 61.3773 39504.22 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20 missed K-I@20; missed K-L@40 0.10895299911499 5528.94384765625 1106.796 5528.83642578125 1106.77453613281 5 27 1.1.1.4738.11 1 61.4042 20154.36 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(N)@17 missed K-I@20; missed K-L@40 0.0597584992647171 5514.88037109375 920.154 5514.8203125 920.14404296875 6 34 1.1.1.4739.6 1 61.4196 12833.02 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24 missed K-I@20; missed K-L@40 0.100988000631332 5514.92333984375 1103.992 5514.8203125 1103.97143554688 5 27 1.1.1.4739.17 1 61.4287 5633.478 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24 missed K-I@20; missed K-L@40 0.0185650996863842 5528.85498046875 790.8437 5528.83642578125 790.841003417969 7 29 1.1.1.4740.3 1 61.4417 7267.503 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0616843998432159 5541.8818359375 792.7047 5541.8203125 792.695861816406 7 24 1.1.1.4740.4 1 61.4426 3170.802 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24 missed K-I@20; missed K-L@40 0.060004498809576 5528.896484375 922.49 5528.83642578125 922.47998046875 6 23 1.1.1.4740.6 1 61.4442 39504.22 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@26; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0903315022587776 5541.9111328125 924.6591 5541.8203125 924.643981933594 6 25 1.1.1.4740.7 1 61.4451 17664.28 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0563913993537426 5572.9189453125 929.8271 5572.8623046875 929.817687988281 6 22 1.1.1.4740.8 1 61.4459 6583.421 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(D)@33 missed K-I@20; missed K-L@40 0.0206039007753134 5514.8408203125 788.8417 5514.8203125 788.838806152344 7 25 1.1.1.4741.3 1 61.4664 1953.524 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0504471994936466 5556.88134765625 794.8475 5556.8310546875 794.840270996094 7 30 1.1.1.4741.4 1 61.4672 25138.96 61.6576 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0620376989245415 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 37 1.1.1.4742.2 1 61.4905 118297.1 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0220807995647192 5542.87353515625 792.8464 5542.85205078125 792.84326171875 7 32 1.1.1.4743.3 1 61.516 5704.333 61.5114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0443919003009796 5781.05322265625 964.5161 5781.0087890625 964.508728027344 6 27 1.1.1.4743.11 1 61.5227 466.1315 61.5852 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.060004498809576 5528.896484375 922.49 5528.83642578125 922.47998046875 6 37 1.1.1.4744.6 1 61.5431 39504.22 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0639240965247154 5587.92626953125 932.3283 5587.8623046875 932.317626953125 6 26 1.1.1.4745.3 1 61.5676 2097.023 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.10895299911499 5528.94384765625 1106.796 5528.83642578125 1106.77453613281 5 31 1.1.1.4745.6 1 61.5751 20154.36 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.101049996912479 5542.95361328125 1109.598 5542.85205078125 1109.57763671875 5 23 1.1.1.4746.9 1 61.6044 16426.45 61.5114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0617158003151417 5542.91357421875 924.8262 5542.85205078125 924.81591796875 6 35 1.1.1.4747.3 1 61.6201 32254.7 61.5114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0720176994800568 5571.9111328125 929.6591 5571.8388671875 929.647033691406 6 26 1.1.1.4747.4 1 61.6243 5044.093 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0174326002597809 5556.88134765625 794.8475 5556.8642578125 794.845031738281 7 31 1.1.1.4748.2 1 61.64 25435.2 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0617158003151417 5542.91357421875 924.8262 5542.85205078125 924.81591796875 6 26 1.1.1.4748.3 1 61.6442 32254.7 61.5114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Phospho(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.05980009958148 5608.8623046875 935.8177 5608.802734375 935.807678222656 6 27 1.1.1.4748.5 1 61.6525 991.2899 61.6335 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0620376989245415 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 39 1.1.1.4749.2 1 61.6682 123559.4 61.7302 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0473031997680664 5572.88525390625 797.1337 5572.837890625 797.126953125 7 25 1.1.1.4750.2 1 61.6878 1926.13 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0567087009549141 5528.892578125 922.4894 5528.83642578125 922.47998046875 6 33 1.1.1.4751.2 1 61.7118 6679.13 61.7302 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0808916017413139 5572.9189453125 929.8271 5572.837890625 929.813598632813 6 23 1.1.1.4752.3 1 61.7357 7615.854 61.7545 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0518395006656647 5587.9140625 932.3263 5587.8623046875 932.317626953125 6 23 1.1.1.4752.5 1 61.7391 2346.917 61.7545 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.108341999351978 5528.94384765625 1106.796 5528.83642578125 1106.77453613281 5 25 1.1.1.4752.8 1 61.7466 3575.344 61.7302 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0503636002540588 5542.90185546875 924.8243 5542.85205078125 924.81591796875 6 38 1.1.1.4754.3 1 61.7892 13341.71 61.7302 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0808916017413139 5572.9189453125 929.8271 5572.837890625 929.813598632813 6 23 1.1.1.4754.4 1 61.7934 7615.854 61.7545 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Oxidation(P)@25; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0240221992135048 5601.865234375 934.6515 5601.84130859375 934.647521972656 6 25 1.1.1.4754.5 1 61.7976 949.3749 61.7545 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0157706998288631 5556.88330078125 794.8477 5556.86767578125 794.845520019531 7 35 1.1.1.4755.2 1 61.809 25843.03 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.051095999777317 5542.9033203125 924.8245 5542.85205078125 924.81591796875 6 28 1.1.1.4755.3 1 61.8131 12870.87 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0620376989245415 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 39 1.1.1.4756.2 1 61.8455 129186.3 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +76(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0533921010792255 5605.9052734375 935.3248 5605.8515625 935.315856933594 6 25 1.1.1.4757.4 1 61.8783 1011.264 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0493846982717514 5528.8857421875 922.4882 5528.83642578125 922.47998046875 6 31 1.1.1.4758.2 1 61.8957 5895.508 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0473031997680664 5572.88525390625 797.1337 5572.837890625 797.126953125 7 24 1.1.1.4760.3 1 61.9451 1926.13 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.051095999777317 5542.9033203125 924.8245 5542.85205078125 924.81591796875 6 37 1.1.1.4761.2 1 61.9691 12870.87 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0695393979549408 5572.90771484375 929.8252 5572.837890625 929.813598632813 6 24 1.1.1.4761.3 1 61.9732 7389.646 62.1065 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamidomethyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0751200020313263 5585.93310546875 931.9961 5585.85791015625 931.983581542969 6 24 1.1.1.4761.4 1 61.9774 2640.15 62.1305 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0157706998288631 5556.88330078125 794.8477 5556.86767578125 794.845520019531 7 34 1.1.1.4762.2 1 61.9921 25843.03 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.051095999777317 5542.9033203125 924.8245 5542.85205078125 924.81591796875 6 30 1.1.1.4762.3 1 61.9955 12870.87 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0664874985814095 5587.92822265625 932.3287 5587.8623046875 932.317626953125 6 24 1.1.1.4762.4 1 61.9988 2617.384 62.1065 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0620376989245415 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 39 1.1.1.4763.2 1 62.0177 129186.3 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0486522987484932 5528.884765625 922.4881 5528.83642578125 922.47998046875 6 31 1.1.1.4765.2 1 62.0647 4976.577 62.0822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0991875007748604 5528.93310546875 1106.794 5528.83642578125 1106.77453613281 5 24 1.1.1.4765.5 1 62.0772 3233.475 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.072750099003315 5571.91162109375 929.6592 5571.8388671875 929.647033691406 6 24 1.1.1.4768.3 1 62.141 5062.442 62.1065 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0412588007748127 5586.91943359375 932.1605 5586.8779296875 932.153625488281 6 27 1.1.1.4768.4 1 62.1452 2858.569 62.1305 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0808103010058403 5541.9013671875 924.6575 5541.8203125 924.643981933594 6 27 1.1.1.4769.2 1 62.1608 10247.93 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0529269985854626 5542.9052734375 924.8248 5542.85205078125 924.81591796875 6 29 1.1.1.4769.3 1 62.1649 10337.13 62.0822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0119255995377898 5556.8798828125 794.8472 5556.86767578125 794.845520019531 7 39 1.1.1.4770.3 1 62.1846 24342.78 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0616714991629124 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 38 1.1.1.4770.4 1 62.1871 110729 62.1065 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.123796999454498 5583.95458984375 931.6664 5583.83056640625 931.645751953125 6 23 1.1.1.4770.5 1 62.1896 2207.049 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.050483301281929 5528.88671875 922.4884 5528.83642578125 922.47998046875 6 30 1.1.1.4772.3 1 62.235 4757.003 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0516268983483315 5592.91943359375 933.1605 5592.86767578125 933.15185546875 6 26 1.1.1.4773.3 1 62.2573 1170.685 62.1065 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0804324001073837 5544.91162109375 925.1592 5544.8310546875 925.145812988281 6 24 1.1.1.4774.3 1 62.2834 4624.394 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0233134999871254 5609.8701171875 935.9856 5609.8466796875 935.981689453125 6 26 1.1.1.4774.4 1 62.2867 1158.234 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0233134999871254 5609.8701171875 935.9856 5609.8466796875 935.981689453125 6 24 1.1.1.4774.5 1 62.2901 1158.234 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0447869002819061 5572.88623046875 797.1339 5572.84130859375 797.12744140625 7 27 1.1.1.4776.2 1 62.3272 1488.569 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0808103010058403 5541.9013671875 924.6575 5541.8203125 924.643981933594 6 24 1.1.1.4776.3 1 62.3297 10247.93 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0790605992078781 5572.9169921875 929.8268 5572.837890625 929.813598632813 6 23 1.1.1.4776.5 1 62.3347 7354.306 62.1305 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0152963995933533 5556.8798828125 794.8472 5556.8642578125 794.845031738281 7 31 1.1.1.4777.2 1 62.3519 24342.78 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0627700984477997 5556.92626953125 927.1617 5556.8642578125 927.151306152344 6 37 1.1.1.4777.4 1 62.3586 115344.4 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.123796999454498 5583.95458984375 931.6664 5583.83056640625 931.645751953125 6 24 1.1.1.4777.5 1 62.3619 2207.049 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0808103010058403 5541.9013671875 924.6575 5541.8203125 924.643981933594 6 23 1.1.1.4778.4 1 62.3792 10247.93 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.106510996818542 5528.94384765625 1106.796 5528.83642578125 1106.77453613281 5 23 1.1.1.4780.3 1 62.431 2468.64 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0493846982717514 5528.8857421875 922.4882 5528.83642578125 922.47998046875 6 32 1.1.1.4781.3 1 62.4556 3204.076 62.4665 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0827225968241692 5572.9208984375 929.8274 5572.837890625 929.813598632813 6 23 1.1.1.4782.2 1 62.4728 4338.782 62.4426 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 -0.00970117002725601 5609.8701171875 935.9856 5609.87939453125 935.987182617188 6 24 1.1.1.4782.4 1 62.4812 1158.234 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0713704004883766 5572.9091796875 929.8255 5572.837890625 929.813598632813 6 24 1.1.1.4783.6 1 62.5043 5075.755 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0136345000937581 5556.880859375 794.8474 5556.86767578125 794.845520019531 7 35 1.1.1.4784.2 1 62.5199 16546.14 62.4665 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0620376989245415 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 40 1.1.1.4784.3 1 62.5232 116355.2 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0900544002652168 5584.95263671875 931.8327 5584.8623046875 931.817687988281 6 23 1.1.1.4784.4 1 62.5265 1879.022 62.4904 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0838036984205246 5599.9091796875 934.3255 5599.82568359375 934.311584472656 6 24 1.1.1.4784.5 1 62.5299 1053.329 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0492650009691715 5542.90185546875 924.8242 5542.85205078125 924.81591796875 6 32 1.1.1.4789.3 1 62.642 7826.622 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(T)@31; Carbamidomethyl(K)@40 missed K-I@20; missed K-L@40 0.0744287967681885 5539.89013671875 924.3223 5539.81591796875 924.309936523438 6 23 1.1.1.4790.2 1 62.6644 4602.006 62.6588 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0170053001493216 5556.880859375 794.8474 5556.8642578125 794.845031738281 7 34 1.1.1.4791.3 1 62.6934 17740.44 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0620376989245415 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 34 1.1.1.4791.4 1 62.6976 82076.82 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0548976995050907 5607.8857421875 935.6549 5607.83056640625 935.645751953125 6 25 1.1.1.4796.4 1 62.8152 710.3035 62.8269 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0779198035597801 5540.9140625 924.493 5540.83642578125 924.47998046875 6 23 1.1.1.4797.2 1 62.8324 5952.581 62.7788 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0801592022180557 5572.91845703125 929.827 5572.837890625 929.813598632813 6 24 1.1.1.4797.3 1 62.8357 5141.178 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0747651979327202 5582.92138671875 931.4942 5582.8466796875 931.481750488281 6 23 1.1.1.4797.4 1 62.8391 1463.474 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0616714991629124 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 34 1.1.1.4798.4 1 62.8697 72528.84 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0161508992314339 5556.8798828125 794.8473 5556.8642578125 794.845031738281 7 30 1.1.1.4799.2 1 62.8857 14228.66 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0870857983827591 5585.93359375 931.9962 5585.8466796875 931.981689453125 6 24 1.1.1.4799.4 1 62.8941 1937.255 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0616714991629124 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 23 1.1.1.4800.5 1 62.9123 72528.84 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@26; Deamidated(N)@28; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0759695991873741 5588.92236328125 932.4943 5588.84619140625 932.481628417969 6 26 1.1.1.4801.2 1 62.9346 1293.835 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0983292981982231 5540.93359375 1109.194 5540.83642578125 1109.17456054688 5 23 1.1.1.4801.3 1 62.9405 2866.609 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0446241982281208 5528.880859375 922.4874 5528.83642578125 922.47998046875 6 34 1.1.1.4802.4 1 62.9641 2298.688 62.9273 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0745811015367508 5571.9130859375 929.6595 5571.8388671875 929.647033691406 6 24 1.1.1.4803.3 1 62.9848 2787.99 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0411815010011196 5602.9140625 934.8263 5602.873046875 934.819458007813 6 24 1.1.1.4803.4 1 62.9881 561.0786 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0529269985854626 5542.9052734375 924.8248 5542.85205078125 924.81591796875 6 29 1.1.1.4804.3 1 63.0054 6738.806 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0225811004638672 5609.869140625 935.9855 5609.8466796875 935.981689453125 6 27 1.1.1.4804.6 1 63.0113 885.6316 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0616714991629124 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 34 1.1.1.4805.3 1 63.0344 72528.84 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0801592022180557 5572.91845703125 929.827 5572.837890625 929.813598632813 6 26 1.1.1.4805.4 1 63.0386 3323.137 62.8269 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +38(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0237566996365786 5593.87548828125 933.3198 5593.8515625 933.315856933594 6 23 1.1.1.4806.3 1 63.0609 497.4803 63.0238 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0161508992314339 5556.8798828125 794.8473 5556.8642578125 794.845031738281 7 32 1.1.1.4807.3 1 63.0785 14078.14 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0616714991629124 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 25 1.1.1.4807.4 1 63.081 72528.84 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0581735000014305 5528.89453125 922.4897 5528.83642578125 922.47998046875 6 25 1.1.1.4809.5 1 63.132 1938.184 63.0961 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0492650009691715 5542.90185546875 924.8242 5542.85205078125 924.81591796875 6 26 1.1.1.4812.2 1 63.2001 5168.663 63.0961 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0620376989245415 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 26 1.1.1.4812.3 1 63.2059 58761.55 62.9519 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0616714991629124 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 28 1.1.1.4814.3 1 63.25 54288.62 62.9999 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0149162001907825 5556.88232421875 794.8476 5556.86767578125 794.845520019531 7 29 1.1.1.4815.3 1 63.2692 11190.45 63.0238 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Oxidation(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0536323003470898 5602.9267578125 934.8284 5602.873046875 934.819458007813 6 24 1.1.1.4817.4 1 63.3261 370.0524 63.3136 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.065166100859642 5626.97509765625 938.8364 5626.9091796875 938.825500488281 6 24 1.1.1.4817.5 1 63.3294 459.8902 63.3136 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0915113985538483 5572.9296875 929.8289 5572.837890625 929.813598632813 6 24 1.1.1.4818.4 1 63.347 1762.268 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.060206700116396 5556.92431640625 927.1613 5556.8642578125 927.151306152344 6 27 1.1.1.4819.3 1 63.3753 43644.11 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0513016991317272 5556.88232421875 794.8476 5556.8310546875 794.840270996094 7 30 1.1.1.4823.2 1 63.4635 6593.049 63.2168 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0482860989868641 5528.88427734375 922.488 5528.83642578125 922.47998046875 6 26 1.1.1.4823.3 1 63.4652 2250.58 63.6311 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +96(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0773027017712593 5625.95458984375 938.6664 5625.8779296875 938.653564453125 6 25 1.1.1.4824.3 1 63.497 440.0068 63.5079 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0827225968241692 5572.9208984375 929.8274 5572.837890625 929.813598632813 6 23 1.1.1.4825.5 1 63.5141 1305.836 63.5325 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0343415997922421 5541.8544921875 792.7008 5541.8203125 792.695861816406 7 23 1.1.1.4827.2 1 63.5616 663.7371 63.5325 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.0680216997861862 5529.88818359375 922.6553 5529.8203125 922.643981933594 6 28 1.1.1.4827.4 1 63.5649 8975.081 63.7539 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0617158003151417 5542.91357421875 924.8262 5542.85205078125 924.81591796875 6 27 1.1.1.4829.4 1 63.6119 3895.273 63.5817 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0859872028231621 5585.93212890625 931.996 5585.8466796875 931.981689453125 6 23 1.1.1.4830.3 1 63.6373 1044.771 63.7049 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.056743498891592 5626.96630859375 938.835 5626.9091796875 938.825500488281 6 27 1.1.1.4831.5 1 63.6676 805.0101 63.7049 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Methyl(I)@36 missed K-I@20; missed K-L@40 0.0633812993764877 5515.8681640625 920.3186 5515.8046875 920.308044433594 6 26 1.1.1.4832.4 1 63.6856 1482.923 63.6557 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0877681002020836 5541.908203125 924.6586 5541.8203125 924.643981933594 6 25 1.1.1.4832.5 1 63.6864 3035.276 63.7049 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Formyl(K)@20 missed K-I@20; missed K-L@40 0.0702288970351219 5529.8544921875 790.9865 5529.78369140625 790.976379394531 7 22 1.1.1.4833.2 1 63.7094 1389.353 63.7539 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.000923339975997806 5610.87841796875 936.1537 5610.8779296875 936.153625488281 6 24 1.1.1.4833.5 1 63.7144 505.8027 63.6557 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0680216997861862 5529.88818359375 922.6553 5529.8203125 922.643981933594 6 22 1.1.1.4834.4 1 63.7372 8970.656 63.7539 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0680216997861862 5529.88818359375 922.6553 5529.8203125 922.643981933594 6 28 1.1.1.4834.5 1 63.7388 8970.656 63.7539 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; hexanoyl addition +98(K)@20; Oxidation(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0987415015697479 5643.9873046875 941.6718 5643.88818359375 941.655334472656 6 26 1.1.1.4836.4 1 63.7865 555.2666 63.6801 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.072835199534893 5573.89501953125 797.278 5573.82177734375 797.267578125 7 23 1.1.1.4837.4 1 63.8085 717.8622 63.8032 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0698361024260521 5600.92724609375 934.4951 5600.857421875 934.483520507813 6 23 1.1.1.4837.6 1 63.811 533.2241 63.8032 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0604659989476204 5782.05322265625 964.6828 5781.99267578125 964.672729492188 6 23 1.1.1.4837.8 1 63.8143 303.0825 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0742309987545013 5757.04638671875 960.515 5756.97216796875 960.502685546875 6 23 1.1.1.4838.8 1 63.8364 285.5702 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@23; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0849198028445244 5572.92333984375 929.8278 5572.837890625 929.813598632813 6 23 1.1.1.4840.5 1 63.8859 2361.595 63.901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0105355000123382 5608.87353515625 935.8195 5608.8623046875 935.817687988281 6 23 1.1.1.4840.7 1 63.8893 521.8259 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0680216997861862 5529.88818359375 922.6553 5529.8203125 922.643981933594 6 29 1.1.1.4841.3 1 63.9101 8970.656 63.7539 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0725679993629456 5582.9189453125 931.4938 5582.8466796875 931.481750488281 6 22 1.1.1.4846.4 1 64.0315 901.2064 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0665569007396698 5529.88671875 922.6551 5529.8203125 922.643981933594 6 25 1.1.1.4848.3 1 64.0789 1192.036 64.0216 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.039011400192976 5542.890625 924.8224 5542.85205078125 924.81591796875 6 27 1.1.1.4848.4 1 64.0822 2471.211 64.0698 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0650115981698036 5542.9169921875 924.8268 5542.85205078125 924.81591796875 6 24 1.1.1.4856.3 1 64.2739 1744.018 64.191 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0963319018483162 5583.92724609375 931.6618 5583.83056640625 931.645751953125 6 23 1.1.1.4856.4 1 64.2781 700.4391 64.2152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.112116999924183 5582.958984375 931.5004 5582.8466796875 931.481750488281 6 23 1.1.1.4863.3 1 64.453 16984.57 64.6856 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0620376989245415 5556.92626953125 927.1616 5556.8642578125 927.151306152344 6 25 1.1.1.4868.4 1 64.5734 4627.677 64.5078 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0627700984477997 5556.92626953125 927.1617 5556.8642578125 927.151306152344 6 31 1.1.1.4875.4 1 64.7428 4788.814 64.4826 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Oxidation(H)@24; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.112269997596741 5672.990234375 946.5057 5672.87841796875 946.486999511719 6 27 1.1.1.4876.4 1 64.7699 1257.25 64.9575 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; Oxidation(H)@24; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.112269997596741 5672.990234375 946.5057 5672.87841796875 946.486999511719 6 26 1.1.1.4883.6 1 64.9491 1262.924 64.9575 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0748545974493027 5556.939453125 927.1638 5556.8642578125 927.151306152344 6 27 1.1.1.4884.4 1 64.9691 1639.775 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0664321035146713 5556.9306640625 927.1624 5556.8642578125 927.151306152344 6 26 1.1.1.4892.4 1 65.1814 1209.209 64.9075 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0715589001774788 5556.935546875 927.1632 5556.8642578125 927.151306152344 6 30 1.1.1.4900.3 1 65.3723 1072.189 65.4344 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0715589001774788 5556.935546875 927.1632 5556.8642578125 927.151306152344 6 26 1.1.1.4908.6 1 65.5811 1072.189 65.4344 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0759532004594803 5556.939453125 927.1639 5556.8642578125 927.151306152344 6 27 1.1.1.4916.2 1 65.7751 713.9736 65.6756 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0748545974493027 5556.939453125 927.1638 5556.8642578125 927.151306152344 6 28 1.1.1.4925.2 1 66.0123 521.5665 66.0772 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0763193964958191 5556.9404296875 927.164 5556.8642578125 927.151306152344 6 28 1.1.1.4933.3 1 66.1793 622.5905 66.198 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0921410992741585 5608.98828125 935.8386 5608.8955078125 935.823181152344 6 24 1.1.1.4938.3 1 66.2719 2789.932 66.3638 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0781503990292549 5556.9423828125 927.1643 5556.8642578125 927.151306152344 6 26 1.1.1.4942.2 1 66.3846 414.3334 66.3897 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0921410992741585 5608.98828125 935.8386 5608.8955078125 935.823181152344 6 27 1.1.1.4945.5 1 66.4595 2789.932 66.3638 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Dehydrated(T)@23; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0917749032378197 5608.9873046875 935.8385 5608.8955078125 935.823181152344 6 24 1.1.1.4952.3 1 66.6451 2782.788 66.3638 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0763193964958191 5556.9404296875 927.164 5556.8642578125 927.151306152344 6 30 1.1.1.4955.2 1 66.7235 352.5068 66.7286 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0759532004594803 5556.939453125 927.1639 5556.8642578125 927.151306152344 6 28 1.1.1.4970.2 1 67.0082 862.217 67.2068 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.088037796318531 5556.95263671875 927.166 5556.8642578125 927.151306152344 6 31 1.1.1.4994.2 1 67.4484 417.6255 67.4282 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0865729972720146 5556.95068359375 927.1657 5556.8642578125 927.151306152344 6 29 1.1.1.5027.3 1 67.8285 383.6093 67.8074 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.088037796318531 5556.95263671875 927.166 5556.8642578125 927.151306152344 6 26 1.1.1.5042.2 1 68.002 417.3813 67.9396 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0862068012356758 5556.94970703125 927.1656 5556.8642578125 927.151306152344 6 31 1.1.1.5104.2 1 68.6458 349.1584 68.6099 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0898687988519669 5556.9541015625 927.1663 5556.8642578125 927.151306152344 6 28 1.1.1.5150.2 1 69.0459 398.8799 69.0014 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0902350023388863 5556.9541015625 927.1663 5556.8642578125 927.151306152344 6 25 1.1.1.5170.2 1 69.221 391.1153 69.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0898687988519669 5556.9541015625 927.1663 5556.8642578125 927.151306152344 6 27 1.1.1.5195.2 1 69.4739 441.3546 69.4937 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0788827985525131 5556.94287109375 927.1644 5556.8642578125 927.151306152344 6 29 1.1.1.5217.2 1 69.667 456.7207 69.6722 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0763193964958191 5556.9404296875 927.164 5556.8642578125 927.151306152344 6 27 1.1.1.5242.2 1 69.9616 471.8178 69.9668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0309676006436348 5556.86181640625 927.1509 5556.8310546875 927.145812988281 6 26 1.1.1.5252.4 1 70.173 480.5735 70.1243 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.00886381044983864 5556.87646484375 927.1533 5556.86767578125 927.15185546875 6 26 1.1.1.5261.5 1 70.3535 608.1349 70.3828 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0301032997667789 5556.89794921875 927.1569 5556.86767578125 927.15185546875 6 31 1.1.1.5271.4 1 70.5223 621.7994 70.4547 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0631363019347191 5556.92724609375 927.1618 5556.8642578125 927.151306152344 6 32 1.1.1.5288.3 1 70.7496 528.0978 70.7209 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0862068012356758 5556.94970703125 927.1656 5556.8642578125 927.151306152344 6 28 1.1.1.5303.2 1 70.9386 612.1065 70.9438 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0748545974493027 5556.939453125 927.1638 5556.8642578125 927.151306152344 6 28 1.1.1.5315.2 1 71.1061 663.9719 71.1382 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0536151006817818 5556.91748046875 927.1602 5556.8642578125 927.151306152344 6 32 1.1.1.5328.2 1 71.283 716.2093 71.3389 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0506854988634586 5556.91455078125 927.1597 5556.8642578125 927.151306152344 6 27 1.1.1.5341.2 1 71.4591 683.6053 71.4992 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0514178983867168 5556.916015625 927.1599 5556.8642578125 927.151306152344 6 28 1.1.1.5354.2 1 71.6345 603.7934 71.6397 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0499530993402004 5556.9140625 927.1596 5556.8642578125 927.151306152344 6 31 1.1.1.5371.2 1 71.8066 680.5745 71.7862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0499530993402004 5556.9140625 927.1596 5556.8642578125 927.151306152344 6 32 1.1.1.5388.2 1 71.9985 732.5332 72.0038 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0400657989084721 5556.904296875 927.158 5556.8642578125 927.151306152344 6 32 1.1.1.5400.2 1 72.1688 743.2419 72.0932 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0393333993852139 5556.90283203125 927.1578 5556.8642578125 927.151306152344 6 27 1.1.1.5411.2 1 72.3485 722.3267 72.3271 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0517840981483459 5556.916015625 927.1599 5556.8642578125 927.151306152344 6 30 1.1.1.5421.2 1 72.5193 736.4788 72.4454 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0400657989084721 5556.904296875 927.158 5556.8642578125 927.151306152344 6 34 1.1.1.5431.2 1 72.6875 797.5254 72.6928 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0382348001003265 5556.90283203125 927.1577 5556.8642578125 927.151306152344 6 26 1.1.1.5443.2 1 72.8471 871.8069 72.7486 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0382348001003265 5556.90283203125 927.1577 5556.8642578125 927.151306152344 6 29 1.1.1.5455.3 1 73.0306 879.2733 72.9604 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0293709002435207 5556.896484375 927.1567 5556.86767578125 927.15185546875 6 27 1.1.1.5466.2 1 73.2123 976.6751 73.1925 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0330329015851021 5556.89990234375 927.1573 5556.86767578125 927.15185546875 6 35 1.1.1.5475.3 1 73.3807 1031.319 73.2728 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0352301001548767 5556.90283203125 927.1577 5556.86767578125 927.15185546875 6 28 1.1.1.5485.3 1 73.5507 966.1423 73.5558 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0333991013467312 5556.90087890625 927.1574 5556.86767578125 927.15185546875 6 36 1.1.1.5495.3 1 73.7196 994.7739 73.7335 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0499530993402004 5556.9140625 927.1596 5556.8642578125 927.151306152344 6 34 1.1.1.5503.3 1 73.8944 1074.949 73.8466 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0477559007704258 5556.91162109375 927.1592 5556.8642578125 927.151306152344 6 23 1.1.1.5520.2 1 74.0638 818.1201 74.0166 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0404319986701012 5556.904296875 927.158 5556.8642578125 927.151306152344 6 32 1.1.1.5531.3 1 74.2387 1078.252 74.2221 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.058066301047802 5556.8896484375 927.1555 5556.8310546875 927.145812988281 6 27 1.1.1.5541.5 1 74.4208 1006.473 74.4593 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0341315008699894 5556.9013671875 927.1575 5556.86767578125 927.15185546875 6 37 1.1.1.5554.4 1 74.5934 1170.837 74.5765 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0514178983867168 5556.916015625 927.1599 5556.8642578125 927.151306152344 6 24 1.1.1.5567.2 1 74.7572 995.6599 74.7706 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0506854988634586 5556.91455078125 927.1597 5556.8642578125 927.151306152344 6 28 1.1.1.5581.2 1 74.9488 1317.605 74.8938 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0393333993852139 5556.90283203125 927.1578 5556.8642578125 927.151306152344 6 32 1.1.1.5593.2 1 75.1162 1479.901 75.0613 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0352301001548767 5556.90283203125 927.1577 5556.86767578125 927.15185546875 6 30 1.1.1.5603.2 1 75.2986 1063.553 75.3289 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0393333993852139 5556.90283203125 927.1578 5556.8642578125 927.151306152344 6 29 1.1.1.5614.2 1 75.4623 1052.421 75.4758 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0495868995785713 5556.9130859375 927.1595 5556.8642578125 927.151306152344 6 32 1.1.1.5622.2 1 75.6416 1048.478 75.6468 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0181850008666515 5557.86669921875 794.9882 5557.84814453125 794.985595703125 7 23 1.1.1.5624.4 1 75.6907 186.5346 75.6468 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0591081008315086 5556.9228515625 927.1611 5556.8642578125 927.151306152344 6 32 1.1.1.5630.2 1 75.8141 992.4026 75.7926 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0609390996396542 5556.9248046875 927.1614 5556.8642578125 927.151306152344 6 28 1.1.1.5640.2 1 75.9834 1182.809 75.9355 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0598405003547668 5556.92431640625 927.1613 5556.8642578125 927.151306152344 6 29 1.1.1.5652.2 1 76.1515 946.5013 76.1307 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0631363019347191 5556.92724609375 927.1618 5556.8642578125 927.151306152344 6 32 1.1.1.5664.4 1 76.3214 1029.915 76.3008 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0525165013968945 5556.916015625 927.16 5556.8642578125 927.151306152344 6 30 1.1.1.5676.2 1 76.4923 1125.903 76.3836 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0591081008315086 5556.9228515625 927.1611 5556.8642578125 927.151306152344 6 27 1.1.1.5686.3 1 76.6665 899.4489 76.6802 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.060206700116396 5556.92431640625 927.1613 5556.8642578125 927.151306152344 6 27 1.1.1.5698.3 1 76.8517 1026.862 76.8626 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0411643013358116 5556.90478515625 927.1581 5556.8642578125 927.151306152344 6 26 1.1.1.5705.6 1 77.0344 1004.341 76.9947 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.060206700116396 5556.92431640625 927.1613 5556.8642578125 927.151306152344 6 24 1.1.1.5712.2 1 77.2256 926.5606 77.2841 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.060206700116396 5556.92431640625 927.1613 5556.8642578125 927.151306152344 6 24 1.1.1.5719.8 1 77.4121 926.5606 77.2841 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0980570018291473 5556.92626953125 927.1616 5556.82763671875 927.145263671875 6 28 1.1.1.5729.5 1 77.6634 687.3134 77.6685 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0631363019347191 5556.92724609375 927.1618 5556.8642578125 927.151306152344 6 24 1.1.1.5736.10 1 77.84 717.6699 77.8712 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0484132990241051 5556.916015625 927.1599 5556.86767578125 927.15185546875 6 23 1.1.1.5750.20 1 78.2064 718.8351 78.2123 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0495868995785713 5556.9130859375 927.1595 5556.8642578125 927.151306152344 6 23 1.1.1.5757.13 1 78.3869 678.7549 78.3134 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0481221005320549 5556.912109375 927.1593 5556.8642578125 927.151306152344 6 23 1.1.1.5771.10 1 78.7569 663.0233 78.7354 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0473146997392178 5556.91455078125 927.1597 5556.86767578125 927.15185546875 6 25 1.1.1.5785.19 1 79.1228 631.6375 79.1296 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.069727897644043 5556.93359375 927.1629 5556.8642578125 927.151306152344 6 25 1.1.1.5827.6 1 80.0068 408.9708 79.9617 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamidomethyl(K)@40 missed K-I@20; missed K-L@40 0.0929348021745682 5557.9189453125 927.3271 5557.826171875 927.311645507813 6 21 1.1.1.4707.10 1 60.62 4118.248 60.6549 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0450391992926598 5572.90771484375 929.8252 5572.8623046875 929.817687988281 6 21 1.1.1.4767.3 1 62.117 7389.646 62.1065 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0699056014418602 5572.908203125 929.8253 5572.837890625 929.813598632813 6 22 1.1.1.4790.5 1 62.6744 4740.376 62.6828 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.000923339975997806 5610.87841796875 936.1537 5610.8779296875 936.153625488281 6 22 1.1.1.4826.5 1 63.5421 505.8027 63.6557 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.100739002227783 5625.97802734375 938.6703 5625.8779296875 938.653564453125 6 22 1.1.1.4837.7 1 63.8127 637.5079 63.7295 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.100268997251987 5585.94677734375 931.9984 5585.8466796875 931.981689453125 6 22 1.1.1.4846.5 1 64.034 1134.144 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0801813006401062 5529.89697265625 922.6568 5529.81689453125 922.643432617188 6 21 1.1.1.4716.12 1 60.8542 1198.191 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0484023988246918 5538.9228515625 924.1611 5538.87451171875 924.153076171875 6 22 1.1.1.4725.13 1 61.0831 1960.415 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0680164024233818 5597.9140625 933.993 5597.8466796875 933.981689453125 6 20 1.1.1.4748.4 1 61.6484 889.3207 61.6576 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0801592022180557 5572.91845703125 929.827 5572.837890625 929.813598632813 6 22 1.1.1.4760.5 1 61.9501 7172.127 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0695393979549408 5572.90771484375 929.8252 5572.837890625 929.813598632813 6 22 1.1.1.4775.2 1 62.305 7389.646 62.1065 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0632288977503777 5571.90185546875 929.6576 5571.8388671875 929.647033691406 6 22 1.1.1.4789.4 1 62.6446 3689.696 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; reduced HNE(H)@24; Dioxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0345239005982876 5795.02294921875 966.8444 5794.98779296875 966.838623046875 6 23 1.1.1.4830.6 1 63.6423 409.7564 63.5571 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@23; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0812577977776527 5572.9189453125 929.8271 5572.837890625 929.813598632813 6 22 1.1.1.4847.4 1 64.0531 1853.064 64.0698 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0364289991557598 5610.84130859375 936.1475 5610.8779296875 936.153625488281 6 22 1.1.1.4850.3 1 64.1286 622.25 64.0698 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0652982965111732 5557.88037109375 794.9902 5557.81494140625 794.980895996094 7 20 1.1.1.4865.3 1 64.4927 4131.132 64.2393 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.100906997919083 5555.93359375 926.9962 5555.83251953125 926.979370117188 6 22 1.1.1.4978.2 1 67.1943 847.702 67.1996 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0533434003591537 5586.93115234375 932.1625 5586.8779296875 932.153625488281 6 21 1.1.1.4717.7 1 60.8766 1120.763 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0627700984477997 5556.92626953125 927.1617 5556.8642578125 927.151306152344 6 22 1.1.1.4776.4 1 62.3322 115344.4 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; MDA adduct +54(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.000609176000580192 5609.84716796875 935.9818 5609.8466796875 935.981689453125 6 22 1.1.1.4811.7 1 63.1852 550.2096 63.1687 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0904128029942513 5572.92822265625 929.8287 5572.837890625 929.813598632813 6 22 1.1.1.4854.4 1 64.2275 1523.086 64.191 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.083159901201725 5573.92626953125 929.995 5573.84326171875 929.981140136719 6 21 1.1.1.4857.4 1 64.2996 2471.5 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(D)@7; hexanoyl addition +98(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0844509974122047 5608.97998046875 935.8373 5608.8955078125 935.823181152344 6 22 1.1.1.4960.2 1 66.8185 480.9249 66.8315 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0980570018291473 5556.92626953125 927.1616 5556.82763671875 927.145263671875 6 22 1.1.1.5743.10 1 78.0238 735.2745 78.0289 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0506854988634586 5556.91455078125 927.1597 5556.8642578125 927.151306152344 6 22 1.1.1.5764.21 1 78.5716 673.4102 78.4975 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.088223397731781 5584.95068359375 931.8324 5584.8623046875 931.817687988281 6 21 1.1.1.4815.5 1 63.2709 1073.388 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0628255009651184 5587.92529296875 932.3281 5587.8623046875 932.317626953125 6 21 1.1.1.4817.3 1 63.3228 831.9039 63.3136 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0735891982913017 5598.916015625 934.1599 5598.841796875 934.147583007813 6 22 1.1.1.4818.6 1 63.352 727.3114 63.3378 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(N)@17; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0503636002540588 5542.90185546875 924.8243 5542.85205078125 924.81591796875 6 22 1.1.1.4822.2 1 63.4383 3261.389 63.4104 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; reduced HNE(H)@24; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0625021010637283 5800.0654296875 967.6849 5800.00341796875 967.674499511719 6 21 1.1.1.4718.14 1 60.9085 444.6302 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0108754001557827 5576.90087890625 930.4908 5576.89013671875 930.489013671875 6 21 1.1.1.4765.3 1 62.0689 2681.171 62.0584 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.101368002593517 5585.94775390625 931.9986 5585.8466796875 931.981689453125 6 21 1.1.1.4791.5 1 62.7018 2077.814 62.6588 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0864396020770073 5774.07470703125 963.353 5773.98779296875 963.338562011719 6 20 1.1.1.4800.8 1 62.9173 613.7089 62.7548 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.144791007041931 5556.9736328125 1112.402 5556.8310546875 1112.37353515625 5 20 1.1.1.4822.15 1 63.4508 17041.04 63.1928 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.116175003349781 5573.92626953125 929.995 5573.81005859375 929.975646972656 6 20 1.1.1.4835.2 1 63.7584 2970.466 63.901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@40; Amidated@C-term missed K-I@20; missed K-L@40 0.104947000741959 5557.96826171875 1112.601 5557.86279296875 1112.57983398438 5 21 1.1.1.4850.5 1 64.137 23367.44 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0724510997533798 5627.9658203125 939.0016 5627.8935546875 938.989501953125 6 21 1.1.1.4859.2 1 64.3432 184.4261 64.3356 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Carbamidomethyl(K)@40 missed K-I@20; missed K-L@40 0.111098997294903 5583.95263671875 931.6661 5583.841796875 931.647583007813 6 21 1.1.1.4906.4 1 65.5259 4824.442 65.5894 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0706731975078583 5572.93359375 929.8295 5572.8623046875 929.817687988281 6 20 1.1.1.4718.8 1 60.9035 44277.84 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0419238992035389 5588.888671875 799.4199 5588.84619140625 799.413879394531 7 21 1.1.1.4720.3 1 60.9502 554.8729 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0793846026062965 5540.91552734375 924.4932 5540.83642578125 924.47998046875 6 21 1.1.1.4783.4 1 62.4993 5829.959 62.4904 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0690803006291389 5544.89990234375 925.1573 5544.8310546875 925.145812988281 6 21 1.1.1.4790.3 1 62.6677 3501.438 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@28; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0649837031960487 5588.91064453125 932.4924 5588.84619140625 932.481628417969 6 21 1.1.1.4792.6 1 62.7224 1505.565 62.6109 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0486850999295712 5574.92333984375 930.1612 5574.87451171875 930.153076171875 6 21 1.1.1.4800.6 1 62.914 2517.184 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.00246346998028457 5612.890625 936.4891 5612.8935546875 936.489562988281 6 21 1.1.1.4810.2 1 63.152 450.6608 63.0961 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0794268026947975 5572.9169921875 929.8268 5572.837890625 929.813598632813 6 21 1.1.1.4811.4 1 63.1777 2549.568 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0433063991367817 5580.9072265625 931.1585 5580.8642578125 931.151306152344 6 21 1.1.1.4811.5 1 63.1802 1140.021 62.9273 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0674344971776009 5557.88232421875 794.9905 5557.81494140625 794.980895996094 7 19 1.1.1.4830.2 1 63.6356 6250.131 63.6311 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0557978004217148 5574.8974609375 797.4212 5574.841796875 797.413208007813 7 19 1.1.1.4852.2 1 64.1775 401.1519 64.191 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.0280064009130001 5610.85009765625 936.1489 5610.8779296875 936.153625488281 6 21 1.1.1.4857.5 1 64.3029 626.7202 64.0698 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0506854988634586 5556.91455078125 927.1597 5556.8642578125 927.151306152344 6 21 1.1.1.5792.10 1 79.3084 631.6375 79.1296 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0973806008696556 5539.90185546875 924.3243 5539.8046875 924.308044433594 6 19 1.1.1.4691.6 1 60.2099 905.9796 60.2481 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.051095999777317 5542.9033203125 924.8245 5542.85205078125 924.81591796875 6 21 1.1.1.4712.7 1 60.7444 494.2504 60.7079 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0621792003512383 5572.888671875 797.1342 5572.826171875 797.125305175781 7 19 1.1.1.4723.3 1 61.0252 12620.14 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Methyl(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0669720992445946 5573.9140625 929.9929 5573.8466796875 929.981689453125 6 20 1.1.1.4739.7 1 61.4204 5035.605 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0509565994143486 5541.8681640625 792.7027 5541.81689453125 792.695373535156 7 21 1.1.1.4792.2 1 62.7116 1571.693 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0827326029539108 5539.88720703125 924.3218 5539.8046875 924.308044433594 6 19 1.1.1.4804.2 1 63.0038 4308.138 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0827663987874985 5585.92578125 931.9949 5585.84326171875 931.981140136719 6 20 1.1.1.4808.2 1 63.1033 1308.147 63.072 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.0633812993764877 5515.8681640625 920.3186 5515.8046875 920.308044433594 6 20 1.1.1.4825.3 1 63.5124 1482.923 63.6557 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0435603000223637 5626.953125 938.8328 5626.9091796875 938.825500488281 6 20 1.1.1.4849.2 1 64.0996 264.881 64.094 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0657941028475761 5586.94384765625 932.1646 5586.8779296875 932.153625488281 6 20 1.1.1.4854.5 1 64.2309 1140.53 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.064901202917099 5590.91650390625 932.8267 5590.85205078125 932.81591796875 6 20 1.1.1.4742.3 1 61.4913 1410.027 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0991875007748604 5528.93310546875 1106.794 5528.83642578125 1106.77453613281 5 20 1.1.1.4766.7 1 62.0986 3233.475 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0900325030088425 5528.92333984375 1106.792 5528.83642578125 1106.77453613281 5 20 1.1.1.4800.10 1 62.9223 1399.112 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@40 missed K-I@20; missed K-L@40 0.0742892026901245 5654.978515625 808.8613 5654.904296875 808.850769042969 7 17 1.1.1.4714.10 1 60.7996 379.6322 60.7875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0281723998486996 5598.86962890625 800.8458 5598.841796875 800.841796875 7 20 1.1.1.4719.3 1 60.9247 523.4662 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.105267003178596 5557.919921875 927.3273 5557.81494140625 927.309814453125 6 19 1.1.1.4719.7 1 60.928 12047.38 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.048412598669529 5543.859375 792.9872 5543.810546875 792.980224609375 7 19 1.1.1.4720.2 1 60.9493 867.9662 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0740439966320992 5572.93359375 929.8295 5572.85888671875 929.817138671875 6 19 1.1.1.4725.14 1 61.0839 44277.84 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Oxidation(P)@25; Hex(N)@30 missed K-I@20; missed K-L@40 0.110513001680374 5891.10400390625 982.858 5890.99365234375 982.839599609375 6 21 1.1.1.4739.10 1 61.4229 1065.766 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Cation:Na(D)@35; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 0.0342166014015675 5933.12451171875 989.8613 5933.08984375 989.855651855469 6 20 1.1.1.4766.6 1 62.0961 3353.271 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0442906990647316 5574.91943359375 930.1605 5574.87451171875 930.153076171875 6 20 1.1.1.4772.4 1 62.2384 4243.607 62.1544 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0958745032548904 5585.9423828125 931.9977 5585.8466796875 931.981689453125 6 20 1.1.1.4776.6 1 62.338 2703.167 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.0893526002764702 5527.8935546875 922.3229 5527.8046875 922.308044433594 6 19 1.1.1.4802.3 1 62.9608 2164.72 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0275599006563425 5580.8916015625 931.1559 5580.8642578125 931.151306152344 6 20 1.1.1.4804.4 1 63.0071 1205.758 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0962935015559196 5598.93798828125 934.1636 5598.841796875 934.147583007813 6 20 1.1.1.4804.5 1 63.0088 820.6935 63.0478 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0904512032866478 5527.89501953125 922.3231 5527.8046875 922.308044433594 6 19 1.1.1.4816.4 1 63.3018 997.8989 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Deamidated(N)@34; Dethiomethyl(M)@37 missed K-I@20; missed K-L@40 0.0895785018801689 5512.90087890625 919.8241 5512.8115234375 919.809204101563 6 20 1.1.1.4817.2 1 63.3194 276.8707 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0632788017392159 5579.86328125 798.1306 5579.79931640625 798.121459960938 7 19 1.1.1.4819.2 1 63.3694 464.4311 63.3136 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0472203008830547 5574.921875 930.1609 5574.87451171875 930.153076171875 6 20 1.1.1.4828.2 1 63.5863 1266.149 63.6064 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0763749033212662 5587.9384765625 932.3304 5587.8623046875 932.317626953125 6 20 1.1.1.4828.3 1 63.588 755.2929 63.6064 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.0633656978607178 5543.87451171875 792.9893 5543.810546875 792.980224609375 7 19 1.1.1.4834.2 1 63.7338 1984.911 63.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.067007303237915 5557.8818359375 794.9904 5557.81494140625 794.980895996094 7 18 1.1.1.4837.3 1 63.8077 13337.92 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.067007303237915 5557.8818359375 794.9904 5557.81494140625 794.980895996094 7 18 1.1.1.4844.3 1 63.9866 13337.92 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0674344971776009 5557.88232421875 794.9905 5557.81494140625 794.980895996094 7 18 1.1.1.4851.3 1 64.1613 10184.36 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamidomethyl(K)@40 missed K-I@20; missed K-L@40 0.0951320007443428 5557.92138671875 927.3275 5557.826171875 927.311645507813 6 19 1.1.1.4854.3 1 64.2242 46814 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.062153298407793 5582.90869140625 798.5657 5582.8466796875 798.556823730469 7 19 1.1.1.4867.2 1 64.5423 4423.708 64.6856 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.112116999924183 5582.958984375 931.5004 5582.8466796875 931.481750488281 6 19 1.1.1.4870.4 1 64.6262 18021.18 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.062153298407793 5582.90869140625 798.5657 5582.8466796875 798.556823730469 7 19 1.1.1.4881.2 1 64.8899 4423.708 64.6856 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 -0.022147199138999 5610.85595703125 936.1499 5610.8779296875 936.153625488281 6 20 1.1.1.4818.7 1 63.3545 461.1055 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0612302012741566 5539.86572265625 792.4167 5539.8046875 792.407958984375 7 18 1.1.1.4820.2 1 63.392 524.9306 63.3862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0661528035998344 5557.88134765625 794.9903 5557.81494140625 794.980895996094 7 18 1.1.1.4858.3 1 64.3172 9208.611 64.0698 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0496950000524521 5539.85400390625 792.415 5539.8046875 792.407958984375 7 18 1.1.1.4811.2 1 63.1726 789.2064 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.0716945007443428 5540.90771484375 924.4919 5540.83642578125 924.47998046875 6 20 1.1.1.4865.4 1 64.4961 579.1005 64.5078 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0704251006245613 5557.88525390625 794.9909 5557.81494140625 794.980895996094 7 18 1.1.1.4877.3 1 64.7938 417.4022 64.7596 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@28; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0478607006371021 5573.89111328125 797.2774 5573.84326171875 797.270568847656 7 19 1.1.1.4718.2 1 60.8985 8121.386 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Lys->Allysine(K)@20 missed K-I@20; missed K-L@40 0.130425006151199 5499.90380859375 1100.988 5499.7734375 1100.9619140625 5 20 1.1.1.4739.16 1 61.4279 741.278 61.4371 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0771040022373199 5576.9130859375 930.4928 5576.83642578125 930.47998046875 6 17 1.1.1.4780.2 1 62.4251 1933.009 62.4426 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20 missed K-I@20; missed K-L@40 0.0847987979650497 5556.916015625 927.1599 5556.8310546875 927.145812988281 6 17 1.1.1.4829.5 1 63.6127 16075.72 63.6064 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0761388018727303 5584.9384765625 931.8304 5584.8623046875 931.817687988281 6 19 1.1.1.4838.4 1 63.833 1071.33 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.060206700116396 5556.92431640625 927.1613 5556.8642578125 927.151306152344 6 20 1.1.1.5778.12 1 78.9403 494.8427 78.9191 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.140970006585121 5557.95849609375 1112.599 5557.81494140625 1112.5703125 5 18 1.1.1.4709.15 1 60.6731 1974.573 60.6549 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0959056988358498 5572.93408203125 929.8296 5572.837890625 929.813598632813 6 20 1.1.1.4711.6 1 60.717 41721.4 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0621792003512383 5572.888671875 797.1342 5572.826171875 797.125305175781 7 17 1.1.1.4716.4 1 60.8476 12620.14 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0332866013050079 5544.86376953125 793.1307 5544.8310546875 793.126037597656 7 19 1.1.1.4717.3 1 60.8733 955.0185 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(2)C(2)(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0430030003190041 5652.96875 808.5742 5652.9248046875 808.567993164063 7 19 1.1.1.4718.4 1 60.9002 331.8926 60.8668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.105267003178596 5557.919921875 927.3273 5557.81494140625 927.309814453125 6 17 1.1.1.4721.8 1 60.9796 12047.38 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0472505986690521 5797.05078125 967.1824 5797.00390625 967.174560546875 6 19 1.1.1.4722.9 1 61.0055 297.4506 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.118986003100872 5539.923828125 924.3279 5539.8046875 924.308044433594 6 18 1.1.1.4733.4 1 61.2759 1625.344 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dehydrated(T)@31; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0473502986133099 5572.888671875 797.1342 5572.84130859375 797.12744140625 7 20 1.1.1.4741.5 1 61.4681 1635.792 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@26; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0998106002807617 5587.96337890625 1118.6 5587.8623046875 1118.57971191406 5 19 1.1.1.4745.8 1 61.5801 1083.009 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.146355003118515 5527.94873046875 1106.597 5527.8046875 1106.56823730469 5 19 1.1.1.4759.3 1 61.9271 2200.101 61.9141 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.0912842974066734 5542.943359375 1109.596 5542.85205078125 1109.57763671875 5 19 1.1.1.4768.5 1 62.1493 5022.473 62.1065 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.112976998090744 5540.94873046875 1109.197 5540.83642578125 1109.17456054688 5 19 1.1.1.4781.4 1 62.4614 2790.336 62.4665 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.116029001772404 5540.95361328125 1109.198 5540.83642578125 1109.17456054688 5 19 1.1.1.4788.3 1 62.6239 3091.921 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.0856906026601791 5527.89013671875 922.3223 5527.8046875 922.308044433594 6 18 1.1.1.4795.2 1 62.7852 2273.733 62.7788 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +62(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0732456967234612 5592.89306640625 933.1561 5592.81982421875 933.143920898438 6 19 1.1.1.4796.3 1 62.8118 748.3972 62.7069 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0946862027049065 5556.92626953125 927.1616 5556.8310546875 927.145812988281 6 17 1.1.1.4803.2 1 62.9814 72528.84 62.8792 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0852959975600243 5539.89013671875 924.3223 5539.8046875 924.308044433594 6 17 1.1.1.4811.3 1 63.1752 3976.703 63.0238 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Formyl(K)@40 missed K-I@20; missed K-L@40 0.146559000015259 5528.94873046875 1106.797 5528.7998046875 1106.76721191406 5 19 1.1.1.4814.6 1 63.26 796.985 63.2651 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamidomethyl(K)@40 missed K-I@20; missed K-L@40 0.102456003427505 5557.92822265625 927.3287 5557.826171875 927.311645507813 6 18 1.1.1.4826.4 1 63.5404 28046.69 63.6064 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.112424999475479 5515.9189453125 1104.191 5515.8046875 1104.16821289063 5 19 1.1.1.4826.10 1 63.5521 710.355 63.6801 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.116268999874592 5627.0234375 1126.412 5626.9091796875 1126.38916015625 5 19 1.1.1.4829.13 1 63.6227 364.6862 63.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.115506999194622 5529.93359375 1106.994 5529.8203125 1106.97131347656 5 19 1.1.1.4833.9 1 63.7211 4160.356 63.7539 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@40; Amidated@C-term missed K-I@20; missed K-L@40 0.106168001890182 5557.96826171875 1112.601 5557.86279296875 1112.57983398438 5 19 1.1.1.4836.9 1 63.7957 29456.58 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0830708965659142 5627.97705078125 939.0034 5627.8935546875 938.989501953125 6 19 1.1.1.4838.6 1 63.8347 714.3661 63.7539 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.0967160984873772 5543.9072265625 924.9918 5543.810546875 924.975708007813 6 18 1.1.1.4839.3 1 63.8567 10930.42 63.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.115506999194622 5529.93359375 1106.994 5529.8203125 1106.97131347656 5 19 1.1.1.4840.8 1 63.8909 4160.356 63.7539 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0908621996641159 5591.92724609375 932.9951 5591.8359375 932.979919433594 6 19 1.1.1.4846.6 1 64.0373 553.2578 64.0698 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0771073028445244 5587.939453125 932.3305 5587.8623046875 932.317626953125 6 19 1.1.1.4847.5 1 64.0548 1057.86 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; HexNAc(N)@28; Oxidation(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.033797599375248 5990.09619140625 999.3566 5990.0625 999.351013183594 6 19 1.1.1.4849.5 1 64.1097 472.0512 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.0700991973280907 5543.90576171875 924.9916 5543.8359375 924.979919433594 6 19 1.1.1.4854.2 1 64.2209 4091.642 64.0216 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Methyl(K)@40 missed K-I@20; missed K-L@40 0.108939997851849 5568.939453125 929.1639 5568.8310546875 929.145812988281 6 19 1.1.1.4861.4 1 64.4033 2370.231 64.5591 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.044658899307251 5626.95361328125 938.8329 5626.9091796875 938.825500488281 6 18 1.1.1.4869.6 1 64.6053 251.3036 64.5851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.10453400015831 5557.91943359375 927.3272 5557.81494140625 927.309814453125 6 17 1.1.1.4877.4 1 64.7971 2075.842 64.7596 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0825584977865219 5583.91357421875 798.7092 5583.83056640625 798.697387695313 7 18 1.1.1.4908.5 1 65.5777 982.2468 65.5975 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Oxidation(P)@25; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0707544013857841 5761.07421875 961.1863 5761.00390625 961.174560546875 6 19 1.1.1.4715.17 1 60.8324 206.0984 60.8408 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.095983698964119 5543.90673828125 924.9917 5543.810546875 924.975708007813 6 17 1.1.1.4721.7 1 60.9788 3187.7 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0674344971776009 5557.88232421875 794.9905 5557.81494140625 794.980895996094 7 16 1.1.1.4722.3 1 61.0005 2863.973 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.107059001922607 5572.93359375 929.8295 5572.826171875 929.811645507813 6 17 1.1.1.4722.6 1 61.003 44277.84 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Oxidation(P)@25; CHDH(D)@33 missed K-I@20; missed K-L@40 0.0856257975101471 5905.1103515625 985.1923 5905.02490234375 985.178100585938 6 24 1.1.1.4740.10 1 61.4476 3279.603 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; CHDH(D)@35; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.101519003510475 5919.12060546875 987.5274 5919.01953125 987.510498046875 6 18 1.1.1.4746.5 1 61.5944 2097.046 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; reduced HNE(H)@24; Dicarbamidomethyl(D)@35; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0639211982488632 5933.13134765625 989.8625 5933.0673828125 989.851806640625 6 18 1.1.1.4751.3 1 61.7151 4960.583 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.101049996912479 5542.95361328125 1109.598 5542.85205078125 1109.57763671875 5 18 1.1.1.4753.8 1 61.7685 6801.796 61.7302 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0984254032373428 5572.95849609375 1115.599 5572.85888671875 1115.5791015625 5 17 1.1.1.4757.6 1 61.885 4273.531 61.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0950523987412453 5556.92626953125 927.1616 5556.8310546875 927.145812988281 6 16 1.1.1.4760.4 1 61.9476 129186.3 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.101049996912479 5542.95361328125 1109.598 5542.85205078125 1109.57763671875 5 18 1.1.1.4760.7 1 61.9551 6330.969 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Methyl(H)@24; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0650475025177002 5543.8974609375 924.9902 5543.83251953125 924.979370117188 6 19 1.1.1.4767.2 1 62.1129 7018.907 62.0584 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.109302997589111 5541.8818359375 792.7047 5541.7724609375 792.689086914063 7 17 1.1.1.4770.2 1 62.1821 1634.365 62.2262 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0437670983374119 5589.91796875 932.6603 5589.87451171875 932.653015136719 6 17 1.1.1.4775.3 1 62.3092 1817.498 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@30; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0914615988731384 5540.88037109375 792.5616 5540.78857421875 792.548522949219 7 17 1.1.1.4783.2 1 62.4943 1203.197 62.5144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.140614002943039 5539.943359375 1108.996 5539.8046875 1108.96813964844 5 17 1.1.1.4795.4 1 62.7935 2065.933 62.7069 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0925517976284027 5597.93896484375 933.9971 5597.8466796875 933.981689453125 6 17 1.1.1.4800.7 1 62.9156 863.0704 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.13756300508976 5539.943359375 1108.996 5539.8046875 1108.96813964844 5 17 1.1.1.4802.6 1 62.9708 2111.382 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@40; Arg->Orn(R)@50 missed K-I@20; missed K-L@40 0.119028002023697 5556.9736328125 1112.402 5556.8564453125 1112.37854003906 5 18 1.1.1.4808.4 1 63.115 34914.11 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.117250002920628 5540.95361328125 1109.198 5540.83642578125 1109.17456054688 5 18 1.1.1.4809.8 1 63.1395 2223.519 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0959158018231392 5539.900390625 924.324 5539.8046875 924.308044433594 6 16 1.1.1.4818.3 1 63.3445 3703.355 63.0961 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.051994800567627 5595.8828125 933.6544 5595.83056640625 933.645751953125 6 16 1.1.1.4820.4 1 63.3986 378.8683 63.2651 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.106902003288269 5539.912109375 924.3259 5539.8046875 924.308044433594 6 16 1.1.1.4825.4 1 63.5133 2560.071 63.4592 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Deamidated(N)@17; acrolein addition +76(K)@20 missed K-I@20; missed K-L@40 0.0805953964591026 5578.884765625 797.9908 5578.80419921875 797.979309082031 7 17 1.1.1.4826.2 1 63.5371 417.091 63.6311 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0822981968522072 5597.9287109375 933.9954 5597.8466796875 933.981689453125 6 16 1.1.1.4827.5 1 63.5666 610.4174 63.5079 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0745811015367508 5571.9130859375 929.6595 5571.8388671875 929.647033691406 6 18 1.1.1.4832.6 1 63.6873 946.1407 63.6801 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.113688997924328 5557.92822265625 927.3287 5557.81494140625 927.309814453125 6 16 1.1.1.4833.4 1 63.7127 28046.69 63.6064 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@28; Methyl(K)@40 missed K-I@20; missed K-L@40 0.112424999475479 5515.9189453125 1104.191 5515.8046875 1104.16821289063 5 18 1.1.1.4833.8 1 63.7194 710.355 63.6801 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamidomethyl(E)@13; acrolein addition +94(K)@20; reduced HNE(H)@24; Methyl(K)@40 missed K-I@20; missed K-L@40 0.058915700763464 5824.07373046875 971.6862 5824.0146484375 971.676391601563 6 19 1.1.1.4834.6 1 63.7413 239.9241 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Delta:H(2)C(2)(H)@24; Deamidated(N)@26; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 0.0660998001694679 5836.0693359375 973.6855 5836.00341796875 973.674499511719 6 17 1.1.1.4836.5 1 63.7882 363.1168 63.8278 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamidomethyl(K)@40 missed K-I@20; missed K-L@40 0.103188000619411 5557.9296875 927.3289 5557.826171875 927.311645507813 6 17 1.1.1.4840.4 1 63.8843 54964.3 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0427487008273602 5597.88916015625 933.9888 5597.8466796875 933.981689453125 6 16 1.1.1.4840.6 1 63.8876 475.5131 63.8032 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.0700991973280907 5543.90576171875 924.9916 5543.8359375 924.979919433594 6 18 1.1.1.4846.2 1 64.0265 4091.642 64.0216 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.106365002691746 5557.92138671875 927.3275 5557.81494140625 927.309814453125 6 16 1.1.1.4847.2 1 64.0498 46814 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0823607966303825 5604.94970703125 935.1656 5604.86767578125 935.15185546875 6 18 1.1.1.4847.6 1 64.0573 269.1261 64.0698 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.100594997406006 5929.017578125 989.1769 5929.11865234375 989.193725585938 6 17 1.1.1.4859.4 1 64.3549 177.7478 64.3114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.105999000370502 5557.92138671875 927.3275 5557.81494140625 927.309814453125 6 16 1.1.1.4861.3 1 64.3975 32798.14 64.1423 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0995756015181541 5584.9619140625 931.8343 5584.8623046875 931.817687988281 6 18 1.1.1.4862.7 1 64.4256 6395.855 64.6604 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@12; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.125183999538422 5599.95068359375 934.3324 5599.82568359375 934.311584472656 6 18 1.1.1.4865.5 1 64.4994 884.2655 64.6856 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.108378000557423 5598.94970703125 934.1656 5598.841796875 934.147583007813 6 18 1.1.1.4872.5 1 64.6705 1045.35 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; hexanoyl addition +98(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0441114008426666 5653.953125 943.3328 5653.9091796875 943.325439453125 6 19 1.1.1.4872.6 1 64.673 143.2199 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.062153298407793 5582.90869140625 798.5657 5582.8466796875 798.556823730469 7 17 1.1.1.4874.3 1 64.7181 4423.708 64.6856 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Oxidation(P)@25; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0898817032575607 5570.93359375 929.4962 5570.84326171875 929.481201171875 6 19 1.1.1.4874.4 1 64.7206 945.3261 64.6604 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.112116999924183 5582.958984375 931.5004 5582.8466796875 931.481750488281 6 17 1.1.1.4877.5 1 64.8004 18021.18 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Oxidation(P)@25; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0494864992797375 5639.90673828125 940.9917 5639.85693359375 940.983459472656 6 19 1.1.1.4878.4 1 64.8241 140.2175 64.7842 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.108378000557423 5598.94970703125 934.1656 5598.841796875 934.147583007813 6 17 1.1.1.4881.3 1 64.8941 1045.35 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.111385002732277 5582.9580078125 931.5003 5582.8466796875 931.481750488281 6 18 1.1.1.4884.5 1 64.9716 18080.92 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@17; acrolein addition +38(K)@20 missed K-I@20; missed K-L@40 0.114078998565674 5565.9345703125 928.663 5565.8203125 928.643981933594 6 17 1.1.1.4889.2 1 65.1006 648.6223 64.9834 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.122569002211094 5569.94873046875 929.3321 5569.826171875 929.311645507813 6 19 1.1.1.4906.3 1 65.5226 512.1652 65.46 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.122331999242306 5583.95263671875 931.6661 5583.83056640625 931.645751953125 6 18 1.1.1.4914.2 1 65.7104 4824.442 65.5894 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.136067003011703 5556.96728515625 927.1685 5556.8310546875 927.145812988281 6 16 1.1.1.5061.2 1 68.2135 333.9395 68.1907 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0882522985339165 5575.9140625 930.3263 5575.82568359375 930.311584472656 6 16 1.1.1.4752.4 1 61.7374 3227.826 61.7302 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24 missed K-I@20; missed K-L@40 0.0809691995382309 5526.9013671875 922.1575 5526.8203125 922.14404296875 6 16 1.1.1.4809.4 1 63.1295 869.0115 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0658421963453293 5776.0693359375 963.6855 5776.00341796875 963.674499511719 6 16 1.1.1.4810.3 1 63.1578 349.0975 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Deamidated(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0522594004869461 5854.10205078125 976.691 5854.05029296875 976.682312011719 6 16 1.1.1.4813.3 1 63.226 308.3203 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; reduced HNE(H)@24; Deamidated(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0413112007081509 5796.05029296875 967.0156 5796.00830078125 967.008666992188 6 16 1.1.1.4829.8 1 63.6152 444.7957 63.5325 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.114422000944614 5557.9296875 927.3289 5557.81494140625 927.309814453125 6 16 1.1.1.4837.5 1 63.8093 54964.3 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0882522985339165 5575.9140625 930.3263 5575.82568359375 930.311584472656 6 16 1.1.1.4844.4 1 63.9924 1722.727 63.901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.106365002691746 5557.92138671875 927.3275 5557.81494140625 927.309814453125 6 16 1.1.1.4846.3 1 64.029 46814 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.124528996646404 5583.95556640625 931.6665 5583.83056640625 931.645751953125 6 17 1.1.1.4899.3 1 65.3467 1325.947 65.2536 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.124528996646404 5583.95556640625 931.6665 5583.83056640625 931.645751953125 6 17 1.1.1.4921.2 1 65.8955 327.0144 65.8857 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; reduced HNE(H)@24; Oxidation(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0885389968752861 5765.06591796875 961.8516 5764.9775390625 961.836853027344 6 17 1.1.1.4720.10 1 60.956 214.6084 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Dethiomethyl(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0186276007443666 5837.0712890625 973.8525 5837.052734375 973.849426269531 6 16 1.1.1.4720.11 1 60.9568 428.243 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.144791007041931 5556.9736328125 1112.402 5556.8310546875 1112.37353515625 5 16 1.1.1.4738.12 1 61.4059 55191.21 61.6335 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0685267969965935 5608.89501953125 935.8231 5608.826171875 935.811645507813 6 15 1.1.1.4741.9 1 61.4714 1010.367 61.6576 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Methyl(K)@40 missed K-I@20; missed K-L@40 0.06667710095644 5515.87158203125 920.3192 5515.8046875 920.308044433594 6 17 1.1.1.4743.5 1 61.5176 8460.981 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.110675998032093 5584.97314453125 1118.002 5584.8623046875 1117.97973632813 5 17 1.1.1.4743.20 1 61.5302 538.8009 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; Hex(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0904107019305229 5933.13134765625 989.8625 5933.041015625 989.847412109375 6 17 1.1.1.4744.14 1 61.5498 5250.238 61.5852 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20 missed K-I@20; missed K-L@40 0.0950523987412453 5556.92626953125 927.1616 5556.8310546875 927.145812988281 6 15 1.1.1.4745.2 1 61.5651 123559.4 61.7302 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Hypusine(K)@20; reduced HNE(H)@24; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0222542006522417 5822.0576171875 971.3502 5822.03515625 971.346496582031 6 17 1.1.1.4753.5 1 61.7635 404.2124 61.7545 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Hex(N)@30; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.0904107019305229 5933.13134765625 989.8625 5933.041015625 989.847412109375 6 17 1.1.1.4755.5 1 61.8215 4960.583 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.135979995131493 5527.9384765625 1106.595 5527.8046875 1106.56823730469 5 17 1.1.1.4773.6 1 62.2656 1904.641 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0957847982645035 5556.92626953125 927.1617 5556.8310546875 927.145812988281 6 15 1.1.1.4783.5 1 62.5018 116289.4 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.145401000976563 5556.978515625 1112.403 5556.8310546875 1112.37353515625 5 16 1.1.1.4815.10 1 63.2776 24518.08 63.0238 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.0633656978607178 5543.87451171875 792.9893 5543.810546875 792.980224609375 7 16 1.1.1.4837.2 1 63.8068 1984.911 63.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +96(K)@20; reduced HNE(H)@24; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0988513007760048 5818.091796875 970.6892 5817.99267578125 970.672729492188 6 16 1.1.1.4839.8 1 63.8617 190.6571 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.156782999634743 5583.00390625 1117.608 5582.8466796875 1117.57666015625 5 17 1.1.1.4866.3 1 64.5283 13407.52 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.07255470007658 5568.939453125 929.1639 5568.86767578125 929.15185546875 6 17 1.1.1.4868.5 1 64.5767 2370.231 64.5591 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.082183800637722 5543.91796875 924.9936 5543.8359375 924.979919433594 6 17 1.1.1.4869.5 1 64.602 1033.865 64.3356 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0770682021975517 5588.9228515625 932.4944 5588.84619140625 932.481628417969 6 17 1.1.1.4836.3 1 63.7848 1009.696 63.901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.0967160984873772 5543.9072265625 924.9918 5543.810546875 924.975708007813 6 16 1.1.1.4841.4 1 63.9134 10930.42 63.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0669179037213326 5597.9140625 933.9929 5597.8466796875 933.981689453125 6 15 1.1.1.4848.5 1 64.0856 381.9002 64.0698 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.156782999634743 5583.00390625 1117.608 5582.8466796875 1117.57666015625 5 17 1.1.1.4880.2 1 64.8692 13547.39 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0815330967307091 5557.896484375 794.9925 5557.81494140625 794.980895996094 7 15 1.1.1.4897.2 1 65.2885 225.0943 65.3576 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Deamidated(N)@34; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0594700984656811 5670.017578125 946.0102 5669.9580078125 946.000305175781 6 16 1.1.1.4717.9 1 60.8783 456.9333 60.8668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0655156970024109 5604.93310546875 935.1628 5604.86767578125 935.15185546875 6 16 1.1.1.4718.9 1 60.9044 857.3009 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; reduced HNE(H)@24; Deamidated(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0313174985349178 5870.076171875 979.3533 5870.04541015625 979.34814453125 6 15 1.1.1.4718.16 1 60.9102 453.9449 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.152190998196602 5572.978515625 1115.603 5572.826171875 1115.57250976563 5 16 1.1.1.4720.16 1 60.961 23858.03 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.126480996608734 5556.958984375 1112.399 5556.8310546875 1112.37353515625 5 15 1.1.1.4723.15 1 61.0385 2273.136 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Methyl(H)@24 missed K-I@20; missed K-L@40 0.115805998444557 5572.978515625 1115.603 5572.8623046875 1115.57971191406 5 16 1.1.1.4727.10 1 61.1397 23858.03 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24; Deamidated(N)@30; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0742688030004501 5585.9208984375 931.9941 5585.8466796875 931.981689453125 6 16 1.1.1.4738.5 1 61.3942 1363.239 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34; Met->Hcy(M)@37 missed K-I@20; missed K-L@40 0.079585500061512 5513.86865234375 919.9854 5513.7890625 919.972106933594 6 17 1.1.1.4744.5 1 61.5423 6202.779 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; HexNAc(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0770083963871002 5918.1181640625 987.3603 5918.041015625 987.347473144531 6 16 1.1.1.4744.13 1 61.549 1792.443 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.136245995759964 5556.96875 1112.401 5556.8310546875 1112.37353515625 5 15 1.1.1.4766.8 1 62.1011 54685.04 62.0584 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.107483997941017 5540.94384765625 1109.196 5540.83642578125 1109.17456054688 5 16 1.1.1.4774.6 1 62.2934 3363.32 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.108800999820232 5572.96826171875 1115.601 5572.85888671875 1115.5791015625 5 16 1.1.1.4779.5 1 62.413 3178.039 62.2985 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24 missed K-I@20; missed K-L@40 0.129425004124641 5526.9482421875 1106.397 5526.8203125 1106.37133789063 5 16 1.1.1.4807.8 1 63.091 510.7305 63.072 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; Hex(N)@26; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0583172999322414 5973.13037109375 996.529 5973.072265625 996.519287109375 6 16 1.1.1.4815.9 1 63.2759 294.7681 63.3136 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.088223397731781 5584.95068359375 931.8324 5584.8623046875 931.817687988281 6 16 1.1.1.4822.4 1 63.4399 1073.388 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(4)C(2)(H)@24 missed K-I@20; missed K-L@40 0.10895299911499 5528.94384765625 1106.796 5528.83642578125 1106.77453613281 5 16 1.1.1.4823.8 1 63.4736 1413.03 63.7049 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dehydrated(T)@31; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.120301000773907 5540.95849609375 1109.199 5540.83642578125 1109.17456054688 5 16 1.1.1.4827.9 1 63.5741 1357.214 63.5817 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0633589029312134 5573.87353515625 797.2749 5573.81005859375 797.265869140625 7 15 1.1.1.4829.3 1 63.6111 453.196 63.6311 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Hex(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0487312003970146 5989.115234375 999.1932 5989.06689453125 999.185119628906 6 16 1.1.1.4832.16 1 63.6981 389.9018 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; Deamidated(N)@30; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0435083992779255 5796.0517578125 967.0159 5796.00830078125 967.008666992188 6 15 1.1.1.4837.9 1 63.816 385.0828 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Dioxidation(P)@25 missed K-I@20; missed K-L@40 0.0915784984827042 5532.88671875 923.155 5532.794921875 923.139709472656 6 16 1.1.1.4840.3 1 63.8826 1583.537 63.7539 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30 missed K-I@20; missed K-L@40 0.106365002691746 5557.92138671875 927.3275 5557.81494140625 927.309814453125 6 15 1.1.1.4853.2 1 64.1984 46814 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0947185978293419 5599.92041015625 800.9959 5599.82568359375 800.982360839844 7 16 1.1.1.4869.3 1 64.5953 278.3693 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; acrolein addition +56(K)@40; Deamidated(N)@48 missed K-I@20; missed K-L@40 0.124528996646404 5583.95556640625 931.6665 5583.83056640625 931.645751953125 6 16 1.1.1.4891.2 1 65.1612 1326.231 65.2536 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.124039001762867 5556.953125 1112.398 5556.8310546875 1112.37353515625 5 15 1.1.1.5408.2 1 72.2694 390.4839 72.2086 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Dethiomethyl(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.068468801677227 5560.89111328125 795.4203 5560.82275390625 795.410522460938 7 15 1.1.1.4744.3 1 61.5406 2167.002 61.5852 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.138896003365517 5772.111328125 963.0258 5771.97216796875 963.002624511719 6 15 1.1.1.4744.8 1 61.5448 508.1622 61.5361 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.10615199804306 5562.92626953125 928.1617 5562.8203125 928.14404296875 6 14 1.1.1.4757.3 1 61.875 3236.934 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0946862027049065 5556.92626953125 927.1616 5556.8310546875 927.145812988281 6 14 1.1.1.4768.2 1 62.1368 110729 62.1065 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0867891982197762 5527.8916015625 922.3225 5527.8046875 922.308044433594 6 15 1.1.1.4777.3 1 62.3553 3605.052 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0950523987412453 5556.92626953125 927.1616 5556.8310546875 927.145812988281 6 14 1.1.1.4790.4 1 62.6711 82076.82 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.144179999828339 5556.9736328125 1112.402 5556.8310546875 1112.37353515625 5 15 1.1.1.4794.3 1 62.7678 40200.5 62.6828 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; reduced HNE(H)@24; Dioxidation(M)@37; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 -0.000459403992863372 5897.01904296875 983.8438 5897.01953125 983.843872070313 6 15 1.1.1.4835.4 1 63.7634 326.127 63.8032 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.0854701027274132 5771.0732421875 962.8528 5770.98779296875 962.838623046875 6 14 1.1.1.4838.9 1 63.8372 276.9296 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0274864006787539 5851.07861328125 976.187 5851.05078125 976.182373046875 6 14 1.1.1.4839.9 1 63.8634 242.6023 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.134587004780769 5543.94384765625 1109.796 5543.810546875 1109.76940917969 5 16 1.1.1.4850.4 1 64.1328 3532.844 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20 missed K-I@20; missed K-L@40 0.146622002124786 5556.978515625 1112.403 5556.8310546875 1112.37353515625 5 15 1.1.1.4864.3 1 64.4775 4147.874 64.3114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.11931300163269 5540.90771484375 924.4919 5540.78857421875 924.472045898438 6 15 1.1.1.4873.2 1 64.6927 579.1005 64.5078 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0883378982543945 5590.93994140625 932.8306 5590.85205078125 932.81591796875 6 15 1.1.1.4717.8 1 60.8775 923.3138 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; Deamidated(N)@34; Dioxidation(M)@37 missed K-I@20; missed K-L@40 0.043784998357296 5627.8642578125 938.9847 5627.82080078125 938.977355957031 6 15 1.1.1.4720.5 1 60.9518 453.8615 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.115520000457764 5557.93017578125 927.329 5557.81494140625 927.309814453125 6 14 1.1.1.4741.8 1 61.4706 80585.42 61.6576 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Methyl(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.052827600389719 5580.9169921875 931.1601 5580.8642578125 931.151306152344 6 16 1.1.1.4746.3 1 61.591 1396.129 61.5852 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.137530997395515 5584.99853515625 1118.007 5584.8623046875 1117.97973632813 5 16 1.1.1.4772.6 1 62.245 1034.381 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0986706987023354 5577.9189453125 930.6604 5577.8203125 930.643981933594 6 14 1.1.1.4793.4 1 62.743 1934.015 62.6348 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.064987801015377 5579.86474609375 798.1308 5579.79931640625 798.121459960938 7 14 1.1.1.4800.3 1 62.909 928.1496 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.147937998175621 5539.95361328125 1108.998 5539.8046875 1108.96813964844 5 15 1.1.1.4816.5 1 63.3052 1364.014 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0721497982740402 5609.88232421875 935.9877 5609.81005859375 935.975646972656 6 13 1.1.1.4825.8 1 63.5166 405.7162 63.6557 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.141204997897148 5572.96826171875 1115.601 5572.826171875 1115.57250976563 5 14 1.1.1.4825.14 1 63.5241 604.6912 63.5079 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Dethiomethyl(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0771588981151581 5644.9931640625 941.8395 5644.91650390625 941.826721191406 6 15 1.1.1.4829.6 1 63.6136 717.998 63.7049 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.12593500316143 5584.98876953125 1118.005 5584.8623046875 1117.97973632813 5 16 1.1.1.4853.4 1 64.2101 386.5565 64.191 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.07255470007658 5568.939453125 929.1639 5568.86767578125 929.15185546875 6 16 1.1.1.4875.5 1 64.7445 2370.231 64.5591 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.10292000323534 5603.93896484375 934.9971 5603.8359375 934.979919433594 6 15 1.1.1.4877.6 1 64.8038 501.1468 64.7349 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.114078998565674 5565.9345703125 928.663 5565.8203125 928.643981933594 6 15 1.1.1.4882.3 1 64.919 648.6223 64.9834 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.111221998929977 5556.943359375 1112.396 5556.8310546875 1112.37353515625 5 14 1.1.1.5456.2 1 73.0606 551.3197 73.0657 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.121597997844219 5556.953125 1112.398 5556.8310546875 1112.37353515625 5 14 1.1.1.5540.3 1 74.3937 600.4254 74.4046 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; CHDH(D)@35; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0981149971485138 5933.13330078125 989.8628 5933.03515625 989.846435546875 6 17 1.1.1.4758.4 1 61.9024 3348.256 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.135636001825333 5556.96875 1112.401 5556.8310546875 1112.37353515625 5 14 1.1.1.4780.4 1 62.4368 60009.02 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Carbamyl(M)@37; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0238010995090008 5972.14892578125 996.3654 5972.12451171875 996.361389160156 6 15 1.1.1.4839.13 1 63.87 342.8177 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Deamidated(N)@17; Delta:H(2)C(2)(K)@20; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.101429000496864 5615.9375 936.9968 5615.8359375 936.979919433594 6 16 1.1.1.4871.4 1 64.6553 232.4436 64.6355 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0574369989335537 5627.95068359375 938.9991 5627.8935546875 938.989501953125 6 15 1.1.1.4876.3 1 64.7674 279.9569 64.7349 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; reduced acrolein addition +96(K)@20; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.106496997177601 5673.984375 946.6713 5673.8779296875 946.653564453125 6 14 1.1.1.4915.4 1 65.7491 276.9715 65.7542 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0595424994826317 5609.93896484375 802.4271 5609.87939453125 802.418640136719 7 16 1.1.1.4940.3 1 66.324 574.4912 66.3638 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; reduced acrolein addition +58(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0628255009651184 5587.92529296875 932.3281 5587.8623046875 932.317626953125 6 15 1.1.1.4711.7 1 60.7178 290.8726 60.6815 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0917735993862152 5778.05322265625 964.0162 5777.96142578125 964.000854492188 6 14 1.1.1.4717.12 1 60.8808 361.3135 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.100175999104977 5579.8994140625 930.9905 5579.79931640625 930.973876953125 6 14 1.1.1.4722.7 1 61.0038 809.8214 60.9955 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0657550990581512 5587.92822265625 932.3286 5587.8623046875 932.317626953125 6 15 1.1.1.4724.8 1 61.0548 1319.582 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.144791007041931 5556.9736328125 1112.402 5556.8310546875 1112.37353515625 5 14 1.1.1.4743.19 1 61.5293 66349.57 61.7062 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.13807700574398 5556.96875 1112.401 5556.8310546875 1112.37353515625 5 14 1.1.1.4787.4 1 62.6052 40812.5 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamidomethyl(K)@40 missed K-I@20; missed K-L@40 0.141942992806435 5557.96826171875 1112.601 5557.826171875 1112.57250976563 5 15 1.1.1.4806.4 1 63.0667 18028.96 63.0478 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +62(K)@20; Deamidated(N)@30; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.148514002561569 5565.92138671875 928.6608 5565.7724609375 928.636047363281 6 15 1.1.1.4822.3 1 63.4391 484.3021 63.6064 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0583774000406265 5580.8896484375 931.1555 5580.8310546875 931.145812988281 6 14 1.1.1.4839.5 1 63.8583 1186.982 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.0946917980909348 5884.119140625 981.6938 5884.0244140625 981.678039550781 6 14 1.1.1.4839.10 1 63.865 243.8528 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Methyl(H)@24 missed K-I@20; missed K-L@40 0.113975003361702 5572.978515625 1115.603 5572.8623046875 1115.57971191406 5 15 1.1.1.4842.2 1 63.9441 1226.065 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Delta:H(2)C(2)(H)@24; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0681198015809059 5606.9150390625 935.4931 5606.8466796875 935.481750488281 6 15 1.1.1.4867.3 1 64.5481 379.4039 64.6604 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Deamidated(N)@34; Dioxidation(M)@37; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.118979997932911 5804.0810546875 968.3541 5803.9619140625 968.334228515625 6 15 1.1.1.4717.13 1 60.8816 227.6248 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0291374009102583 5855.11083984375 976.8591 5855.08203125 976.854248046875 6 13 1.1.1.4743.13 1 61.5243 439.496 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.144791007041931 5556.9736328125 1112.402 5556.8310546875 1112.37353515625 5 14 1.1.1.4745.7 1 61.5776 67842.28 61.7545 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.135979995131493 5527.9384765625 1106.595 5527.8046875 1106.56823730469 5 15 1.1.1.4793.6 1 62.7497 1332.638 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; reduced HNE(H)@24; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.00975020974874496 5869.0712890625 979.1858 5869.06103515625 979.184143066406 6 13 1.1.1.4815.8 1 63.2742 267.1994 63.2651 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@12; reduced acrolein addition +58(K)@20; reduced HNE(H)@24; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.106026001274586 5794.0986328125 1159.827 5793.99267578125 1159.80578613281 5 12 1.1.1.4825.16 1 63.5274 916.4071 63.4837 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced HNE(H)@24; Ammonia-loss(N)@30; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0370022989809513 5669.9736328125 811.0035 5669.93701171875 810.998291015625 7 18 1.1.1.4712.3 1 60.741 248.839 60.7345 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.144791007041931 5556.9736328125 1112.402 5556.8310546875 1112.37353515625 5 14 1.1.1.4716.18 1 60.8592 3022.456 60.8668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] GlnThrGlyGly(K)@20; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 -0.0273928996175528 5942 991.3406 5942.02734375 991.345153808594 6 14 1.1.1.4717.16 1 60.8842 422.3107 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0407043993473053 5625.861328125 938.6508 5625.8203125 938.643981933594 6 13 1.1.1.4722.8 1 61.0046 553.0267 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.035096500068903 5619.8662109375 937.6516 5619.83056640625 937.645751953125 6 13 1.1.1.4753.4 1 61.7618 609.9846 61.7302 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@26; Dethiomethyl(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.137048006057739 5571.9638671875 1115.4 5571.82763671875 1115.37280273438 5 15 1.1.1.4764.4 1 62.0533 2379.282 62.0345 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@26; Dioxidation(M)@37 missed K-I@20; missed K-L@40 0.138935998082161 5571.93359375 1115.394 5571.79443359375 1115.3662109375 5 15 1.1.1.4771.5 1 62.2178 2780.822 62.1305 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0969462022185326 5597.94384765625 933.9979 5597.8466796875 933.981689453125 6 13 1.1.1.4811.6 1 63.1827 571.8521 63.1446 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.106518998742104 5562.92724609375 928.1618 5562.8203125 928.14404296875 6 13 1.1.1.4815.4 1 63.2701 1411.095 63.0961 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.0395704992115498 5794.0322265625 966.6793 5793.99267578125 966.672729492188 6 13 1.1.1.4822.8 1 63.4433 374.2809 63.4592 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.106026001274586 5794.0986328125 1159.827 5793.99267578125 1159.80578613281 5 14 1.1.1.4822.16 1 63.4525 916.4071 63.4837 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] Carbamyl(K)@40 missed K-I@20; missed K-L@40 0.141911000013351 5543.95361328125 1109.798 5543.810546875 1109.76940917969 5 15 1.1.1.4836.8 1 63.7932 5148.775 63.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; HexNAc(N)@26; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0885156989097595 5972.140625 996.364 5972.0517578125 996.349243164063 6 15 1.1.1.4858.8 1 64.3281 146.0855 64.3114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0754327997565269 5741.05322265625 821.1577 5740.9775390625 821.146911621094 7 14 1.1.1.4715.11 1 60.8274 310.7496 60.7875 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0786503031849861 5611.90380859375 936.3246 5611.82568359375 936.311584472656 6 13 1.1.1.4719.9 1 60.9297 432.8099 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 [trypsin fragment, 50 aa] Deamidated(N)@12; MDA adduct +62(K)@20; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0806728973984718 5601.90087890625 934.6574 5601.8203125 934.643981933594 6 13 1.1.1.4742.4 1 61.4921 911.7296 61.5361 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0728150010108948 5619.90380859375 937.6579 5619.83056640625 937.645751953125 6 13 1.1.1.4743.7 1 61.5193 516.0659 61.5361 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0984254032373428 5572.95849609375 1115.599 5572.85888671875 1115.5791015625 5 14 1.1.1.4750.6 1 61.7012 4273.531 61.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Hex(N)@34; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.100663997232914 5933.1416015625 989.8642 5933.041015625 989.847412109375 6 19 1.1.1.4776.7 1 62.3414 1392.07 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.053396500647068 5853.11962890625 976.5272 5853.06640625 976.518310546875 6 12 1.1.1.4838.10 1 63.838 331.0864 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.989999294281 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Dehydrated(T)@31; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0827376991510391 5594.96240234375 933.501 5594.8798828125 933.487243652344 6 15 1.1.1.4941.4 1 66.3587 424.5768 66.2853 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Deamidated(N)@34; Met->Hcy(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.09896519780159 5525.8876953125 921.9886 5525.7890625 921.972106933594 6 14 1.1.1.4709.6 1 60.6639 211.615 60.6284 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Deamidated(N)@12; MDA adduct +54(K)@20; Dethiomethyl(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.113347999751568 5561.92041015625 927.994 5561.806640625 927.975036621094 6 14 1.1.1.4717.6 1 60.8758 1712.626 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.112576998770237 5648.97021484375 942.5023 5648.857421875 942.483520507813 6 12 1.1.1.4720.6 1 60.9527 278.7857 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Ammonia-loss(N)@12; ONE addition +154(K)@20; reduced HNE(H)@24; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 0.0139974998310208 5950.12158203125 992.6942 5950.10791015625 992.69189453125 6 14 1.1.1.4739.12 1 61.4246 598.1434 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.160144999623299 5539.96337890625 1109 5539.8046875 1108.96813964844 5 14 1.1.1.4739.18 1 61.4296 1916.938 61.4371 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Oxidation(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0733055993914604 5905.1533203125 1182.038 5905.08251953125 1182.02368164063 5 13 1.1.1.4740.18 1 61.4543 1449.476 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced HNE(H)@24; Oxidation(M)@37; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.0754463002085686 5823.05859375 971.517 5822.98291015625 971.504455566406 6 13 1.1.1.4742.13 1 61.4996 320.4026 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.101049996912479 5542.95361328125 1109.598 5542.85205078125 1109.57763671875 5 14 1.1.1.4746.8 1 61.6019 16426.45 61.5114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.144791007041931 5556.9736328125 1112.402 5556.8310546875 1112.37353515625 5 13 1.1.1.4752.9 1 61.7491 68389.38 61.7545 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.137466996908188 5556.96875 1112.401 5556.8310546875 1112.37353515625 5 13 1.1.1.4759.4 1 61.9329 68276.99 61.8901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.131830006837845 5561.9306640625 927.9957 5561.798828125 927.973754882813 6 14 1.1.1.4766.2 1 62.0861 5097.853 62.0584 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.089190199971199 5579.888671875 930.9887 5579.79931640625 930.973876953125 6 13 1.1.1.4818.5 1 63.3495 767.4336 63.2651 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Dethiomethyl(M)@37; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 0.0782575011253357 5644.99462890625 941.8397 5644.91650390625 941.826721191406 6 13 1.1.1.4822.6 1 63.4416 605.0442 63.6801 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Carbamidomethyl(E)@13; acrolein addition +94(K)@20; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 0.106446996331215 5806.07421875 968.6863 5805.9677734375 968.668518066406 6 14 1.1.1.4832.9 1 63.6898 291.9907 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; Hex(N)@34; acrolein addition +112(K)@40 missed K-I@20; missed K-L@40 0.0175148006528616 5991.10009765625 999.524 5991.08251953125 999.521057128906 6 14 1.1.1.4837.12 1 63.821 571.9774 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.104818999767303 5593.919921875 933.3273 5593.81494140625 933.309814453125 6 13 1.1.1.4838.5 1 63.8338 496.6493 63.8278 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] acrolein addition +76(K)@20; reduced HNE(H)@24; HexNAc(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0321979001164436 5976.09375 997.0229 5976.06201171875 997.017578125 6 13 1.1.1.4838.12 1 63.8397 406.4391 63.7295 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Deamidated(N)@12; dHex(N)@17; reduced HNE(H)@24 missed K-I@20; missed K-L@40 0.0965515002608299 5806.07421875 968.6863 5805.9775390625 968.670166015625 6 15 1.1.1.4839.7 1 63.86 291.9907 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Hex(N)@30; Deamidated(N)@34; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0435662008821964 5990.0947265625 999.3564 5990.05126953125 999.34912109375 6 18 1.1.1.4839.14 1 63.8717 641.2855 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.137688994407654 5561.9365234375 927.9967 5561.798828125 927.973754882813 6 14 1.1.1.4847.3 1 64.0514 4009.315 64.0216 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.0802984014153481 5542.93359375 1109.594 5542.85205078125 1109.57763671875 5 14 1.1.1.4847.9 1 64.0648 1482.456 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] Deamidated(Q)@14; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.152566000819206 5557.96826171875 1112.601 5557.81494140625 1112.5703125 5 14 1.1.1.4873.3 1 64.6968 4089.711 64.4332 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.16015300154686 5583.00390625 1117.608 5582.84326171875 1117.57592773438 5 15 1.1.1.4873.4 1 64.701 13547.39 64.7103 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.135636001825333 5556.96875 1112.401 5556.8310546875 1112.37353515625 5 13 1.1.1.4879.5 1 64.8495 1354.522 64.5851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(2)C(2)(H)@24; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.1137880012393 5610.98828125 936.172 5610.87451171875 936.153076171875 6 15 1.1.1.4924.4 1 65.982 750.2943 66.0434 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8399982452393 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0245658997446299 5614.87646484375 936.82 5614.85205078125 936.81591796875 6 16 1.1.1.4721.9 1 60.9804 442.8581 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8399982452393 [trypsin fragment, 50 aa] acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0466208010911942 5576.88232421875 797.7048 5576.83642578125 797.698181152344 7 16 1.1.1.4744.4 1 61.5415 1108.467 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8399982452393 [trypsin fragment, 50 aa] HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0777157992124558 5672.9921875 946.506 5672.9150390625 946.493103027344 6 16 1.1.1.4897.3 1 65.2927 1447.169 65.3832 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.134693995118141 5654.0078125 943.3419 5653.87255859375 943.319396972656 6 13 1.1.1.4712.9 1 60.746 591.2803 60.7345 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] Methyl(H)@24 missed K-I@20; missed K-L@40 0.0465753003954887 5514.8671875 920.1518 5514.8203125 920.14404296875 6 13 1.1.1.4715.15 1 60.8307 230.2507 60.8668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] reduced HNE(H)@24; Deamidated(N)@34; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.00979033019393682 5753.97119140625 960.0025 5753.96142578125 960.000854492188 6 12 1.1.1.4718.11 1 60.906 207.9533 60.8668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; Oxidation(M)@37; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.125314995646477 5787.1083984375 965.5253 5786.98291015625 965.504455566406 6 13 1.1.1.4718.13 1 60.9077 351.9573 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0889168009161949 5585.935546875 931.9965 5585.8466796875 931.981689453125 6 14 1.1.1.4724.7 1 61.0532 846.123 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.149063006043434 5556.978515625 1112.403 5556.8310546875 1112.37353515625 5 13 1.1.1.4731.8 1 61.2325 4058.714 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Methyl(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.103440001606941 5573.94873046875 1115.797 5573.8466796875 1115.77661132813 5 14 1.1.1.4736.4 1 61.3544 2815.855 61.5852 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; Dethiomethyl(M)@37; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0749341025948524 5588.9638671875 1118.8 5588.89013671875 1118.78540039063 5 13 1.1.1.4758.6 1 61.909 1496.862 61.8026 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] reduced acrolein addition +96(K)@20; reduced HNE(H)@24; Phospho(T)@31; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.129987999796867 5933.16357421875 1187.64 5933.03271484375 1187.61376953125 5 15 1.1.1.4763.4 1 62.0294 1900.516 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; Hex(N)@34; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0889459028840065 5933.12939453125 989.8622 5933.041015625 989.847412109375 6 18 1.1.1.4771.4 1 62.2145 1714.557 62.1783 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.111896999180317 5584.97314453125 1118.002 5584.8623046875 1117.97973632813 5 14 1.1.1.4825.15 1 63.5258 442.1925 63.7049 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Dethiomethyl(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0137769002467394 5839.08203125 974.1876 5839.068359375 974.185363769531 6 13 1.1.1.4835.3 1 63.7609 309.6328 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0815517008304596 5620.9443359375 937.8313 5620.8623046875 937.817687988281 6 10 1.1.1.4839.6 1 63.8592 257.5604 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.124039001762867 5556.953125 1112.398 5556.8310546875 1112.37353515625 5 12 1.1.1.5734.14 1 77.7888 386.3439 77.7179 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 [trypsin fragment, 50 aa] Deamidated(N)@34; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0801813006401062 5529.89697265625 922.6568 5529.81689453125 922.643432617188 6 11 1.1.1.4712.6 1 60.7435 1198.191 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.1153249964118 5653.00390625 943.1746 5652.888671875 943.155395507813 6 12 1.1.1.4713.9 1 60.7724 610.6628 60.7345 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; reduced HNE(H)@24; Deamidated(N)@30; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0906530022621155 5744.06787109375 958.3519 5743.97705078125 958.336791992188 6 14 1.1.1.4716.15 1 60.8567 384.3109 60.8668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 [trypsin fragment, 50 aa] Deamidated(N)@17; MDA adduct +54(K)@20; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.146503999829292 5652.00341796875 943.0079 5651.85693359375 942.983459472656 6 13 1.1.1.4720.7 1 60.9535 523.035 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 [trypsin fragment, 50 aa] Ammonia-loss(N)@17; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.125634998083115 5541.943359375 1109.396 5541.8203125 1109.37133789063 5 14 1.1.1.4767.4 1 62.1212 5200.246 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.141204997897148 5572.96826171875 1115.601 5572.826171875 1115.57250976563 5 13 1.1.1.4833.10 1 63.7227 1182.736 63.901 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.116779997944832 5584.97900390625 1118.003 5584.8623046875 1117.97973632813 5 14 1.1.1.4840.10 1 63.8959 438.7843 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@40; Amidated@C-term missed K-I@20; missed K-L@40 0.106168001890182 5557.96826171875 1112.601 5557.86279296875 1112.57983398438 5 17 1.1.1.4843.4 1 63.968 29456.58 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.7399995326996 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.129609003663063 5572.95361328125 1115.598 5572.826171875 1115.57250976563 5 13 1.1.1.4849.6 1 64.113 921.2767 64.0698 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] Deamidated(N)@12; Deamidated(N)@30; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.124505996704102 5561.92333984375 927.9945 5561.798828125 927.973754882813 6 13 1.1.1.4743.6 1 61.5185 5667.745 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; Deamidated(N)@34; Delta:H(2)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0847046002745628 5581.89990234375 931.3239 5581.81494140625 931.309814453125 6 13 1.1.1.4753.3 1 61.7601 1598.917 61.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@28; Oxidation(M)@37 missed K-I@20; missed K-L@40 0.0873591974377632 5579.88671875 930.9884 5579.79931640625 930.973876953125 6 12 1.1.1.4760.6 1 61.9526 2100.307 61.9866 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0963103994727135 5527.90087890625 922.3241 5527.8046875 922.308044433594 6 16 1.1.1.4788.2 1 62.6181 2417.207 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.150970995426178 5572.978515625 1115.603 5572.826171875 1115.57250976563 5 13 1.1.1.4810.4 1 63.1636 1231.376 63.0961 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.152210995554924 5539.95849609375 1108.999 5539.8046875 1108.96813964844 5 13 1.1.1.4823.9 1 63.4761 1117.328 63.4592 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.152210995554924 5539.95849609375 1108.999 5539.8046875 1108.96813964844 5 13 1.1.1.4830.9 1 63.6473 1117.328 63.4592 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.15378700196743 5557.96826171875 1112.601 5557.81494140625 1112.5703125 5 13 1.1.1.4840.9 1 63.8934 29456.58 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; reduced acrolein addition +96(K)@20; reduced HNE(H)@24; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 -0.0709699019789696 5953.0478515625 993.1819 5953.11865234375 993.193725585938 6 13 1.1.1.4875.7 1 64.7495 126.8111 64.6104 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.126227006316185 5673.03857421875 1135.615 5672.9150390625 1135.59020996094 5 12 1.1.1.4881.5 1 64.9024 577.2719 64.9575 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.0872026979923248 5568.95458984375 929.1664 5568.86767578125 929.15185546875 6 14 1.1.1.4899.2 1 65.3409 266.6491 65.2798 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.124650001525879 5556.953125 1112.398 5556.8310546875 1112.37353515625 5 12 1.1.1.5604.6 1 75.3238 583.7358 75.3289 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.4300017356873 [trypsin fragment, 50 aa] Cation:Na(E)@13; hexanoyl addition +98(K)@20; reduced HNE(H)@24; ONE addition +154(K)@40 missed K-I@20; missed K-L@40 0.085326299071312 5933.17333984375 1187.642 5933.08984375 1187.62524414063 5 15 1.1.1.4753.10 1 61.7735 2514.318 61.6576 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.4300017356873 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.133193999528885 5556.9638671875 1112.4 5556.8310546875 1112.37353515625 5 10 1.1.1.5754.21 1 78.3084 429.0896 78.3134 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.2999980449677 [trypsin fragment, 50 aa] Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.13476000726223 5561.93359375 927.9962 5561.798828125 927.973754882813 6 13 1.1.1.4802.5 1 62.9675 3389.743 62.8508 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.2999980449677 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.128312006592751 5556.958984375 1112.399 5556.8310546875 1112.37353515625 5 12 1.1.1.5703.6 1 76.9896 583.4991 76.9682 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.1700003147125 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.136245995759964 5556.96875 1112.401 5556.8310546875 1112.37353515625 5 12 1.1.1.5746.16 1 78.1021 431.4894 78.1071 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.0300009250641 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Dethiomethyl(M)@37; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.118320003151894 5584.97900390625 1118.003 5584.85888671875 1117.97912597656 5 13 1.1.1.4803.6 1 62.9948 616.2102 62.9759 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.869998216629 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.144179999828339 5556.9736328125 1112.402 5556.8310546875 1112.37353515625 5 12 1.1.1.4801.4 1 62.9463 34914.11 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.869998216629 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.108232997357845 5579.90771484375 930.9919 5579.79931640625 930.973876953125 6 12 1.1.1.4832.7 1 63.6881 627.0703 63.6557 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.869998216629 [trypsin fragment, 50 aa] Trimethyl(K)@40 missed K-I@20; missed K-L@40 0.101659998297691 5542.95361328125 1109.598 5542.85205078125 1109.57763671875 5 13 1.1.1.4854.6 1 64.2342 921.1017 64.191 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.6999998092651 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.152566000819206 5557.96826171875 1112.601 5557.81494140625 1112.5703125 5 15 1.1.1.4857.6 1 64.3063 23004.74 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.5199997425079 [trypsin fragment, 50 aa] Carbamidomethyl(E)@13; MDA adduct +62(K)@20; reduced HNE(H)@24; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.104144997894764 5840.09228515625 974.356 5839.98828125 974.338684082031 6 13 1.1.1.4717.14 1 60.8825 259.2214 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.5199997425079 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; Deamidated(N)@34; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 -0.0104390997439623 5625.81005859375 804.6944 5625.8203125 804.695861816406 7 11 1.1.1.4718.3 1 60.8994 300.6645 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.5199997425079 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@30; Dethiomethyl(M)@37; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0824275016784668 5573.92578125 929.9949 5573.84326171875 929.981140136719 6 19 1.1.1.4809.6 1 63.1345 2049.006 63.1205 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.5199997425079 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.103385001420975 5598.9833984375 1120.804 5598.8779296875 1120.78283691406 5 11 1.1.1.4828.10 1 63.5997 393.8008 63.5079 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.3699986934662 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0624714009463787 5598.94091796875 934.1641 5598.8779296875 934.153625488281 6 15 1.1.1.4832.8 1 63.6889 715.1281 63.4347 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.3200023174286 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0795937031507492 5573.8896484375 797.2772 5573.81005859375 797.265869140625 7 11 1.1.1.4709.2 1 60.6606 169.2473 60.6549 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.3200023174286 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0815330967307091 5557.896484375 794.9925 5557.81494140625 794.980895996094 7 11 1.1.1.4904.3 1 65.4686 225.0943 65.3576 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.1000015735626 [trypsin fragment, 50 aa] acrolein addition +38(K)@20; reduced HNE(H)@24; Deamidated(N)@34; reduced acrolein addition +96(K)@40 missed K-I@20; missed K-L@40 0.106026001274586 5794.0986328125 1159.827 5793.99267578125 1159.80578613281 5 12 1.1.1.4829.14 1 63.6244 916.4071 63.4837 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.8699991703033 [trypsin fragment, 50 aa] ONE addition +154(K)@20; Dethiomethyl(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.0130741000175476 5644.9296875 941.8289 5644.91650390625 941.826721191406 6 11 1.1.1.4721.10 1 60.9813 310.5741 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.3500022888184 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.141204997897148 5572.96826171875 1115.601 5572.826171875 1115.57250976563 5 12 1.1.1.4744.18 1 61.5531 3293.252 61.5607 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.3500022888184 [trypsin fragment, 50 aa] Delta:H(2)C(2)(H)@4; MDA adduct +54(K)@20; Deamidated(N)@34; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.0350202992558479 5635.86083984375 940.3174 5635.82568359375 940.311584472656 6 12 1.1.1.4874.6 1 64.7265 312.0733 64.6856 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 [trypsin fragment, 50 aa] acrolein addition +94(K)@20; acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.0735030993819237 5688.9619140625 949.1676 5688.888671875 949.155395507813 6 10 1.1.1.4720.8 1 60.9543 200.819 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 [trypsin fragment, 50 aa] Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.124505996704102 5561.92333984375 927.9945 5561.798828125 927.973754882813 6 12 1.1.1.4750.4 1 61.6945 5667.745 61.6822 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.150970995426178 5572.978515625 1115.603 5572.826171875 1115.57250976563 5 12 1.1.1.4817.6 1 63.3328 934.7301 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; reduced HNE(H)@24; Carbamyl(M)@37; hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0238010995090008 5972.14892578125 996.3654 5972.12451171875 996.361389160156 6 14 1.1.1.4838.11 1 63.8389 342.8177 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 [trypsin fragment, 50 aa] Oxidation(M)@37; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.141816005110741 5572.96826171875 1115.601 5572.826171875 1115.57250976563 5 12 1.1.1.4853.3 1 64.2043 735.9659 64.191 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 [trypsin fragment, 50 aa] Deamidated(N)@28; Deamidated(N)@30; Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.124140001833439 5561.9228515625 927.9944 5561.798828125 927.973754882813 6 12 1.1.1.4857.3 1 64.2963 3690.503 64.0457 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.106268003582954 5568.99365234375 1114.806 5568.88525390625 1114.78430175781 5 12 1.1.1.4879.6 1 64.8528 1534.202 64.5851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.3800022602081 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.100910998880863 5584.96337890625 1118 5584.8623046875 1117.97973632813 5 12 1.1.1.4827.10 1 63.5766 459.1304 63.7295 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; MDA adduct +62(K)@40 missed K-I@20; missed K-L@40 0.0163682997226715 5620.87841796875 937.8204 5620.8623046875 937.817687988281 6 15 1.1.1.4718.10 1 60.9052 348.3701 60.9448 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0214571002870798 5598.89990234375 934.1572 5598.8779296875 934.153625488281 6 14 1.1.1.4739.8 1 61.4212 699.8553 61.5361 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0507671982049942 5612.90771484375 936.4919 5612.857421875 936.483520507813 6 15 1.1.1.4742.5 1 61.493 715.9046 61.5361 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.0847987979650497 5556.916015625 927.1599 5556.8310546875 927.145812988281 6 15 1.1.1.4839.4 1 63.8575 27019.03 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 [trypsin fragment, 50 aa] MDA adduct +54(K)@20; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.000475242006359622 5610.8427734375 802.5562 5610.841796875 802.556091308594 7 14 1.1.1.4840.2 1 63.8809 348.2947 63.8278 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.9400017261505 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0389389991760254 5558.8857421875 795.1338 5558.8466796875 795.128234863281 7 14 1.1.1.4875.3 1 64.7412 389.2856 64.6604 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.6800003051758 [trypsin fragment, 50 aa] Oxidation(M)@37; MDA adduct +62(K)@40; Deamidated(N)@48 missed K-I@20; missed K-L@40 0.10054200142622 5579.89990234375 930.9906 5579.79931640625 930.973876953125 6 11 1.1.1.4825.6 1 63.5149 674.6273 63.5571 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.6800003051758 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.128922000527382 5556.958984375 1112.399 5556.8310546875 1112.37353515625 5 11 1.1.1.5724.8 1 77.5407 494.7325 77.4694 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.1699991226196 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; Deamidated(N)@34; Dethiomethyl(M)@37; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0914610996842384 5569.95849609375 1114.999 5569.869140625 1114.98107910156 5 12 1.1.1.4741.16 1 61.4798 918.4651 61.5361 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.1699991226196 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@20; reduced HNE(H)@24; MDA adduct +54(K)@40; HexNAc(S)@42 missed K-I@20; missed K-L@40 0.0620598010718822 5974.12939453125 996.6955 5974.0673828125 996.685180664063 6 12 1.1.1.4822.12 1 63.4466 329.2358 63.3378 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.6199972629547 [trypsin fragment, 50 aa] Met->Hcy(M)@37; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.113651998341084 5524.91845703125 921.827 5524.8046875 921.80810546875 6 12 1.1.1.4726.11 1 61.1065 304.1334 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.0199990272522 [trypsin fragment, 50 aa] Deamidated(N)@34; Oxidation(M)@37; MDA adduct +54(K)@40 missed K-I@20; missed K-L@40 0.146870002150536 5571.943359375 1115.396 5571.79443359375 1115.3662109375 5 12 1.1.1.4803.5 1 62.9914 1204.76 62.9033 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 91.3800001144409 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@20; Dethiomethyl(M)@37; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.0608118996024132 5578.96875 1116.801 5578.90576171875 1116.78845214844 5 12 1.1.1.4816.6 1 63.3085 328.1473 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.6799972057343 [trypsin fragment, 50 aa] acrolein addition +56(K)@20; Delta:H(4)C(2)(K)@40 missed K-I@20; missed K-L@40 0.128376007080078 5584.98876953125 1118.005 5584.8623046875 1117.97973632813 5 12 1.1.1.4815.11 1 63.2793 407.0275 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.110936999320984 5638.962890625 940.8344 5638.85205078125 940.81591796875 6 10 1.1.1.4716.13 1 60.8551 228.2688 60.8668 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 [trypsin fragment, 50 aa] acrolein addition +112(K)@20; reduced HNE(H)@24; Dioxidation(M)@37; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0296641997992992 5975.11767578125 996.8602 5975.087890625 996.855224609375 6 11 1.1.1.4743.16 1 61.5268 363.4881 61.6335 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 [trypsin fragment, 50 aa] Deamidated(N)@34; reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.137586995959282 5559.96826171875 1113.001 5559.83056640625 1112.97338867188 5 11 1.1.1.4836.10 1 63.7982 11815.39 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 [trypsin fragment, 50 aa] HexNAc(N)@17; ONE addition +154(K)@20; acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 -0.00321878003887832 5895.99609375 983.6733 5895.99951171875 983.673828125 6 16 1.1.1.4849.3 1 64.103 293.6485 64.094 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.2700026035309 [trypsin fragment, 50 aa] reduced HNE(H)@24; Deamidated(N)@34 missed K-I@20; missed K-L@40 0.0509284995496273 5659.970703125 944.3357 5659.91943359375 944.327209472656 6 9 1.1.1.4721.11 1 60.9821 215.2613 60.8934 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3399972915649 [trypsin fragment, 50 aa] HPNE addition +172(K)@20; Delta:H(4)C(2)(H)@24; HPNE addition +172(K)@40 missed K-I@20; missed K-L@40 0.0023781000636518 5873.05810546875 979.8503 5873.05615234375 979.849975585938 6 11 1.1.1.4717.15 1 60.8833 284.0243 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 87.3399972915649 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.153175994753838 5557.96826171875 1112.601 5557.81494140625 1112.5703125 5 18 1.1.1.4829.12 1 63.6211 13734.2 63.6064 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.3699972629547 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0755525976419449 5558.92236328125 927.4943 5558.8466796875 927.481750488281 6 13 1.1.1.4773.2 1 62.2548 46062.6 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.3699972629547 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0210909005254507 5598.89990234375 934.1572 5598.8779296875 934.153625488281 6 13 1.1.1.4858.4 1 64.3189 282.3722 64.3114 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.3499999046326 [trypsin fragment, 50 aa] MDA adduct +62(K)@20; reduced HNE(H)@24; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0844926983118057 5797.06689453125 967.1851 5796.982421875 967.171020507813 6 9 1.1.1.4711.9 1 60.7195 285.0949 60.9195 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 85.2800011634827 [trypsin fragment, 50 aa] Oxidation(M)@37; Carbamidomethyl(K)@40 missed K-I@20; missed K-L@40 0.0657968968153 5573.8876953125 797.2769 5573.8212890625 797.267456054688 7 13 1.1.1.4862.5 1 64.4206 228.6273 64.3356 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 82.940000295639 [trypsin fragment, 50 aa] acrolein addition +56(K)@40 missed K-I@20; missed K-L@40 0.13502499461174 5556.96875 1112.401 5556.8310546875 1112.37353515625 5 9 1.1.1.5762.18 1 78.519 373.1504 78.4184 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 81.6399991512299 [trypsin fragment, 50 aa] acrolein addition +38(K)@40 missed K-I@20; missed K-L@40 0.137722000479698 5538.95849609375 1108.799 5538.8203125 1108.77136230469 5 10 1.1.1.4725.20 1 61.089 897.5317 61.1199 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 66.1400020122528 [trypsin fragment, 50 aa] ONE addition +154(K)@20; reduced HNE(H)@24; Hex(N)@34 missed K-I@20; missed K-L@40 0.00622744997963309 5975.09423828125 996.8563 5975.087890625 996.855224609375 6 13 1.1.1.4834.9 1 63.7488 395.4541 63.7049 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 52.5499999523163 [trypsin fragment, 50 aa] acrolein addition +94(K)@40 missed K-I@20; missed K-L@40 0.0254838000983 5594.8720703125 800.2747 5594.8466796875 800.271118164063 7 12 1.1.1.4716.5 1 60.8484 732.0587 60.9702 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.9300001859665 [trypsin fragment, 50 aa] Deamidated(N)@34; acrolein addition +76(K)@40 missed K-I@20; missed K-L@40 0.0998696982860565 5577.91845703125 1116.591 5577.8203125 1116.5712890625 5 8 1.1.1.4740.17 1 61.4534 836.1001 61.5361 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.8799986839294 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.0599079988896847 5598.93798828125 934.1636 5598.8779296875 934.153625488281 6 12 1.1.1.4825.7 1 63.5158 651.543 63.5325 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.8299987316132 [trypsin fragment, 50 aa] reduced acrolein addition +58(K)@40 missed K-I@20; missed K-L@40 0.0799470022320747 5558.92724609375 927.4951 5558.8466796875 927.481750488281 6 12 1.1.1.4794.2 1 62.762 33373.32 62.5862 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 20.890000462532 [trypsin fragment, 50 aa] hexanoyl addition +98(K)@40 missed K-I@20; missed K-L@40 0.125357002019882 5599.00341796875 1120.808 5598.8779296875 1120.78283691406 5 9 1.1.1.4815.12 1 63.2809 459.7654 63.2893 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Oxidation(P)@4 0.00371345994062722 1060.55505371094 531.2848 1060.55126953125 531.282897949219 2 11 1.1.1.3246.7 1 25.8741 1311.018 26.0998 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR 0.00463051022961736 1044.56103515625 523.2878 1044.55639648438 523.285461425781 2 14 1.1.1.3249.6 1 25.9434 73464.3 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Oxidation(P)@4 0.00151629000902176 1060.55285644531 531.2837 1060.55126953125 531.282897949219 2 12 1.1.1.3253.5 1 26.0405 1677.712 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 0.0219104997813702 1045.5625 523.7885 1045.54040527344 523.777465820313 2 14 1.1.1.3255.3 1 26.0847 23651.29 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR 0.00463051022961736 1044.56103515625 523.2878 1044.55639648438 523.285461425781 2 17 1.1.1.3256.3 1 26.1084 73643.72 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Pro->pyro-Glu(P)@4 0.00334508996456862 1058.5390625 530.2768 1058.53564453125 530.275085449219 2 12 1.1.1.3260.3 1 26.2076 1899.49 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Oxidation(P)@4 0.00151629000902176 1060.55285644531 531.2837 1060.55126953125 531.282897949219 2 13 1.1.1.3261.6 1 26.2338 1677.712 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 0.00396698992699385 1045.54443359375 523.7795 1045.54040527344 523.777465820313 2 15 1.1.1.3280.4 1 26.6774 6802.054 26.7864 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 0.00396698992699385 1045.54443359375 523.7795 1045.54040527344 523.777465820313 2 16 1.1.1.3288.2 1 26.8678 6802.054 26.7864 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Deamidated(N)@8 0.00592001993209124 1045.54650878906 523.7805 1045.54040527344 523.777465820313 2 13 1.1.1.3295.14 1 27.0385 1915.246 27.0485 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Delta:H(2)C(2)@N-term 0.0138785997405648 1070.58581542969 536.3002 1070.57202148438 536.293273925781 2 11 1.1.1.3388.6 1 28.9463 306.4659 28.9115 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Dehydrated(S)@2 -0.000433139997767285 1026.54553222656 514.28 1026.54577636719 514.280151367188 2 7 1.1.1.3254.2 1 26.056 155.4257 26.0998 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 LSSPATLNSR Delta:H(2)C(2)@N-term 0.00155009003356099 1070.57373046875 536.2941 1070.57202148438 536.293273925781 2 8 1.1.1.3410.20 1 29.4772 296.9546 29.5549 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.8799998760223 LSSPATLNSR 0.00475256983190775 1044.56103515625 523.2878 1044.55639648438 523.285461425781 2 8 1.1.1.3232.4 1 25.5206 119.6382 25.5357 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.6399997472763 LSSPATLNSR 0.00780418980866671 1044.56433105469 523.2894 1044.55639648438 523.285461425781 2 9 1.1.1.3576.6 1 33.4478 113.8706 33.3347 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.4499999284744 LSSPATLNSR Pro->pyro-Glu(P)@4 0.0056643201969564 1058.54150390625 530.278 1058.53564453125 530.275085449219 2 11 1.1.1.3252.2 1 26.0234 1907.443 26.0761 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 40.4399991035461 LSSPATLNSR 0.00438637984916568 1044.56091308594 523.2877 1044.55639648438 523.285461425781 2 11 1.1.1.3242.4 1 25.7746 46913.08 25.9809 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.8699988126755 LSSPATLNSR 0.00780418980866671 1044.56433105469 523.2894 1044.55639648438 523.285461425781 2 10 1.1.1.3169.2 1 24.0009 78.9297 24.0144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.390000462532 LSSPATLNSR Dioxidation(P)@4 0.0058500599116087 1076.55212402344 539.2833 1076.54614257813 539.280395507813 2 11 1.1.1.3257.2 1 26.1297 2765.76 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 31.3699990510941 LSSPATLNSR 0.00463051022961736 1044.56103515625 523.2878 1044.55639648438 523.285461425781 2 10 1.1.1.3272.4 1 26.4932 537.5966 26.4789 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 30.7500004768372 LSSPATLNSR 0.00841450970619917 1044.56481933594 523.2897 1044.55639648438 523.285461425781 2 7 1.1.1.3522.14 1 32.157 76.8772 32.1378 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 26.3300001621246 LSSPATLNSR 0.00402018986642361 1044.56042480469 523.2875 1044.55639648438 523.285461425781 2 10 1.1.1.3183.4 1 24.3483 112.0233 24.3286 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.3900002837181 LSSPATLNSR 0.00463051022961736 1044.56103515625 523.2878 1044.55639648438 523.285461425781 2 10 1.1.1.3258.2 1 26.1575 73643.72 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 LSSPATLNSR Dioxidation(P)@4 0.0058500599116087 1076.55212402344 539.2833 1076.54614257813 539.280395507813 2 10 1.1.1.3250.7 1 25.9692 2765.76 26.1235 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NIDVLEGNEQFINAAK cleaved H-N@N-term 0.0336514003574848 1773.92346191406 887.969 1773.88977050781 887.9521484375 2 24 1.1.1.4243.6 1 49.2945 873.043 49.3811 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.589999973774 NKPGVYTK -0.00186782004311681 905.495300292969 453.7549 905.4970703125 453.755798339844 2 8 1.1.1.2620.2 1 15.8458 130.6831 15.857 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +56(K)@2; acrolein addition +76(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 0.045821700245142 2813.43041992188 938.8174 2813.384765625 938.802185058594 3 22 1.1.1.4739.9 1 61.4221 2057.354 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.048718698322773 2855.4443359375 952.822 2855.39526367188 952.8056640625 3 22 1.1.1.4920.4 1 65.8764 2918.308 66.0174 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0489018000662327 2855.4443359375 952.822 2855.39526367188 952.8056640625 3 23 1.1.1.4927.4 1 66.0643 3006.221 66.0843 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0492679998278618 2855.4443359375 952.8221 2855.39526367188 952.8056640625 3 23 1.1.1.4937.3 1 66.2477 2389.029 66.2322 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0489018000662327 2855.4443359375 952.822 2855.39526367188 952.8056640625 3 23 1.1.1.4944.3 1 66.4367 3457.609 66.598 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0489018000662327 2855.4443359375 952.822 2855.39526367188 952.8056640625 3 23 1.1.1.4951.4 1 66.619 3457.609 66.598 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0489018000662327 2855.4443359375 952.822 2855.39526367188 952.8056640625 3 24 1.1.1.4959.4 1 66.7919 3457.609 66.598 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0106650004163384 2855.40625 714.8588 2855.39526367188 714.856079101563 4 20 1.1.1.4945.2 1 66.4495 473.7695 66.5717 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Trioxidation(Y)@6; hexanoyl addition +98(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 0.0334963016211987 2827.4189453125 943.4802 2827.38500976563 943.468994140625 3 21 1.1.1.4947.2 1 66.5061 499.9731 66.2853 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +76(K)@2; No Carbamidomethyl(C)@10 missed K-V@8 0.0265234000980854 2699.37963867188 900.8005 2699.35302734375 900.791625976563 3 20 1.1.1.4737.2 1 61.3714 626.8759 61.4126 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN MDA adduct +54(K)@2; Oxidation(P)@3; acrolein addition +76(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 0.0555411018431187 2827.41967773438 943.4805 2827.36401367188 943.4619140625 3 20 1.1.1.4915.3 1 65.7433 391.8266 65.8857 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; MDA adduct +54(K)@2; Oxidation(P)@3; acrolein addition +76(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0504143014550209 2827.41455078125 943.4788 2827.36401367188 943.4619140625 3 20 1.1.1.4930.3 1 66.1066 329.5476 66.1379 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Carbamidomethyl@N-term; MDA adduct +62(K)@2; acrolein addition +56(K)@8; Carbamidomethyl(C)@10; Deamidated(Q)@18 missed K-V@8 0.047333899885416 2856.43774414063 953.1532 2856.39038085938 953.137451171875 3 20 1.1.1.4972.3 1 67.0351 463.9893 66.9872 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +112(K)@2; MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0118856001645327 2855.4072265625 714.8591 2855.39526367188 714.856079101563 4 18 1.1.1.4923.2 1 65.9599 448.747 66.0772 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; Hydroxytrimethyl(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 0.0362914018332958 2741.39697265625 914.8063 2741.36083984375 914.794250488281 3 20 1.1.1.4924.3 1 65.9779 475.7586 66.1379 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +76(K)@2; Oxidation(P)@3; MDA adduct +54(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 0.0546256005764008 2827.4189453125 943.4802 2827.36401367188 943.4619140625 3 19 1.1.1.4938.4 1 66.276 499.9731 66.2853 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +56(K)@2; acrolein addition +76(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 0.0465540997684002 2813.43115234375 938.8177 2813.384765625 938.802185058594 3 16 1.1.1.4761.5 1 61.9816 1281.938 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +56(K)@2; Carbamidomethyl(C)@10; Trp->Kynurenin(W)@15 missed K-V@8 0.0479520000517368 2741.39624023438 914.806 2741.34838867188 914.7900390625 3 17 1.1.1.4940.4 1 66.3282 514.0659 66.2322 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 NKPGVYTKVCNYVNWIQQTIAAN MDA adduct +54(K)@2; Oxidation(P)@3; acrolein addition +76(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@14 missed K-V@8 0.0555411018431187 2827.41967773438 943.4805 2827.36401367188 943.4619140625 3 15 1.1.1.4922.7 1 65.9334 391.8266 65.8857 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 NKPGVYTKVCNYVNWIQQTIAAN Carbamidomethyl@N-term; acrolein addition +76(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@14 missed K-V@8 0.0495635010302067 2814.4296875 939.1505 2814.3798828125 939.133911132813 3 12 1.1.1.4745.4 1 61.5701 1827.495 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 NKPGVYTKVCNYVNWIQQTIAAN Deamidated(N)@1; acrolein addition +56(K)@2; acrolein addition +76(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0494837015867233 2813.43432617188 938.8187 2813.384765625 938.802185058594 3 11 1.1.1.4752.6 1 61.7416 1310.26 61.7785 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 90.8500015735626 NKPGVYTKVCNYVNWIQQTIAAN MDA adduct +62(K)@8; Carbamidomethyl(C)@10 missed K-V@8 0.0421134009957314 2742.40087890625 915.1409 2742.35888671875 915.126892089844 3 13 1.1.1.4918.2 1 65.8275 283.5707 65.6756 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 78.8100004196167 NKPGVYTKVCNYVNWIQQTIAAN acrolein addition +56(K)@2; acrolein addition +76(K)@8; Carbamidomethyl(C)@10; Deamidated(N)@11 missed K-V@8 0.0215300992131233 2813.40625 704.3588 2813.384765625 704.353454589844 4 8 1.1.1.4741.2 1 61.4656 257.7292 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 28.2000005245209 NSRVATVSLPR Dehydrated(S)@2 cleaved L-N@N-term; missed R-V@3 0.00333239999599755 1180.67102050781 591.3428 1180.66760253906 591.341125488281 2 10 1.1.1.3435.6 1 30.0755 256.526 30.0326 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.6199994087219 PNFNGNTLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@16 cleaved H-P@N-term; missed K-L@16 0.0289753004908562 2872.50439453125 958.5087 2872.47534179688 958.4990234375 3 12 1.1.1.4743.9 1 61.521 213.7208 61.4865 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.1899998188019 QVRLGEHNIDVLEGNEQFINAAK Arg->GluSA(R)@3 cleaved I-Q@N-term; missed R-L@3 0.0262068994343281 2550.29760742188 851.1065 2550.271484375 851.097778320313 3 10 1.1.1.4152.12 1 47.1018 159.5819 47.0898 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; Deamidated(N)@31; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0256855990737677 5895.99609375 983.6733 5896.02197265625 983.677551269531 6 19 1.1.1.4849.3 1 64.103 293.6485 64.094 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@23; Deamidated(N)@33; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.0300421006977558 5975.09423828125 996.8563 5975.06396484375 996.851257324219 6 17 1.1.1.4834.9 1 63.7488 395.4541 63.7049 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.121991999447346 5933.17333984375 1187.642 5933.05322265625 1187.61791992188 5 17 1.1.1.4753.10 1 61.7735 2514.318 61.6576 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(Q)@1; reduced acrolein addition +58(K)@23; Deamidated(N)@33; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.0741053000092506 5972.14892578125 996.3654 5972.07421875 996.352966308594 6 17 1.1.1.4838.11 1 63.8389 342.8177 63.8768 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.0763750970363617 5933.12939453125 989.8622 5933.05322265625 989.849487304688 6 19 1.1.1.4771.4 1 62.2145 1714.557 62.1783 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Deamidated(N)@20; acrolein addition +76(K)@23; Deamidated(N)@31; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.030995300039649 5990.0947265625 999.3564 5990.0634765625 999.351196289063 6 19 1.1.1.4839.14 1 63.8717 641.2855 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR MDA adduct +62(K)@23; Deamidated(N)@33; Deamidated(N)@37; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.0739478021860123 5976.1220703125 997.0276 5976.0478515625 997.015258789063 6 16 1.1.1.4896.5 1 65.268 199.3042 65.3319 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.0880934968590736 5933.1416015625 989.8642 5933.05322265625 989.849487304688 6 19 1.1.1.4776.7 1 62.3414 1392.07 62.2745 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.0796708986163139 5933.13330078125 989.8628 5933.05322265625 989.849487304688 6 16 1.1.1.4758.4 1 61.9024 3348.256 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; reduced acrolein addition +96(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.00494393985718489 5991.10009765625 999.524 5991.09521484375 999.523132324219 6 14 1.1.1.4837.12 1 63.821 571.9774 63.8523 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; reduced acrolein addition +58(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 -0.0318990983068943 5953.0478515625 993.1819 5953.07958984375 993.187194824219 6 14 1.1.1.4875.7 1 64.7495 126.8111 64.6104 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.5400021076202 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23; Delta:H(4)C(2)(K)@43 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.109174996614456 5933.16357421875 1187.64 5933.05322265625 1187.61791992188 5 14 1.1.1.4763.4 1 62.0294 1900.516 61.8661 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 88.2700026035309 QVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Gln->pyro-Glu@N-term; acrolein addition +38(K)@23 cleaved I-Q@N-term; missed R-L@3; missed K-I@23; missed K-L@43 0.0883110985159874 5905.1103515625 985.1923 5905.02197265625 985.177612304688 6 19 1.1.1.4740.10 1 61.4476 3279.603 61.4618 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.9099979400635 RIQVRLGEHNIDVLEGNEQFINAAK Deamidated(Q)@3; reduced HNE(H)@9; Ammonia-loss(N)@10 cleaved S-R@N-term; missed R-I@1; missed R-L@5 -0.0303687993437052 3004.56762695313 752.1492 3004.59814453125 752.156799316406 4 14 1.1.1.4284.7 1 50.3044 388.6494 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.4799981117249 RIQVRLGEHNIDVLEGNEQFINAAK Diphthamide(H)@9 cleaved S-R@N-term; missed R-I@1; missed R-L@5 -0.0107728000730276 3004.61010742188 1002.544 3004.62060546875 1002.54748535156 3 12 1.1.1.4283.20 1 50.2792 301.393 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 RIQVRLGEHNIDVLEGNEQFINAAK Delta:H(2)C(2)@N-term cleaved S-R@N-term; missed R-I@1; missed R-L@5 0.0299050994217396 2888.55541992188 963.8591 2888.52563476563 963.849182128906 3 8 1.1.1.4162.16 1 47.3492 632.6055 47.2365 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 RIQVRLGEHNIDVLEGNEQFINAAKIITHPNFNGNTLDNDIMLIKLSSPATLNSR Dioxidation(R)@5; reduced HNE(H)@9; reduced acrolein addition +58(K)@25; Delta:H(4)C(2)(K)@45 cleaved S-R@N-term; missed R-I@1; missed R-L@5; missed K-I@25; missed K-L@45 0.0579458996653557 6429.47265625 1072.586 6429.41162109375 1072.57592773438 6 19 1.1.1.4733.8 1 61.2859 5543.036 61.3152 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 45.6099987030029 RLGEHNIDVLEGNEQFINAAK reduced HNE(H)@5 cleaved V-R@N-term; missed R-L@1 -0.0593224987387657 2524.26953125 842.4304 2524.32861328125 842.450134277344 3 12 1.1.1.4156.13 1 47.2004 1568.231 47.1878 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.4499999284744 RLGEHNIDVLEGNEQFINAAK reduced HNE(H)@5 cleaved V-R@N-term; missed R-L@1 -0.0602380000054836 2524.2685546875 842.4301 2524.32861328125 842.450134277344 3 12 1.1.1.4149.18 1 47.0329 1596.288 47.1144 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term 0.0732771977782249 3807.87573242188 952.9762 3807.80249023438 952.957885742188 4 14 1.1.1.4327.7 1 51.3505 17239.66 51.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Carbamidomethyl(C)@31; Carbamidomethyl(Y)@32; hexanoyl addition +98(K)@33 cleaved N-S@N-term 0.0620438009500504 3807.87573242188 952.9762 3807.81372070313 952.960693359375 4 15 1.1.1.4329.8 1 51.4036 17239.66 51.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 95.7300007343292 SIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Carbamidomethyl(C)@15; Deamidated(N)@21; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term 0.0732771977782249 3807.87573242188 952.9762 3807.80249023438 952.957885742188 4 11 1.1.1.4338.18 1 51.6227 17239.66 51.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 SPATLNSR cleaved S-S@N-term -0.00350572005845606 844.436889648438 423.2257 844.440307617188 423.227416992188 2 9 1.1.1.2937.2 1 19.2631 442.4028 19.1256 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 SPATLNSR cleaved S-S@N-term -0.00185785000212491 844.4384765625 423.2265 844.440307617188 423.227416992188 2 6 1.1.1.3250.2 1 25.9609 180.4691 26.0998 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 SRIQVRLGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Delta:H(2)C(2)(H)@10; Deamidated(N)@11 missed R-I@2; missed R-L@6 -0.00521674007177353 3004.56762695313 752.1492 3004.57299804688 752.150512695313 4 15 1.1.1.4284.7 1 50.3044 388.6494 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.1700003147125 SRIQVRLGEHNIDVLEGNEQFINAAK Delta:H(4)C(2)@N-term; Delta:H(2)C(2)(H)@10; Deamidated(N)@11 missed R-I@2; missed R-L@6 0.0368461012840271 3004.61010742188 1002.544 3004.57299804688 1002.53161621094 3 13 1.1.1.4283.20 1 50.2792 301.393 50.2851 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 SSPATLNSR cleaved L-S@N-term -0.000337092991685495 931.472045898438 466.7433 931.472290039063 466.743438720703 2 11 1.1.1.2963.2 1 19.814 1219.103 19.8753 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.0197889991104603 2229.2236328125 744.0818 2229.20385742188 744.075256347656 3 26 1.1.1.4423.5 1 53.6751 18102.7 53.7714 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10; Deamidated(N)@18 cleaved N-T@N-term; missed K-L@10 0.0265219006687403 2230.21411132813 744.412 2230.18798828125 744.403259277344 3 24 1.1.1.4437.6 1 54.0324 1331.307 54.0755 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR cleaved N-T@N-term; missed K-L@10 0.0188248995691538 2201.19116210938 734.7377 2201.17260742188 734.7314453125 3 14 1.1.1.4419.6 1 53.5727 381.569 53.6158 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.0202165991067886 2245.21899414063 749.4136 2245.19873046875 749.406860351563 3 17 1.1.1.4333.5 1 51.4943 795.9186 51.6053 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Oxidation(M)@7; Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 0.0202165991067886 2245.21899414063 749.4136 2245.19873046875 749.406860351563 3 17 1.1.1.4340.8 1 51.6664 795.9186 51.6053 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10 cleaved N-T@N-term; missed K-L@10 -0.0111106997355819 2229.19287109375 558.3055 2229.20385742188 558.308227539063 4 17 1.1.1.4426.5 1 53.753 838.1141 53.7714 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 98.8300025463104 TLDNDIMLIKLSSPATLNSR Delta:H(4)C(2)(K)@10; Deamidated(N)@18 cleaved N-T@N-term; missed K-L@10 0.027437400072813 2230.21533203125 744.4124 2230.18798828125 744.403259277344 3 11 1.1.1.4444.4 1 54.21 367.3114 54.255 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.000507603981532156 857.496704101563 429.7556 857.4970703125 429.755798339844 2 9 1.1.1.3200.2 1 24.7557 132.7059 24.8207 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.000324508000630885 857.496704101563 429.7556 857.4970703125 429.755798339844 2 11 1.1.1.3430.5 1 29.9417 10248.04 30.0326 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0225398000329733 842.508666992188 422.2616 842.486145019531 422.250366210938 2 11 1.1.1.3431.5 1 29.9662 214999.8 30.0326 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 -0.000559727021027356 823.491088867188 412.7528 823.491577148438 412.753082275391 2 11 1.1.1.3435.2 0 30.0621 33314.94 30.1286 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.000507603981532156 857.496704101563 429.7556 857.4970703125 429.755798339844 2 11 1.1.1.3437.5 1 30.1102 12625.78 30.1527 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.00102711003273726 823.49267578125 412.7536 823.491577148438 412.753082275391 2 12 1.1.1.3442.2 0 30.2303 30918.67 30.2248 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Pro->pyro-Glu(P)@7 0.000226443997235037 855.481689453125 428.7481 855.4814453125 428.747985839844 2 12 1.1.1.3442.4 1 30.237 21918.07 30.1527 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.000934829993639141 857.49609375 429.7553 857.4970703125 429.755798339844 2 12 1.1.1.3444.4 1 30.2782 12047.3 30.3207 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 -0.000781255017500371 873.491271972656 437.7529 873.492004394531 437.753265380859 2 13 1.1.1.3444.5 1 30.2799 21071.11 30.3207 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0227228999137878 842.508850097656 422.2617 842.486145019531 422.250366210938 2 11 1.1.1.3445.6 1 30.3039 243235.9 30.2727 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 0.0021167800296098 857.499267578125 429.7569 857.4970703125 429.755798339844 2 12 1.1.1.3452.7 1 30.4736 12218.55 30.4166 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Pro->pyro-Glu(P)@7 0.000226443997235037 855.481689453125 428.7481 855.4814453125 428.747985839844 2 12 1.1.1.3456.7 1 30.5728 17875.18 30.6565 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 0.00117178005166352 873.493103027344 437.7538 873.492004394531 437.753265380859 2 13 1.1.1.3458.5 1 30.6175 17709.55 30.6565 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0225398000329733 842.508666992188 422.2616 842.486145019531 422.250366210938 2 11 1.1.1.3459.3 1 30.6381 197557.3 30.5606 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.000324508000630885 857.496704101563 429.7556 857.4970703125 429.755798339844 2 12 1.1.1.3459.5 1 30.6414 10116.36 30.6565 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Deamidated(R)@8 0.0225398000329733 842.508666992188 422.2616 842.486145019531 422.250366210938 2 11 1.1.1.3460.3 1 30.662 197557.3 30.5606 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 -0.000742823991458863 823.490844726563 412.7527 823.491577148438 412.753082275391 2 10 1.1.1.3463.2 1 30.7324 25753.97 30.7285 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Pro->pyro-Glu(P)@7 0.000226443997235037 855.481689453125 428.7481 855.4814453125 428.747985839844 2 12 1.1.1.3463.5 1 30.7374 17875.18 30.6565 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 -0.000170932995388284 873.491882324219 437.7532 873.492004394531 437.753265380859 2 13 1.1.1.3465.5 1 30.7885 14540.41 30.8002 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.000934829993639141 857.49609375 429.7553 857.4970703125 429.755798339844 2 12 1.1.1.3466.6 1 30.8074 8146.896 30.8481 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dioxidation(P)@7 -0.000170932995388284 873.491882324219 437.7532 873.492004394531 437.753265380859 2 13 1.1.1.3472.4 1 30.9533 14540.41 30.8002 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Oxidation(P)@7 -0.000690701010171324 857.496459960938 429.7555 857.4970703125 429.755798339844 2 11 1.1.1.3473.4 1 30.9748 7677.349 30.9676 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 -0.000742823991458863 823.490844726563 412.7527 823.491577148438 412.753082275391 2 10 1.1.1.3477.2 1 31.0669 21236.34 30.9437 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00292372005060315 869.536499023438 435.7755 869.533447265625 435.774017333984 2 11 1.1.1.3515.4 0 31.9764 183447 32.2102 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00335094006732106 869.536865234375 435.7757 869.533447265625 435.774017333984 2 12 1.1.1.3522.5 0 32.1437 555334.4 32.3295 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00335094006732106 869.536865234375 435.7757 869.533447265625 435.774017333984 2 12 1.1.1.3526.5 0 32.2429 559948.5 32.3295 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00335094006732106 869.536865234375 435.7757 869.533447265625 435.774017333984 2 11 1.1.1.3528.3 1 32.2873 559948.5 32.3295 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00335094006732106 869.536865234375 435.7757 869.533447265625 435.774017333984 2 12 1.1.1.3529.4 0 32.3111 559948.5 32.3295 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00353403994813561 869.537048339844 435.7758 869.533447265625 435.774017333984 2 11 1.1.1.3534.5 1 32.4306 542912.7 32.4967 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.000638068013358861 885.529052734375 443.7718 885.528381347656 443.771453857422 2 12 1.1.1.3535.4 0 32.4577 9710.902 32.4251 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00353403994813561 869.537048339844 435.7758 869.533447265625 435.774017333984 2 12 1.1.1.3536.9 0 32.4816 542912.7 32.4967 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00353403994813561 869.537048339844 435.7758 869.533447265625 435.774017333984 2 12 1.1.1.3543.4 0 32.6471 542912.7 32.4967 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00353403994813561 869.537048339844 435.7758 869.533447265625 435.774017333984 2 12 1.1.1.3544.4 0 32.6734 542912.7 32.4967 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.000821164983790368 885.529296875 443.7719 885.528381347656 443.771453857422 2 12 1.1.1.3550.5 0 32.8178 8914.596 32.5684 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00310680991970003 869.536499023438 435.7755 869.533447265625 435.774017333984 2 11 1.1.1.3551.5 0 32.8375 382866.4 32.5923 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00292372005060315 869.536499023438 435.7755 869.533447265625 435.774017333984 2 12 1.1.1.3558.5 0 33.0033 128085.1 32.7589 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00292372005060315 869.536499023438 435.7755 869.533447265625 435.774017333984 2 12 1.1.1.3565.6 0 33.1751 70476.47 32.926 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.000909655005671084 869.534301757813 435.7744 869.533447265625 435.774017333984 2 10 1.1.1.3586.5 1 33.6842 3257.95 33.5291 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00591428996995091 869.539245605469 435.7769 869.533447265625 435.774017333984 2 10 1.1.1.3617.5 0 34.4076 1237.855 34.4678 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term 0.00329131004400551 867.521057128906 434.7678 867.517822265625 434.766174316406 2 12 1.1.1.3782.3 1 38.2001 17944.56 38.1872 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00591428996995091 869.539245605469 435.7769 869.533447265625 435.774017333984 2 10 1.1.1.3861.2 1 40.0496 883.799 40.0681 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.000821164983790368 885.529296875 443.7719 885.528381347656 443.771453857422 2 12 1.1.1.3528.4 0 32.2889 9188.97 32.3057 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term 0.00353403994813561 869.537048339844 435.7758 869.533447265625 435.774017333984 2 11 1.1.1.3541.5 1 32.6036 542912.7 32.4967 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term 0.00329131004400551 867.521057128906 434.7678 867.517822265625 434.766174316406 2 11 1.1.1.3774.4 1 38.0096 17843.14 38.1872 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term 0.00329131004400551 867.521057128906 434.7678 867.517822265625 434.766174316406 2 11 1.1.1.3790.2 1 38.3822 17944.56 38.1872 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(2)C(2)@N-term 0.00384059990756214 867.521667480469 434.7681 867.517822265625 434.766174316406 2 11 1.1.1.3822.3 1 39.1278 6448.364 39.0699 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 -0.000742823991458863 823.490844726563 412.7527 823.491577148438 412.753082275391 2 10 1.1.1.3470.2 1 30.8997 25753.97 30.7285 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Formyl@N-term -0.00066685100318864 869.496459960938 435.7555 869.4970703125 435.755798339844 2 11 1.1.1.3478.3 0 31.0941 7443.344 31.3258 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Dehydrated(T)@3 0.00163743004668504 823.493286132813 412.7539 823.491577148438 412.753082275391 2 8 1.1.1.3491.3 1 31.4027 3007.261 31.254 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VATVSLPR Delta:H(4)C(2)@N-term; Oxidation(P)@7 0.000821164983790368 885.529296875 443.7719 885.528381347656 443.771453857422 2 12 1.1.1.3542.5 0 32.6249 10317.13 32.5206 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 97.6599991321564 VATVSLPR Delta:H(4)C(2)@N-term 0.00335094006732106 869.536865234375 435.7757 869.533447265625 435.774017333984 2 9 1.1.1.3935.2 1 41.816 983.9221 41.8823 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 93.1699991226196 VATVSLPR Delta:H(4)C(2)@N-term -0.00788640975952148 869.525695800781 435.7701 869.533447265625 435.774017333984 2 6 1.1.1.4350.2 1 51.9064 380.483 51.9266 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.5499975681305 VATVSLPR -0.00654317019507289 841.495666503906 421.7551 841.502136230469 421.758361816406 2 9 1.1.1.4329.2 1 51.3885 830.7008 51.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 VATVSLPR Formyl@N-term 0.03008590079844 869.527099609375 435.7708 869.4970703125 435.755798339844 2 7 1.1.1.4358.3 1 52.1085 371.7182 52.0744 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.3699972629547 VATVSLPR -0.00874034035950899 841.493469238281 421.754 841.502136230469 421.758361816406 2 8 1.1.1.4307.3 1 50.8461 991.2228 50.94 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.3699972629547 VATVSLPR -0.00874034035950899 841.493469238281 421.754 841.502136230469 421.758361816406 2 8 1.1.1.4315.2 1 51.0429 991.2228 50.94 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.3699972629547 VATVSLPR -0.00855724979192019 841.49365234375 421.7541 841.502136230469 421.758361816406 2 8 1.1.1.4322.2 1 51.2176 672.8093 51.1886 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 86.3699972629547 VATVSLPR -0.00654317019507289 841.495666503906 421.7551 841.502136230469 421.758361816406 2 7 1.1.1.5594.2 1 75.1292 102.8245 75.1621 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 73.3799993991852 VATVSLPR Delta:H(4)C(2)@N-term 0.00634152023121715 869.539855957031 435.7772 869.533447265625 435.774017333984 2 9 1.1.1.3804.4 1 38.7 815.0713 38.6906 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.6699984073639 VATVSLPR -0.00636008009314537 841.495849609375 421.7552 841.502136230469 421.758361816406 2 8 1.1.1.4343.2 1 51.7335 877.3936 51.7289 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.6699984073639 VATVSLPR -0.00636008009314537 841.495849609375 421.7552 841.502136230469 421.758361816406 2 8 1.1.1.5498.2 1 73.7544 106.2173 73.7406 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 62.6699984073639 VATVSLPR -0.0089844698086381 841.493103027344 421.7538 841.502136230469 421.758361816406 2 7 1.1.1.5568.2 1 74.781 107.0812 74.7977 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 50.6200015544891 VATVSLPR Pro->pyro-Glu(P)@7 4.33478016930167E-05 855.4814453125 428.748 855.4814453125 428.747985839844 2 12 1.1.1.3449.5 1 30.4041 19647.25 30.4166 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 50.6200015544891 VATVSLPR Delta:H(4)C(2)@N-term 0.00292372005060315 869.536499023438 435.7755 869.533447265625 435.774017333984 2 10 1.1.1.3572.5 1 33.3404 13079.58 33.2626 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 46.8100011348724 VATVSLPR Pro->pyro-Glu(P)@7 0.000226443997235037 855.481689453125 428.7481 855.4814453125 428.747985839844 2 12 1.1.1.3435.4 1 30.0688 21918.07 30.1527 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.4499999284744 VATVSLPR Delta:H(4)C(2)@N-term 0.0065246201120317 869.540100097656 435.7773 869.533447265625 435.774017333984 2 9 1.1.1.3666.4 1 35.5159 906.8608 35.5072 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 44.4499999284744 VATVSLPR Delta:H(4)C(2)@N-term 0.000299334002193064 869.53369140625 435.7741 869.533447265625 435.774017333984 2 10 1.1.1.3835.3 1 39.4347 1341.743 39.3074 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.8799986839294 VATVSLPR -0.00636008009314537 841.495849609375 421.7552 841.502136230469 421.758361816406 2 8 1.1.1.4336.2 1 51.5604 877.3936 51.7289 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.1700000762939 VATVSLPR Dehydrated(T)@3 0.00127123994752765 823.492858886719 412.7537 823.491577148438 412.753082275391 2 8 1.1.1.3499.2 1 31.5922 1261.177 31.5163 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.1700000762939 VATVSLPR Delta:H(2)C(2)@N-term 0.0106761995702982 867.528503417969 434.7715 867.517822265625 434.766174316406 2 10 1.1.1.3806.4 1 38.7523 1067.472 38.6906 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 42.1700000762939 VATVSLPR Delta:H(4)C(2)@N-term 0.00292372005060315 869.536499023438 435.7755 869.533447265625 435.774017333984 2 10 1.1.1.3886.2 1 40.6578 933.2719 40.7105 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 40.4399991035461 VATVSLPR 0.0028204598929733 841.505065917969 421.7598 841.502136230469 421.758361816406 2 9 1.1.1.4242.2 1 49.2627 1384.313 49.2592 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 VATVSLPR Dioxidation(P)@7 -0.000415060989325866 873.49169921875 437.7531 873.492004394531 437.753265380859 2 10 1.1.1.3430.7 1 29.9434 24820.38 30.1527 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 VATVSLPR Deamidated(R)@8 0.0225398000329733 842.508666992188 422.2616 842.486145019531 422.250366210938 2 10 1.1.1.3431.6 1 29.967 214999.8 30.0326 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 VATVSLPR Deamidated(R)@8 0.0229059997946024 842.509094238281 422.2618 842.486145019531 422.250366210938 2 10 1.1.1.3438.6 1 30.1393 230274.4 30.1527 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 VATVSLPR Dehydrated(T)@3 0.00102711003273726 823.49267578125 412.7536 823.491577148438 412.753082275391 2 10 1.1.1.3449.2 1 30.3966 28853.85 30.4166 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 VATVSLPR Deamidated(R)@8 0.0225398000329733 842.508666992188 422.2616 842.486145019531 422.250366210938 2 10 1.1.1.3452.4 1 30.4694 199707.9 30.4407 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 VATVSLPR Pro->pyro-Glu(P)@7 0.00205741007812321 855.483459472656 428.749 855.4814453125 428.747985839844 2 11 1.1.1.3470.5 1 30.9047 14312.06 30.872 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 VATVSLPR Deamidated(R)@8 0.0225398000329733 842.508666992188 422.2616 842.486145019531 422.250366210938 2 10 1.1.1.3475.3 1 31.0226 170086.7 30.7763 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 VATVSLPR Delta:H(2)C(2)@N-term 0.011896800249815 867.529663085938 434.7721 867.517822265625 434.766174316406 2 10 1.1.1.3798.3 1 38.5752 1426.007 38.5666 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 37.7099990844727 VATVSLPR Delta:H(2)C(2)@N-term 0.00426782015711069 867.522094726563 434.7683 867.517822265625 434.766174316406 2 10 1.1.1.3830.3 1 39.3135 4946.59 39.2837 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.5300009250641 VATVSLPR Dioxidation(P)@7 0.00159899995196611 873.49365234375 437.7541 873.492004394531 437.753265380859 2 11 1.1.1.3480.3 1 31.1433 12749.84 30.8959 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 35.5300009250641 VATVSLPR Delta:H(4)C(2)@N-term 0.00249649002216756 869.535888671875 435.7752 869.533447265625 435.774017333984 2 9 1.1.1.3579.7 1 33.514 3359.578 33.5048 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 34.5200002193451 VATVSLPR -0.00654317019507289 841.495666503906 421.7551 841.502136230469 421.758361816406 2 7 1.1.1.4363.2 1 52.2257 822.3173 52.1729 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.390000462532 VATVSLPR Pro->pyro-Glu(P)@7 0.039836298674345 855.521301269531 428.7679 855.4814453125 428.747985839844 2 11 1.1.1.3477.5 1 31.0719 224506.9 31.3018 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.390000462532 VATVSLPR Delta:H(4)C(2)@N-term -0.00250814994797111 869.530883789063 435.7727 869.533447265625 435.774017333984 2 9 1.1.1.3693.2 1 36.154 1027.723 36.1494 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.390000462532 VATVSLPR Delta:H(4)C(2)@N-term 0.00609738985076547 869.539489746094 435.777 869.533447265625 435.774017333984 2 9 1.1.1.3754.4 1 37.5569 608.1516 37.5188 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.390000462532 VATVSLPR Delta:H(2)C(2)@N-term 0.00408473005518317 867.521850585938 434.7682 867.517822265625 434.766174316406 2 10 1.1.1.3838.4 1 39.5116 5089.737 39.26 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.390000462532 VATVSLPR Delta:H(4)C(2)@N-term 0.00335094006732106 869.536865234375 435.7757 869.533447265625 435.774017333984 2 10 1.1.1.3921.2 1 41.4827 984.2507 41.4755 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 33.390000462532 VATVSLPR Formyl@N-term 0.0258821006864309 869.522888183594 435.7687 869.4970703125 435.755798339844 2 10 1.1.1.4028.3 1 44.0634 1153.282 44.0332 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 32.0100009441376 VATVSLPR 0.0028204598929733 841.505065917969 421.7598 841.502136230469 421.758361816406 2 8 1.1.1.4169.2 1 47.5092 1141.648 47.4574 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 VATVSLPR Dehydrated(T)@3 -0.000559727021027356 823.491088867188 412.7528 823.491577148438 412.753082275391 2 9 1.1.1.3434.2 1 30.0398 33314.94 30.1286 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 VATVSLPR Oxidation(P)@7 0.0237221997231245 857.520874023438 429.7677 857.4970703125 429.755798339844 2 9 1.1.1.3481.5 1 31.1655 25834.32 31.3973 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 VATVSLPR Methyl(T)@3; Oxidation(P)@7 -0.00304845999926329 871.509643554688 436.7621 871.5126953125 436.763641357422 2 12 1.1.1.3495.3 1 31.5012 7195.981 31.3735 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 VATVSLPR Delta:H(4)C(2)@N-term 0.00353403994813561 869.537048339844 435.7758 869.533447265625 435.774017333984 2 10 1.1.1.3535.3 1 32.4552 542912.7 32.4967 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 VATVSLPR Delta:H(4)C(2)@N-term 0.00371714006178081 869.537048339844 435.7758 869.533447265625 435.774017333984 2 10 1.1.1.3593.3 1 33.8506 2039.595 33.8673 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 VATVSLPR Delta:H(2)C(2)@N-term 0.00365750002674758 867.521484375 434.768 867.517822265625 434.766174316406 2 10 1.1.1.3766.3 1 37.8368 6120.053 38.045 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 VATVSLPR Delta:H(2)C(2)@N-term 0.00384059990756214 867.521667480469 434.7681 867.517822265625 434.766174316406 2 10 1.1.1.3814.5 1 38.9386 4520.737 38.9274 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 VATVSLPR Delta:H(4)C(2)@N-term 0.00994241982698441 869.54345703125 435.779 869.533447265625 435.774017333984 2 9 1.1.1.3879.3 1 40.4785 955.5645 40.4246 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 29.2199999094009 VATVSLPR Delta:H(2)C(2)@N-term 0.00908937025815248 867.52685546875 434.7707 867.517822265625 434.766174316406 2 8 1.1.1.4087.3 1 45.5048 572.0589 45.3504 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.8299987316132 VATVSLPR -0.00874034035950899 841.493469238281 421.754 841.502136230469 421.758361816406 2 8 1.1.1.5486.2 1 73.5695 103.6758 73.5558 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.8299987316132 VATVSLPR -0.00874034035950899 841.493469238281 421.754 841.502136230469 421.758361816406 2 8 1.1.1.5528.2 1 74.1824 101.9972 74.1874 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.3499995470047 VATVSLPR 0.00257632997818291 841.504699707031 421.7596 841.502136230469 421.758361816406 2 8 1.1.1.4120.2 1 46.3095 1526.911 46.3549 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.1899998188019 VATVSLPR Dioxidation(P)@7 0.00220931996591389 873.494262695313 437.7544 873.492004394531 437.753265380859 2 10 1.1.1.3496.3 1 31.5251 2374.579 31.3018 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 27.1899998188019 VATVSLPR Delta:H(2)C(2)@N-term 0.00426782015711069 867.522094726563 434.7683 867.517822265625 434.766174316406 2 9 1.1.1.3831.2 1 39.3348 4946.59 39.2837 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 23.2500001788139 VATVSLPR Delta:H(4)C(2)@N-term 0.000909655005671084 869.534301757813 435.7744 869.533447265625 435.774017333984 2 9 1.1.1.3871.2 1 40.2882 949.2972 40.3058 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 22.3700001835823 VATVSLPR 0.000623299973085523 841.502868652344 421.7587 841.502136230469 421.758361816406 2 8 1.1.1.3918.2 1 41.4069 2291.012 41.4755 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 20.5300003290176 VATVSLPR 0.0028204598929733 841.505065917969 421.7598 841.502136230469 421.758361816406 2 8 1.1.1.4134.2 1 46.653 1499.71 46.6739 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.8500007390976 VATVSLPR 0.00257632997818291 841.504699707031 421.7596 841.502136230469 421.758361816406 2 10 1.1.1.3437.4 1 30.1093 874106.9 30.1286 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 19.4499999284744 VATVSLPR Dehydrated(T)@3 0.00426180986687541 823.495849609375 412.7552 823.491577148438 412.753082275391 2 6 1.1.1.3506.3 1 31.7599 1054.057 31.7783 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.8999995589256 VATVSLPR 0.00300354999490082 841.505249023438 421.7599 841.502136230469 421.758361816406 2 8 1.1.1.4085.4 1 45.4547 1851.39 45.5481 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 18.8999995589256 VATVSLPR 0.00300354999490082 841.505249023438 421.7599 841.502136230469 421.758361816406 2 8 1.1.1.4092.3 0 45.6268 1851.39 45.5481 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.7200004458427 VATVSLPR 0.0028204598929733 841.505065917969 421.7598 841.502136230469 421.758361816406 2 8 1.1.1.4078.2 1 45.28 2013.002 45.178 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.620000243187 VATVSLPR Amidated@C-term -0.00212904997169971 840.516052246094 421.2653 840.518127441406 421.266357421875 2 8 1.1.1.3369.5 1 28.5125 1217.395 28.4567 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.620000243187 VATVSLPR Pro->pyro-Glu(P)@7 4.33478016930167E-05 855.4814453125 428.748 855.4814453125 428.747985839844 2 7 1.1.1.3428.5 1 29.9004 19695.71 30.0805 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.620000243187 VATVSLPR Delta:H(4)C(2)@N-term 0.0145198004320264 869.548095703125 435.7813 869.533447265625 435.774017333984 2 8 1.1.1.3658.4 1 35.3471 971.8954 35.335 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.620000243187 VATVSLPR Delta:H(2)C(2)@N-term 0.00329131004400551 867.521057128906 434.7678 867.517822265625 434.766174316406 2 9 1.1.1.3776.4 1 38.057 17944.56 38.1872 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.620000243187 VATVSLPR Delta:H(2)C(2)@N-term 0.00384059990756214 867.521667480469 434.7681 867.517822265625 434.766174316406 2 8 1.1.1.3814.4 1 38.9361 4520.737 38.9274 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 17.1700000762939 VATVSLPR 0.00257632997818291 841.504699707031 421.7596 841.502136230469 421.758361816406 2 10 1.1.1.3462.2 1 30.7083 705481.1 30.7285 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.6500002145767 VATVSLPR 0.00300354999490082 841.505249023438 421.7599 841.502136230469 421.758361816406 2 9 1.1.1.3981.2 1 42.9225 1936.898 42.8461 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.3900002837181 VATVSLPR 0.00257632997818291 841.504699707031 421.7596 841.502136230469 421.758361816406 2 10 1.1.1.3456.4 1 30.5678 759295.6 30.5367 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.3900002837181 VATVSLPR 0.00257632997818291 841.504699707031 421.7596 841.502136230469 421.758361816406 2 10 1.1.1.3463.3 1 30.734 705481.1 30.7285 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 16.1500006914139 VATVSLPR 0.00257632997818291 841.504699707031 421.7596 841.502136230469 421.758361816406 2 10 1.1.1.3432.3 0 29.9902 874106.9 30.1286 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 VATVSLPR -0.0442872010171413 841.457824707031 842.4651 841.502136230469 842.509399414063 1 9 1.1.1.3463.11 1 30.7474 0 -1 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 VATVSLPR Methyl(T)@3 0.00326772010885179 855.521057128906 428.7678 855.517822265625 428.766174316406 2 8 1.1.1.3479.4 1 31.1203 345628.1 31.3496 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 VATVSLPR Acetyl@N-term 0.0010053199948743 883.513671875 442.7641 883.5126953125 442.763641357422 2 9 1.1.1.3536.10 1 32.4833 13134.94 32.4011 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 VATVSLPR Delta:H(2)C(2)@N-term 0.00329131004400551 867.521057128906 434.7678 867.517822265625 434.766174316406 2 9 1.1.1.3788.4 1 38.3482 17944.56 38.1872 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 VATVSLPR Delta:H(2)C(2)@N-term 0.0152535997331142 867.533081054688 434.7738 867.517822265625 434.766174316406 2 8 1.1.1.3860.3 1 40.0276 418.7554 40.0443 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 VATVSLPR Delta:H(4)C(2)@N-term 0.00249649002216756 869.535888671875 435.7752 869.533447265625 435.774017333984 2 8 1.1.1.3928.2 1 41.6477 942.3172 41.643 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 VATVSLPR Formyl@N-term 0.0405298992991447 869.537658691406 435.7761 869.4970703125 435.755798339844 2 8 1.1.1.3964.4 1 42.5161 1046.777 42.2672 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 VATVSLPR Formyl@N-term 0.0399194993078709 869.537048339844 435.7758 869.4970703125 435.755798339844 2 8 1.1.1.3971.5 1 42.6867 820.5873 42.7017 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.8099994063377 VATVSLPR Delta:H(4)C(2)@N-term 0.00530397007241845 869.538696289063 435.7766 869.533447265625 435.774017333984 2 9 1.1.1.3985.2 1 43.0224 822.1671 43.0634 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.6700000166893 VATVSLPR 0.00257632997818291 841.504699707031 421.7596 841.502136230469 421.758361816406 2 10 1.1.1.3442.3 0 30.2336 884253.1 30.2727 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.6700000166893 VATVSLPR 0.0028204598929733 841.505065917969 421.7598 841.502136230469 421.758361816406 2 10 1.1.1.3449.3 0 30.3991 757449.3 30.4407 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.6700000166893 VATVSLPR 0.00257632997818291 841.504699707031 421.7596 841.502136230469 421.758361816406 2 10 1.1.1.3470.3 0 30.9014 705481.1 30.7285 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 15.6700000166893 VATVSLPR 0.00239323009736836 841.504699707031 421.7596 841.502136230469 421.758361816406 2 10 1.1.1.3477.3 0 31.0686 556197 30.9676 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 96.2000012397766 VATVSLPRSCAAAGTECLISGWGN Carbamidomethyl(C)@10; Carbamidomethyl(C)@17; GlyGly(S)@20 cleaved N-T@C-term; missed R-S@8 0.0634004026651382 2590.2900390625 864.4373 2590.22680664063 864.416198730469 3 12 1.1.1.4332.9 1 51.4715 455.5196 51.5061 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 89.92999792099 VATVSLPRSCAAAGTECLISGWGNTK Carbamidomethyl(C)@10; Carbamidomethyl(C)@17; acrolein addition +56(K)@26 missed R-S@8 0.0531740002334118 2761.40576171875 921.4759 2761.35278320313 921.458190917969 3 8 1.1.1.4462.4 1 54.669 1181.826 54.8128 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 92.9000020027161 VGGYTCAANSIPYQVSLNSGSHFCGGSLINSQWVVSAAHCYK Dehydrated(T)@5; Carbamidomethyl(C)@6; Deamidated(N)@18; Carbamidomethyl(C)@24; reduced HNE(H)@39; Carbamidomethyl(C)@40; acrolein addition +56(K)@42 cleaved I-V@N-term 0.0866604000329971 4743.30615234375 949.6685 4743.2197265625 949.651184082031 5 12 1.1.1.4561.3 1 57.1112 724.5415 57.031 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VNWIQQTIAAN cleaved Y-V@N-term 0.00655532022938132 1256.65783691406 629.3362 1256.6513671875 629.332946777344 2 14 1.1.1.4336.5 1 51.5679 819.4114 51.4328 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VRLGEHNIDVLEGNEQFINAAK Carbamyl@N-term cleaved Q-V@N-term; missed R-L@2 0.00447933003306389 2508.27661132813 837.0995 2508.27221679688 837.097961425781 3 15 1.1.1.4149.17 1 47.0321 4501.785 47.0898 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 VRLGEHNIDVLEGNEQFINAAK Carbamyl@N-term cleaved Q-V@N-term; missed R-L@2 0.00356384995393455 2508.27563476563 837.0992 2508.27221679688 837.097961425781 3 15 1.1.1.4163.14 1 47.3723 4664.746 47.1633 2 64.04 64.04 81.6100001335144 81.6100001335144 72.6499974727631 cont|000143; cont|000023 pdb|1FNI_A| A Chain A, Crystal Structure Of Porcine Beta Trypsin With 0.01% Polydocanol [Sus scrofa (contaminant)]; gi|494360|pdb|1MCT|A Chain A, Trypsin (E.C.3.4.21.4) Complexed With Inhibitor From Bitter Gourd [Sus scrofa (Contaminant)] 0 99.0000009536743 YVNWIQQTIAAN cleaved N-Y@N-term 0.0155595997348428 1419.73022460938 710.8724 1419.71472167969 710.864624023438 2 14 1.1.1.4455.2 1 54.4923 3369.39 54.4101 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 AKDALSSVQESQVAQQAR Carbamidomethyl@N-term; acrolein addition +76(K)@2 cleaved T-A@N-term; missed K-D@2 0.00686086993664503 2048.03564453125 683.6858 2048.02856445313 683.683532714844 3 15 1.1.1.3511.3 1 31.8866 687.6237 31.9214 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 ATKTAKDALSSVQESQVAQQAR Carbamidomethyl(K)@3; acrolein addition +56(K)@6; Oxidation(D)@7 cleaved H-A@N-term; missed K-T@3; missed K-D@6 0.00867191981524229 2445.25463867188 612.3209 2445.24584960938 612.318786621094 4 16 1.1.1.3575.13 1 33.4267 733.0884 33.4562 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 DALSSVQESQVAQQAR 0.00906450022011995 1715.85314941406 572.9583 1715.84387207031 572.955200195313 3 23 1.1.1.3655.6 1 35.2823 15078.42 35.4119 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 QGYMKHATKTAKDALSSVQESQVAQQAR Gln->pyro-Glu@N-term; ONE addition +154(K)@5; MDA adduct +62(K)@9; HPNE addition +172(K)@12 cleaved M-Q@N-term; missed K-H@5; missed K-T@9; missed K-D@12 0.029958700761199 3431.76831054688 1144.93 3431.73950195313 1144.92041015625 3 16 1.1.1.3660.8 1 35.4014 458.803 35.4595 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 SVQESQVAQQAR cleaved S-S@N-term 0.015137399546802 1329.67883300781 665.8467 1329.66369628906 665.839111328125 2 20 1.1.1.3066.3 1 22.088 122.5989 22.0446 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 2 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 -0.00420928979292512 2016.01928710938 505.0121 2016.02355957031 505.01318359375 4 19 1.1.1.3512.10 1 31.913 1947.798 31.9692 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.00788851175457239 98.9499986171722 SLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR ONE addition +154(K)@11; MDA adduct +54(K)@15; acrolein addition +76(K)@18 cleaved A-S@N-term; missed K-H@11; missed K-T@15; missed K-D@18 0.0375404991209507 4023.060546875 805.6194 4023.0234375 805.611938476563 5 13 1.1.1.4719.4 1 60.9255 933.5222 60.9702 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.000869458774104714 67.1899974346161 VLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR Deamidated(Q)@29; MDA adduct +62(K)@33; reduced acrolein addition +58(K)@37 missed R-A@15; missed K-H@33; missed K-T@37; missed K-D@40 0.0558058992028236 6036.22607421875 1007.045 6036.17041015625 1007.03570556641 6 10 1.1.1.4720.13 0 60.9585 1003.219 60.9955 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.000434511806815863 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK Bromo(W)@21; acrolein addition +76(K)@30; acrolein addition +94(K)@37 missed K-D@3; missed R-G@19; missed K-D@30 0.0258724000304937 4321.0224609375 865.2118 4320.99658203125 865.206604003906 5 16 1.1.1.4444.7 1 54.2125 965.9227 54.2292 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0.000434511806815863 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK acrolein addition +56(K)@30; Sulfo(Y)@32; MDA adduct +54(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 -0.0220272000879049 4506.1064453125 752.025 4506.12841796875 752.028686523438 6 19 1.1.1.4396.4 1 53.0098 1343.074 52.9949 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 ATKTAKDALSSVQESQVAQQAR Carbamidomethyl@N-term; Oxidation(K)@3; acrolein addition +56(K)@6 cleaved H-A@N-term; missed K-T@3; missed K-D@6 0.0317380987107754 2445.27783203125 816.0999 2445.24584960938 816.089233398438 3 26 1.1.1.3577.12 1 33.4754 446.4566 33.4562 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 ATKTAKDALSSVQESQVAQQAR Carbamidomethyl@N-term; acrolein addition +56(K)@3; Oxidation(D)@7 cleaved H-A@N-term; missed K-T@3; missed K-D@6 0.0317380987107754 2445.27783203125 816.0999 2445.24584960938 816.089233398438 3 22 1.1.1.3579.12 1 33.5223 446.4566 33.4562 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Deamidated(Q)@13; Methyl+Deamidated(Q)@14 0.0243142005056143 1731.85192871094 866.9332 1731.82751464844 866.921020507813 2 24 1.1.1.3659.6 1 35.3775 0 -1 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Cation:Na(E)@8 0.0095601798966527 1737.83532714844 580.2857 1737.82580566406 580.282531738281 3 23 1.1.1.3660.6 1 35.3964 522.7693 35.4119 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Dioxidation(R)@16 0.0300456993281841 1747.86364746094 874.9391 1747.83361816406 874.924133300781 2 22 1.1.1.3662.5 1 35.4306 470.9203 35.4119 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.0338350012898445 1715.87768554688 858.9461 1715.84387207031 858.92919921875 2 26 1.1.1.3663.6 1 35.4512 17428.3 35.4357 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR Dioxidation(R)@16 0.0300456993281841 1747.86364746094 874.9391 1747.83361816406 874.924133300781 2 17 1.1.1.3663.7 1 35.4545 470.9203 35.4119 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.00906450022011995 1715.85314941406 572.9583 1715.84387207031 572.955200195313 3 25 1.1.1.3671.3 1 35.639 15265.19 35.4119 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 DALSSVQESQVAQQAR 0.0340791009366512 1715.8779296875 858.9462 1715.84387207031 858.92919921875 2 26 1.1.1.3673.7 1 35.6925 17601.02 35.4357 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.7900018692017 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK HexNAc(S)@25; acrolein addition +112(K)@27; MDA adduct +54(K)@34 missed R-G@16; missed K-D@27 0.0344625003635883 4142.0107421875 1036.51 4141.9755859375 1036.50122070313 4 13 1.1.1.4687.7 1 60.1183 272.7085 60.1259 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.5899984836578 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Sulfo(Y)@29; acrolein addition +56(K)@34; MDA adduct +54(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 0.00933938007801771 4205.9580078125 842.1989 4205.94873046875 842.197021484375 5 13 1.1.1.4454.12 1 54.4751 987.8276 54.462 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 98.5400021076202 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Deamidated(Q)@13; Deamidated(Q)@14; MDA adduct +62(K)@34; MDA adduct +62(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 0.0192725006490946 4141.9736328125 829.402 4141.95458984375 829.398193359375 5 12 1.1.1.4687.4 1 60.1108 387.0015 60.1016 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 97.869998216629 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK MDA adduct +54(K)@27; MDA adduct +54(K)@34; MDA adduct +54(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 -0.0353146009147167 4177.95166015625 836.5976 4177.98681640625 836.604675292969 5 11 1.1.1.4522.5 1 56.1437 635.657 56.1126 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 96.0500001907349 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Bromo(W)@30; acrolein addition +112(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 0.0338875986635685 4205.9521484375 842.1977 4205.91796875 842.19091796875 5 12 1.1.1.4461.12 1 54.6509 1643.549 54.6883 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 95.7300007343292 DALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Dioxidation(W)@18; acrolein addition +56(K)@27; acrolein addition +38(K)@36 missed R-G@16; missed K-D@27; missed K-D@34 0.0232290998101234 4142.0107421875 1036.51 4141.98681640625 1036.50402832031 4 11 1.1.1.4687.7 1 60.1183 272.7085 60.1259 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 0.0228490997105837 2016.04663085938 673.0228 2016.02355957031 673.01513671875 3 25 1.1.1.3494.9 1 31.4875 814.0427 31.5163 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 0.0177222993224859 2016.04150390625 673.0211 2016.02355957031 673.01513671875 3 28 1.1.1.3507.6 1 31.797 24801.12 31.9452 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Methyl+Deamidated(Q)@13 missed K-D@3 -1.43090001074597E-05 2031.02319335938 678.015 2031.02331542969 678.015014648438 3 18 1.1.1.3509.5 1 31.8448 519.5828 31.9214 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 0.0177222993224859 2016.04150390625 673.0211 2016.02355957031 673.01513671875 3 29 1.1.1.3514.11 1 31.9641 24801.12 31.9452 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR missed K-D@3 0.0177222993224859 2016.04150390625 673.0211 2016.02355957031 673.01513671875 3 23 1.1.1.3521.18 1 32.1327 24801.12 31.9452 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR acrolein addition +56(K)@3; Ser->LacticAcid(S)@7 missed K-D@3 0.0136197004467249 2057.052734375 686.6915 2057.03881835938 686.686889648438 3 22 1.1.1.3546.5 1 32.7301 1160.315 32.7828 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Formyl@N-term; reduced acrolein addition +58(K)@3 missed K-D@3 0.0168669000267982 2102.07739257813 701.6997 2102.06030273438 701.694091796875 3 19 1.1.1.4135.12 1 46.6883 416.5009 46.7475 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Formyl@N-term; reduced acrolein addition +58(K)@3 missed K-D@3 0.0586041994392872 2102.11938476563 1052.067 2102.06030273438 1052.03747558594 2 20 1.1.1.4137.18 1 46.7424 287.4131 46.7229 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQAR Formyl@N-term; reduced acrolein addition +58(K)@3 missed K-D@3 0.0586041994392872 2102.11938476563 1052.067 2102.06030273438 1052.03747558594 2 19 1.1.1.4138.9 1 46.7667 287.4131 46.7229 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 96.3500022888184 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVK acrolein addition +56(K)@30; Phospho(S)@34; acrolein addition +112(K)@37 missed K-D@3; missed R-G@19; missed K-D@30 -0.0357295013964176 4321.02197265625 865.2117 4321.05810546875 865.218872070313 5 12 1.1.1.4452.8 1 54.4201 1010.751 54.4101 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK acrolein addition +56(K)@30; Sulfo(Y)@32; MDA adduct +54(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 0.0224469006061554 4506.15087890625 902.2375 4506.12841796875 902.232971191406 5 18 1.1.1.4390.5 1 52.8595 996.0618 52.8504 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Bromo(W)@33; acrolein addition +112(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 0.0460795983672142 4506.14404296875 902.2361 4506.09765625 902.226867675781 5 18 1.1.1.4397.4 1 53.0264 1386.086 52.9949 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 99.0000009536743 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Chloro(Y)@32; MDA adduct +62(K)@37; MDA adduct +62(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 0.0274001006036997 4474.15478515625 895.8382 4474.12744140625 895.832702636719 5 15 1.1.1.4444.9 1 54.2142 1193.421 54.2292 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 93.1699991226196 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK Phospho(S)@34; MDA adduct +62(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 0.0147276995703578 4458.13134765625 744.0292 4458.11669921875 744.026733398438 6 11 1.1.1.4715.5 1 60.8224 329.4412 60.8139 3 12.01 12.01 76.7700016498566 76.7700016498566 54.5499980449677 sp|P02656|APOC3_HUMAN Apolipoprotein C-III OS=Homo sapiens GN=APOC3 PE=1 SV=1 0 90.6799972057343 TAKDALSSVQESQVAQQARGWVTDGFSSLKDYWSTVKDK MDA adduct +62(K)@37; Cation:K(D)@38; MDA adduct +62(K)@39 missed K-D@3; missed R-G@19; missed K-D@30; missed K-D@37 0.00722821988165379 4478.12939453125 747.3622 4478.1220703125 747.360961914063 6 11 1.1.1.4413.7 1 53.4204 267.9738 53.4627 4 2.74 2.74 13.0799993872643 13.0799993872643 13.0799993872643 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 2 99.0000009536743 GNYDAAQRGPGGVWAAK Trp->Kynurenin(W)@14 missed R-G@8 -0.00438104989007115 1720.82373046875 861.4191 1720.828125 861.421325683594 2 14 1.1.1.3258.3 1 26.1659 3068.726 26.3132 4 2.74 2.74 13.0799993872643 13.0799993872643 13.0799993872643 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0.74232143163681 99.0000009536743 GNYDAAQR -0.00052602298092097 893.398681640625 447.7066 893.399169921875 447.706848144531 2 12 1.1.1.2808.2 1 17.3056 833.3972 17.2712 4 2.74 2.74 13.0799993872643 13.0799993872643 13.0799993872643 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 34.0499997138977 GNYDAAQR -0.00052602298092097 893.398681640625 447.7066 893.399169921875 447.706848144531 2 10 1.1.1.2763.2 1 16.9775 292.8608 17.0242 4 2.74 2.74 13.0799993872643 13.0799993872643 13.0799993872643 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 34.0499997138977 GNYDAAQR -0.000342927000019699 893.398864746094 447.7067 893.399169921875 447.706848144531 2 11 1.1.1.2785.2 1 17.145 842.7645 17.1616 4 2.74 2.74 13.0799993872643 13.0799993872643 13.0799993872643 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 31.3699990510941 GNYDAAQR -0.000342927000019699 893.398864746094 447.7067 893.399169921875 447.706848144531 2 9 1.1.1.2843.2 1 17.6589 490.1977 17.5933 4 2.74 2.74 13.0799993872643 13.0799993872643 13.0799993872643 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 24.0199998021126 GNYDAAQR 0.00106081005651504 893.400268554688 447.7074 893.399169921875 447.706848144531 2 8 1.1.1.2864.2 1 18.013 152.7635 17.982 4 2.74 2.74 13.0799993872643 13.0799993872643 13.0799993872643 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 19.2100003361702 GNYDAAQR 0.00228145997971296 893.401489257813 447.708 893.399169921875 447.706848144531 2 8 1.1.1.2878.2 1 18.1859 145.6886 18.1348 4 2.74 2.74 13.0799993872643 13.0799993872643 13.0799993872643 sp|P35542|SAA4_HUMAN Serum amyloid A-4 protein OS=Homo sapiens GN=SAA4 PE=1 SV=2 0 19.4499999284744 GNYDAAQRGPGGVWAAK Trp->Kynurenin(W)@14 missed R-G@8 -0.0332554988563061 1720.794921875 574.6056 1720.828125 574.616638183594 3 10 1.1.1.3266.5 1 26.3521 19423.72 26.3368 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 2 99.0000009536743 LGEHNIEVLEGNEQFINAAK Deamidated(N)@5; Cation:K(E)@7 0.00482027977705002 2263.05712890625 755.3597 2263.05224609375 755.358032226563 3 13 1.1.1.4153.5 1 47.1204 591.7137 47.0898 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.0423927158117294 99.0000009536743 SVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@15; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term; cleaved K-P@C-term 0.0669225975871086 3793.85375976563 949.4707 3793.78686523438 949.453979492188 4 18 1.1.1.4305.6 1 50.8125 15088.41 50.5525 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.00130484171677381 99.0000009536743 IQVRLGEHNIEVLEGNEQFINAAK cleaved H-I@N-term; missed R-L@4 0.962540984153748 2721.38745117188 681.3541 2720.42456054688 681.113403320313 4 14 1.1.1.4283.12 1 50.2725 330.3575 50.2603 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0.00130484171677381 39.9899989366531 SVPYQVSLN cleaved N-S@N-term; cleaved N-S@C-term 0.00750391976907849 1005.52069091797 503.7676 1005.51312255859 503.763824462891 2 11 1.1.1.3938.5 1 41.8945 560.6462 41.8584 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 EQFINAAK cleaved N-E@N-term 0.00323767005465925 919.479675292969 460.7471 919.476318359375 460.745452880859 2 8 1.1.1.3242.3 0 25.7704 810.61 25.859 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 30.2500009536743 GNEQFINAAK cleaved E-G@N-term 0.00591281009837985 1090.54663085938 546.2806 1090.54077148438 546.277648925781 2 7 1.1.1.3292.11 0 26.9697 106.5174 26.9764 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.7399995326996 IQVRLGEHNIEVLEGNEQFINAAK Deamidated(Q)@2; Oxidation(R)@4 cleaved H-I@N-term; missed R-L@4 -0.00452621001750231 2737.39892578125 685.357 2737.40356445313 685.358154296875 4 12 1.1.1.4282.10 1 50.246 335.6706 50.3095 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 16.0300001502037 IQVRLGEHNIEVLEGNEQFINAAK cleaved H-I@N-term; missed R-L@4 0.0164963006973267 2720.44116210938 907.821 2720.42456054688 907.815490722656 3 9 1.1.1.4286.7 0 50.342 173.7239 50.3341 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 49.5299994945526 IVGGYTCEENSVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@7; Deamidated(N)@10; Oxidation(P)@13; Carbamidomethyl(C)@25; Carbamidomethyl(C)@41; ONE addition +154(K)@43 cleaved K-P@C-term 0.0486399009823799 4933.279296875 823.2205 4933.23095703125 823.212463378906 6 10 1.1.1.4544.2 1 56.6912 12725.8 56.7859 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 LGEHNIEVLEGNEQFINAAK Methyl(E)@7; Deamidated(N)@17 0.0145945996046066 2239.12670898438 747.3828 2239.11206054688 747.377990722656 3 16 1.1.1.4149.14 0 47.0296 404.187 47.0405 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 LGEHNIEVLEGNEQFINAAK Carbamidomethyl@N-term -0.00814902037382126 2281.12573242188 761.3825 2281.1337890625 761.38525390625 3 13 1.1.1.4157.8 0 47.2289 457.2366 47.1388 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 LGEHNIEVLEGNEQFINAAK -3.97329998016357 2220.13891601563 741.0536 2224.1123046875 742.378051757813 3 14 1.1.1.4160.8 1 47.2944 351.5675 47.1878 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 LGEHNIEVLEGNEQFINAAK Methyl(E)@7 0.0486886985599995 2238.17724609375 1120.096 2238.12817382813 1120.0712890625 2 21 1.1.1.4197.6 0 48.1957 1429.49 48.153 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 LGEHNIEVLEGNEQFINAAK Methyl(E)@7; Deamidated(Q)@14 0.0167918000370264 2239.12866210938 747.3835 2239.11206054688 747.377990722656 3 17 1.1.1.4238.7 0 49.1761 168.1741 49.1617 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 LGEHNIEVLEGNEQFINAAK Carbamidomethyl@N-term -0.00814902037382126 2281.12573242188 761.3825 2281.1337890625 761.38525390625 3 11 1.1.1.4150.11 0 47.0517 457.2366 47.1388 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 82.3000013828278 LGEHNIEVLEGNEQFINAAK Delta:H(2)C(2)(H)@4; Deamidated(N)@5 0.00893543008714914 2251.12084960938 751.3809 2251.11206054688 751.377990722656 3 9 1.1.1.4280.8 1 50.1976 152.3178 50.211 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 33.390000462532 LGEHNIEVLEGNEQFINAAK Methyl(E)@7 0.0168423000723124 2238.14501953125 747.0556 2238.12817382813 747.049987792969 3 13 1.1.1.4273.6 0 50.0266 1959.295 50.2603 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 27.1899998188019 LGEHNIEVLEGNEQFINAAK Oxidation(N)@12 -0.00419620983302593 2240.10302734375 747.7083 2240.107421875 747.709716796875 3 12 1.1.1.4160.10 0 47.2977 393.8165 47.3095 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 26.3300001621246 LGEHNIEVLEGNEQFINAAK -0.0044820299372077 2224.10791015625 742.3766 2224.1123046875 742.378051757813 3 16 1.1.1.4150.9 0 47.05 1289.668 47.0898 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 26.3300001621246 LGEHNIEVLEGNEQFINAAK 0.000827790005132556 2224.11352539063 742.3784 2224.1123046875 742.378051757813 3 23 1.1.1.4157.7 0 47.2264 1249.719 47.2365 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 23.589999973774 LGEHNIEVLEGNEQFINAAK 0.0119967004284263 2224.12451171875 742.3821 2224.1123046875 742.378051757813 3 11 1.1.1.4259.8 0 49.6882 275.5388 49.6737 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 17.620000243187 LGEHNIEVLEGNEQFINAAK Methyl(E)@7 0.0243493001908064 2238.15258789063 747.0581 2238.12817382813 747.049987792969 3 26 1.1.1.4194.6 0 48.1157 6677.309 48.2246 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 93.6800003051758 PHIQVRLGEHNIEVLEGNEQFINAAK Acetyl@N-term cleaved K-P@N-term; missed R-L@6 -0.0168028995394707 2996.53002929688 750.1398 2996.546875 750.143981933594 4 11 1.1.1.4284.6 0 50.3011 368.0207 50.2851 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.2400000095367 PYQVSLNSG cleaved V-P@N-term; cleaved G-S@C-term -4.00025987625122 959.4658203125 960.4731 963.466186523438 964.473449707031 1 8 1.1.1.4420.12 0 53.6057 5556.52 53.6935 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 SVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@15; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term; cleaved K-P@C-term 0.0669225975871086 3793.85375976563 949.4707 3793.78686523438 949.453979492188 4 13 1.1.1.4298.9 1 50.6404 14521.19 50.5765 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.8300025463104 SVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@15; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term; cleaved K-P@C-term 0.0669225975871086 3793.85375976563 949.4707 3793.78686523438 949.453979492188 4 12 1.1.1.4291.7 1 50.4685 14521.19 50.5765 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.7399995326996 SVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Carbamidomethyl(C)@15; Deamidated(Q)@23; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term; cleaved K-P@C-term 0.0369307994842529 3794.8076171875 759.9688 3794.77099609375 759.96142578125 5 12 1.1.1.4323.12 1 51.251 2571.939 51.3125 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 98.7399995326996 SVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Deamidated(N)@9; Carbamidomethyl(C)@15; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term; cleaved K-P@C-term 0.0445598997175694 3794.81494140625 759.9703 3794.77099609375 759.96142578125 5 12 1.1.1.4349.6 1 51.8893 882.9366 51.9266 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 57.039999961853 SVPYQVSLNSGSHFCGGSLISEQWVVSAGHCYK Deamidated(N)@9; Carbamidomethyl(C)@15; Carbamidomethyl(C)@31; ONE addition +154(K)@33 cleaved N-S@N-term; cleaved K-P@C-term 0.0445598997175694 3794.81494140625 759.9703 3794.77099609375 759.96142578125 5 9 1.1.1.4280.9 0 50.1993 942.2129 50.1865 5 2.05 6.05 45.3399986028671 23.8900005817413 23.0800002813339 sp|Q8NHM4|TRY6_HUMAN Putative trypsin-6 OS=Homo sapiens GN=TRY6 PE=5 SV=1 0 99.0000009536743 VLEGNEQFINAAK cleaved E-V@N-term 0.0176704004406929 1431.75341796875 716.884 1431.73583984375 716.875183105469 2 23 1.1.1.3712.4 0 36.5976 1386.948 36.6307 6 2.01 2.01 13.2400006055832 0.759000005200505 0.379500002600253 sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=1 SV=1 2 99.0000009536743 LGIASLSK acrolein addition +38(K)@8 -0.00409850012511015 825.491882324219 413.7532 825.496032714844 413.755279541016 2 10 1.1.1.3485.2 1 31.2578 1461.295 31.3496 6 2.01 2.01 13.2400006055832 0.759000005200505 0.379500002600253 sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=1 SV=1 0.00524305552244186 82.940000295639 SLKTPKKR acrolein addition +112(K)@3; acrolein addition +94(K)@7 missed K-T@3; missed K-K@6; missed K-R@7 -0.0079268803820014 1162.69946289063 582.357 1162.70739746094 582.360961914063 2 5 1.1.1.4566.2 1 57.2312 3352.032 57.2262 6 2.01 2.01 13.2400006055832 0.759000005200505 0.379500002600253 sp|Q2KJY2|KI26B_HUMAN Kinesin-like protein KIF26B OS=Homo sapiens GN=KIF26B PE=1 SV=1 0.000434511806815863 33.6899995803833 SLKTPKK MDA adduct +54(K)@3; acrolein addition +56(K)@6; acrolein addition +56(K)@7 missed K-T@3; missed K-K@6 0.0216272994875908 966.5966796875 484.3056 966.575012207031 484.294769287109 2 3 1.1.1.5720.3 1 77.4234 872.1699 77.5457 7 2.01 2.01 25.220000743866 23.479999601841 23.479999601841 sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1 2 99.0000009536743 FTISRDDSK missed R-D@5 0.00661914004012942 1067.53125 534.7729 1067.52478027344 534.769653320313 2 11 1.1.1.3123.3 1 23.1827 126.3622 23.1878 7 2.01 2.01 25.220000743866 23.479999601841 23.479999601841 sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1 0.00700490176677704 42.7700012922287 LLESGGGLVQPGGSLR cleaved Q-L@N-term 0.00385336996987462 1538.845703125 770.4301 1538.84167480469 770.428100585938 2 12 1.1.1.3724.4 1 36.8827 581.7219 36.9157 7 2.01 2.01 25.220000743866 23.479999601841 23.479999601841 sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1 0.00656376918777823 41.8099999427795 GRFTISR missed R-F@2 -0.000167396996403113 835.466247558594 418.7404 835.466430664063 418.740509033203 2 10 1.1.1.3162.2 1 23.8281 2542.529 23.7496 7 2.01 2.01 25.220000743866 23.479999601841 23.479999601841 sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1 0 40.4399991035461 GRFTISR missed R-F@2 -0.000167396996403113 835.466247558594 418.7404 835.466430664063 418.740509033203 2 10 1.1.1.3155.3 1 23.6642 2542.529 23.7496 7 2.01 2.01 25.220000743866 23.479999601841 23.479999601841 sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 VQLLESGGGLVQPGGSLR Carbamidomethyl@N-term; Carbamidomethyl(E)@5 cleaved E-V@N-term 0.0326917991042137 1880.04431152344 941.0294 1880.01159667969 941.013061523438 2 16 1.1.1.4378.5 1 52.572 575.1684 52.6108 7 2.01 2.01 25.220000743866 23.479999601841 23.479999601841 sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 VQLLESGGGLVQPGGSLR Carbamidomethyl@N-term; Carbamidomethyl(E)@5 cleaved E-V@N-term 0.0278092008084059 1880.03942871094 941.027 1880.01159667969 941.013061523438 2 14 1.1.1.4371.3 1 52.4065 887.6733 52.4677 7 2.01 2.01 25.220000743866 23.479999601841 23.479999601841 sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1 0 48.2100009918213 VQLLESGGGLVQPGGSLR Deamidated(Q)@2; GlyGly(S)@6 cleaved E-V@N-term 0.0516749992966652 1881.04724121094 628.023 1880.99560546875 628.005798339844 3 13 1.1.1.3913.5 0 41.2998 18301.92 41.4755 7 2.01 2.01 25.220000743866 23.479999601841 23.479999601841 sp|P01765|HV304_HUMAN Ig heavy chain V-III region TIL OS=Homo sapiens PE=1 SV=1 0 44.4499999284744 VQLLESGGGLVQPGGSLR Deamidated(Q)@2; GlyGly(S)@6 cleaved E-V@N-term 0.0516749992966652 1881.04724121094 628.023 1880.99560546875 628.005798339844 3 13 1.1.1.3927.6 1 41.6329 18441.39 41.4755 8 2 2 37.270000576973 10.0000001490116 10.0000001490116 sp|P81605|DCD_HUMAN; cont|000124 Dermcidin OS=Homo sapiens GN=DCD PE=1 SV=2; spt|P81605| Dermcidin precursor (Preproteolysin) (Contains: Survival-promoting peptide; DCD-1) [Homo sapiens (contaminant)] 2 99.0000009536743 ENAGEDPGLAR 0.0082028703764081 1127.52893066406 564.7717 1127.52075195313 564.767639160156 2 11 1.1.1.3086.10 1 22.4769 277.2191 22.4609 9 2 2 12.2699998319149 1.39800002798438 1.39800002798438 sp|P04264|K2C1_HUMAN; cont|000135; cont|000134 Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6; cra|hCP1609934.2| keratin 1 (epidermolytic hyperkeratosis) [Homo sapiens (contaminant)]; rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 TLLEGEESR 0.00679770018905401 1032.515625 517.2651 1032.5087890625 517.261657714844 2 8 1.1.1.3245.7 1 25.8473 166.0668 25.859 10 2 2 3.48200015723705 0.580399995669723 0.580399995669723 sp|P02751-9|FINC_HUMAN; sp|P02751-12|FINC_HUMAN Isoform Fibronectin not containing EIIIA and EIIIB and uses V64 variant of IIICS region of Fibronectin OS=Homo sapiens GN=FN1; Isoform 12 of Fibronectin OS=Homo sapiens GN=FN1 2 99.0000009536743 LGVRPSQGGEAPR -0.00494808983057737 1322.70068359375 441.9075 1322.70544433594 441.909118652344 3 17 1.1.1.3069.3 1 22.1552 229.9487 22.1905 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 2 99.0000009536743 AVSISISK Formyl@N-term; acrolein addition +38(K)@8 0.0121534001082182 869.498046875 435.7563 869.48583984375 435.750183105469 2 12 1.1.1.3500.2 1 31.6161 10935.09 31.3735 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 AVSISISK Methyl(S)@3; MDA adduct +54(K)@8 0.00800183974206448 871.509460449219 436.762 871.50146484375 436.758026123047 2 12 1.1.1.3481.6 1 31.1671 7400.121 31.3973 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.0141570996493101 869.536499023438 435.7755 869.522216796875 435.768371582031 2 11 1.1.1.3515.4 0 31.9764 183447 32.2102 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.0171476993709803 869.539245605469 435.7769 869.522216796875 435.768371582031 2 10 1.1.1.3617.5 0 34.4076 1237.855 34.4678 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 99.0000009536743 AVSISISK Delta:H(4)C(2)@N-term; MDA adduct +54(K)@8 0.011871499940753 885.529052734375 443.7718 885.517150878906 443.765838623047 2 11 1.1.1.3535.4 0 32.4577 9710.902 32.4251 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 73.3799993991852 AVSISISK Formyl@N-term; acrolein addition +38(K)@8 0.0121534001082182 869.498046875 435.7563 869.48583984375 435.750183105469 2 11 1.1.1.3492.5 1 31.4324 10792.02 31.3735 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 46.8100011348724 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.014584300108254 869.536865234375 435.7757 869.522216796875 435.768371582031 2 11 1.1.1.3526.5 0 32.2429 559948.5 32.3295 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 46.8100011348724 AVSISISK Delta:H(4)C(2)@N-term; MDA adduct +54(K)@8 0.0120545998215675 885.529296875 443.7719 885.517150878906 443.765838623047 2 11 1.1.1.3542.5 0 32.6249 10317.13 32.5206 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 44.4499999284744 AVSISISK Formyl@N-term; acrolein addition +38(K)@8 0.0105665000155568 869.496459960938 435.7555 869.48583984375 435.750183105469 2 11 1.1.1.3478.3 0 31.0941 7443.344 31.3258 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 44.4499999284744 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.014584300108254 869.536865234375 435.7757 869.522216796875 435.768371582031 2 11 1.1.1.3529.4 0 32.3111 559948.5 32.3295 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 44.4499999284744 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.0147673999890685 869.537048339844 435.7758 869.522216796875 435.768371582031 2 11 1.1.1.3543.4 0 32.6471 542912.7 32.4967 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 44.4499999284744 AVSISISK Delta:H(4)C(2)@N-term; MDA adduct +54(K)@8 0.0120545998215675 885.529296875 443.7719 885.517150878906 443.765838623047 2 10 1.1.1.3550.5 0 32.8178 8914.596 32.5684 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 42.1700000762939 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.0147673999890685 869.537048339844 435.7758 869.522216796875 435.768371582031 2 11 1.1.1.3536.9 0 32.4816 542912.7 32.4967 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 29.2199999094009 AVSISISK Formyl@N-term; acrolein addition +38(K)@8 0.0121534001082182 869.498046875 435.7563 869.48583984375 435.750183105469 2 8 1.1.1.3485.3 1 31.2595 10792.02 31.3735 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 29.2199999094009 AVSISISK Formyl@N-term; acrolein addition +38(K)@8 0.0121534001082182 869.498046875 435.7563 869.48583984375 435.750183105469 2 10 1.1.1.3485.4 1 31.2612 10792.02 31.3735 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 29.2199999094009 AVSISISK Formyl@N-term; acrolein addition +38(K)@8 0.0125195998698473 869.498291015625 435.7564 869.48583984375 435.750183105469 2 10 1.1.1.3507.3 1 31.787 2392.923 31.5402 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 29.2199999094009 AVSISISK Methyl(S)@3; MDA adduct +54(K)@8 0.00519435992464423 871.506652832031 436.7606 871.50146484375 436.758026123047 2 11 1.1.1.3510.4 1 31.8644 637.2252 31.826 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 28.7000000476837 AVSISISK acrolein addition +38(K)@8 0.0138096995651722 841.504699707031 421.7596 841.490905761719 421.752746582031 2 11 1.1.1.3435.3 0 30.0655 874106.9 30.1286 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 27.1899998188019 AVSISISK Dehydrated(S)@3; acrolein addition +38(K)@8 0.0122605003416538 823.49267578125 412.7536 823.480346679688 412.747467041016 2 10 1.1.1.3442.2 0 30.2303 30918.67 30.2248 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 25.2000004053116 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.0143402004614472 869.536499023438 435.7755 869.522216796875 435.768371582031 2 10 1.1.1.3551.5 0 32.8375 382866.4 32.5923 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 23.2500001788139 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.0141570996493101 869.536499023438 435.7755 869.522216796875 435.768371582031 2 10 1.1.1.3558.5 0 33.0033 128085.1 32.7589 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 21.3300004601479 AVSISISK Delta:H(4)C(2)@N-term; MDA adduct +54(K)@8 0.0120545998215675 885.529296875 443.7719 885.517150878906 443.765838623047 2 10 1.1.1.3528.4 0 32.2889 9188.97 32.3057 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 19.4499999284744 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.014584300108254 869.536865234375 435.7757 869.522216796875 435.768371582031 2 10 1.1.1.3522.5 0 32.1437 555334.4 32.3295 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 19.4499999284744 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.0147673999890685 869.537048339844 435.7758 869.522216796875 435.768371582031 2 10 1.1.1.3544.4 0 32.6734 542912.7 32.4967 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 19.4499999284744 AVSISISK Delta:H(4)C(2)@N-term; acrolein addition +38(K)@8 0.0141570996493101 869.536499023438 435.7755 869.522216796875 435.768371582031 2 10 1.1.1.3565.6 0 33.1751 70476.47 32.926 11 2 2 22.8300005197525 1.39800002798438 1.2419999577105 RRRRRcont|000134 REVERSED rf|NP_006112.2| keratin 1 [Homo sapiens (contaminant)] 0 90.5399978160858 AVSISISKS acrolein addition +38(K)@8 cleaved S-G@C-term; missed K-S@8 -0.0224511008709669 928.50048828125 465.2575 928.52294921875 465.268737792969 2 11 1.1.1.3433.4 1 30.0184 1209.716 30.0086 12 2 2 27.4599999189377 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 2 99.0000009536743 VGAHAGEYGAEALERMFLSFPTTK missed R-M@15 -0.00106935994699597 2581.26245117188 646.3229 2581.26342773438 646.323181152344 4 24 1.1.1.4689.3 1 60.156 236.7023 60.1259 12 2 2 27.4599999189377 16.8999999761581 16.8999999761581 sp|P69905|HBA_HUMAN Hemoglobin subunit alpha OS=Homo sapiens GN=HBA1 PE=1 SV=2 0 96.0099995136261 VGAHAGEYGAEALERMFLSFPTTK Oxidation(M)@16 missed R-M@15 0.0102522997185588 2597.26904296875 650.3245 2597.25854492188 650.321899414063 4 15 1.1.1.4422.4 1 53.6481 1581.445 53.7196 13 2 2 10.1099997758865 8.18599984049797 2.56799999624491 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 2 99.0000009536743 SGGGGGGGLGSGGSIR 0.0123223997652531 1231.60290527344 616.8087 1231.59057617188 616.802551269531 2 23 1.1.1.3128.4 1 23.2653 210.8521 23.2704 13 2 2 10.1099997758865 8.18599984049797 2.56799999624491 sp|P35527|K1C9_HUMAN Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3 0 60.589998960495 ALKKNHKEEMSQLTGQNSGDVNVEINVAPGKDLTK MDA adduct +62(K)@4; acrolein addition +112(K)@7; acrolein addition +76(K)@31; hexanoyl addition +98(K)@35 cleaved M-A@N-term; missed K-K@3; missed K-N@4; missed K-E@7; missed K-D@31 0.0335795991122723 4140.15478515625 1036.046 4140.1201171875 1036.03735351563 4 9 1.1.1.4987.2 1 67.3194 619.0994 67.3588 14 2 2 40.1800006628037 11.6099998354912 11.6099998354912 sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1 2 99.0000009536743 FSGSGSGTBFTLK Deamidated(B)@9 0.0162928998470306 1302.62548828125 652.32 1302.60925292969 652.311889648438 2 19 1.1.1.3659.5 1 35.3742 1166.42 35.4119 14 2 2 40.1800006628037 11.6099998354912 11.6099998354912 sp|P01616|KV203_HUMAN Ig kappa chain V-II region MIL OS=Homo sapiens PE=1 SV=1 0 99.0000009536743 FSGSGSGTBFTLK Deamidated(B)@9 0.0191003996878862 1302.62829589844 652.3214 1302.60925292969 652.311889648438 2 18 1.1.1.3667.5 1 35.5497 1157.315 35.4834