MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	mHCT116_iTRAQ_JPST000205
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190823\20190823215055952307^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_CH_1\120307_mHCT116_iTRAQ_02.HCD.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190823\20190823215055952307^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\120307_mHCT116_iTRAQ_02.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[1]-setting	variableModifications=iTRAQ4plex (Y),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[2]-setting	IT_MODS=Oxidation (M),iTRAQ4plex (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=5
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[3]-setting	VarMod=iTRAQ4plex (Y),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	fixed_mod[2]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	fixed_mod[2]-site	K
MTD	fixed_mod[2]-position	Anywhere
MTD	fixed_mod[3]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	fixed_mod[3]-site	N-term
MTD	fixed_mod[3]-position	Any N-term
MTD	variable_mod[1]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	variable_mod[1]-site	Y
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P30044-4|PRDX5_HUMAN	Isoform 4 of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	103-UNIMOD:214,115-UNIMOD:4	0.19	29.0	2	1	0
PRT	sp|P85037-2|FOXK1_HUMAN	Isoform 2 of Forkhead box protein K1 OS=Homo sapiens OX=9606 GN=FOXK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	544-UNIMOD:214	0.05	27.0	1	1	1
PRT	sp|P48729-3|KC1A_HUMAN	Isoform 3 of Casein kinase I isoform alpha OS=Homo sapiens OX=9606 GN=CSNK1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	305-UNIMOD:214	0.07	26.0	1	1	1
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	215-UNIMOD:214	0.08	26.0	1	1	1
PRT	sp|Q8WZA9|IRGQ_HUMAN	Immunity-related GTPase family Q protein OS=Homo sapiens OX=9606 GN=IRGQ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	610-UNIMOD:214	0.02	24.0	1	1	1
PRT	sp|Q8WY36-2|BBX_HUMAN	Isoform 2 of HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	898-UNIMOD:214,908-UNIMOD:4	0.02	24.0	2	1	0
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	2064-UNIMOD:214,2078-UNIMOD:35,2074-UNIMOD:35	0.01	24.0	12	1	0
PRT	sp|Q7Z4W1|DCXR_HUMAN	L-xylulose reductase OS=Homo sapiens OX=9606 GN=DCXR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	227-UNIMOD:214,244-UNIMOD:4	0.08	24.0	1	1	1
PRT	sp|Q8TAE8|G45IP_HUMAN	Growth arrest and DNA damage-inducible proteins-interacting protein 1 OS=Homo sapiens OX=9606 GN=GADD45GIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	203-UNIMOD:214	0.09	23.0	2	1	0
PRT	sp|Q9NZZ3|CHMP5_HUMAN	Charged multivesicular body protein 5 OS=Homo sapiens OX=9606 GN=CHMP5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	204-UNIMOD:214	0.08	23.0	1	1	1
PRT	sp|Q08209-4|PP2BA_HUMAN	Isoform 4 of Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	270-UNIMOD:214	0.07	22.0	1	1	1
PRT	sp|P36542|ATPG_HUMAN	ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	286-UNIMOD:214	0.05	22.0	2	1	0
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1293-UNIMOD:214,1302-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|P52758|RIDA_HUMAN	2-iminobutanoate/2-iminopropanoate deaminase OS=Homo sapiens OX=9606 GN=RIDA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	121-UNIMOD:214	0.13	22.0	2	1	0
PRT	sp|Q9BT78|CSN4_HUMAN	COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	388-UNIMOD:214	0.05	22.0	2	1	0
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	285-UNIMOD:214	0.07	21.0	1	1	1
PRT	sp|Q14019|COTL1_HUMAN	Coactosin-like protein OS=Homo sapiens OX=9606 GN=COTL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	132-UNIMOD:214	0.08	21.0	2	1	0
PRT	sp|Q9Y570-2|PPME1_HUMAN	Isoform 2 of Protein phosphatase methylesterase 1 OS=Homo sapiens OX=9606 GN=PPME1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	185-UNIMOD:214,194-UNIMOD:4,199-UNIMOD:4	0.08	21.0	1	1	1
PRT	sp|P40938|RFC3_HUMAN	Replication factor C subunit 3 OS=Homo sapiens OX=9606 GN=RFC3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	346-UNIMOD:214,355-UNIMOD:35	0.03	21.0	2	1	0
PRT	sp|Q9UBQ5|EIF3K_HUMAN	Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	205-UNIMOD:214	0.07	21.0	3	1	0
PRT	sp|Q9UHA3|RLP24_HUMAN	Probable ribosome biogenesis protein RLP24 OS=Homo sapiens OX=9606 GN=RSL24D1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	149-UNIMOD:214,149-UNIMOD:35,159-UNIMOD:35	0.10	21.0	4	1	0
PRT	sp|P61086-2|UBE2K_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 K OS=Homo sapiens OX=9606 GN=UBE2K	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	136-UNIMOD:214	0.10	21.0	1	1	1
PRT	sp|Q9Y2Q5|LTOR2_HUMAN	Ragulator complex protein LAMTOR2 OS=Homo sapiens OX=9606 GN=LAMTOR2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	108-UNIMOD:214	0.15	21.0	1	1	1
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	401-UNIMOD:214	0.03	20.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	133-UNIMOD:214	0.10	20.0	3	1	0
PRT	sp|Q96F45-3|ZN503_HUMAN	Isoform 3 of Zinc finger protein 503 OS=Homo sapiens OX=9606 GN=ZNF503	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	274-UNIMOD:214	0.04	20.0	1	1	1
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	256-UNIMOD:214	0.07	20.0	1	1	1
PRT	sp|Q9BRT9|SLD5_HUMAN	DNA replication complex GINS protein SLD5 OS=Homo sapiens OX=9606 GN=GINS4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	210-UNIMOD:214	0.07	20.0	1	1	1
PRT	sp|Q8N668|COMD1_HUMAN	COMM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=COMMD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	174-UNIMOD:214	0.09	20.0	2	1	0
PRT	sp|Q96P11-2|NSUN5_HUMAN	Isoform 2 of Probable 28S rRNA (cytosine-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	456-UNIMOD:214,461-UNIMOD:4,465-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|O15127|SCAM2_HUMAN	Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	317-UNIMOD:214	0.04	19.0	1	1	1
PRT	sp|P61619-3|S61A1_HUMAN	Isoform 3 of Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	344-UNIMOD:214,351-UNIMOD:35	0.04	19.0	3	1	0
PRT	sp|Q96DZ1-3|ERLEC_HUMAN	Isoform 3 of Endoplasmic reticulum lectin 1 OS=Homo sapiens OX=9606 GN=ERLEC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	443-UNIMOD:214	0.04	19.0	1	1	0
PRT	sp|Q8WV07|LTO1_HUMAN	Protein LTO1 homolog OS=Homo sapiens OX=9606 GN=LTO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	128-UNIMOD:214	0.08	19.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	96-UNIMOD:214,101-UNIMOD:4	0.10	19.0	8	1	0
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	145-UNIMOD:214,147-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	428-UNIMOD:214	0.04	19.0	2	1	0
PRT	sp|Q6ZMU5|TRI72_HUMAN	Tripartite motif-containing protein 72 OS=Homo sapiens OX=9606 GN=TRIM72 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	463-UNIMOD:214	0.03	19.0	2	1	0
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	321-UNIMOD:214	0.05	19.0	2	1	0
PRT	sp|O95453-4|PARN_HUMAN	Isoform 4 of Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	452-UNIMOD:214	0.03	19.0	1	1	0
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	498-UNIMOD:214	0.02	19.0	1	1	1
PRT	sp|Q14145|KEAP1_HUMAN	Kelch-like ECH-associated protein 1 OS=Homo sapiens OX=9606 GN=KEAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	616-UNIMOD:214,622-UNIMOD:4,624-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	438-UNIMOD:214	0.02	19.0	1	1	1
PRT	sp|Q9NZJ7-3|MTCH1_HUMAN	Isoform 3 of Mitochondrial carrier homolog 1 OS=Homo sapiens OX=9606 GN=MTCH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	162-UNIMOD:214,167-UNIMOD:4	0.06	19.0	1	1	1
PRT	sp|Q99627|CSN8_HUMAN	COP9 signalosome complex subunit 8 OS=Homo sapiens OX=9606 GN=COPS8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	200-UNIMOD:214	0.05	19.0	1	1	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	223-UNIMOD:214	0.10	18.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	773-UNIMOD:214	0.04	18.0	1	1	1
PRT	sp|Q12893|TM115_HUMAN	Transmembrane protein 115 OS=Homo sapiens OX=9606 GN=TMEM115 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	334-UNIMOD:214	0.05	18.0	1	1	1
PRT	sp|Q9UL63-2|MKLN1_HUMAN	Isoform 2 of Muskelin OS=Homo sapiens OX=9606 GN=MKLN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	520-UNIMOD:214	0.02	18.0	1	1	1
PRT	sp|Q7Z417|NUFP2_HUMAN	Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	683-UNIMOD:214,690-UNIMOD:35	0.02	18.0	1	1	1
PRT	sp|Q99720-5|SGMR1_HUMAN	Isoform 5 of Sigma non-opioid intracellular receptor 1 OS=Homo sapiens OX=9606 GN=SIGMAR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	176-UNIMOD:214	0.07	18.0	1	1	0
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	1275-UNIMOD:214	0.01	18.0	1	1	0
PRT	sp|Q96B49|TOM6_HUMAN	Mitochondrial import receptor subunit TOM6 homolog OS=Homo sapiens OX=9606 GN=TOMM6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	61-UNIMOD:214,68-UNIMOD:35	0.20	18.0	2	1	0
PRT	sp|Q14157|UBP2L_HUMAN	Ubiquitin-associated protein 2-like OS=Homo sapiens OX=9606 GN=UBAP2L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	1077-UNIMOD:214	0.01	18.0	1	1	1
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	432-UNIMOD:214	0.03	18.0	1	1	1
PRT	sp|O43707-3|ACTN4_HUMAN	Isoform 3 of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	510-UNIMOD:214	0.02	18.0	2	1	0
PRT	sp|Q13557-12|KCC2D_HUMAN	Isoform Delta 12 of Calcium/calmodulin-dependent protein kinase type II subunit delta OS=Homo sapiens OX=9606 GN=CAMK2D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	470-UNIMOD:214	0.02	18.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	860-UNIMOD:214	0.02	18.0	2	1	0
PRT	sp|Q96GX9-3|MTNB_HUMAN	Isoform 2 of Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	189-UNIMOD:214	0.08	18.0	1	1	0
PRT	sp|Q15291|RBBP5_HUMAN	Retinoblastoma-binding protein 5 OS=Homo sapiens OX=9606 GN=RBBP5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	520-UNIMOD:214	0.04	18.0	2	1	0
PRT	sp|Q9BSV6|SEN34_HUMAN	tRNA-splicing endonuclease subunit Sen34 OS=Homo sapiens OX=9606 GN=TSEN34 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	299-UNIMOD:214	0.04	18.0	1	1	1
PRT	sp|Q9BYN0|SRXN1_HUMAN	Sulfiredoxin-1 OS=Homo sapiens OX=9606 GN=SRXN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	127-UNIMOD:214	0.09	18.0	1	1	1
PRT	sp|Q6Y7W6|GGYF2_HUMAN	GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	1288-UNIMOD:214,1290-UNIMOD:35	0.01	18.0	1	1	0
PRT	sp|P11940|PABP1_HUMAN	Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	626-UNIMOD:214	0.02	18.0	3	1	0
PRT	sp|Q9P2T1|GMPR2_HUMAN	GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	336-UNIMOD:214,348-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q9P0V3-2|SH3B4_HUMAN	Isoform 2 of SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	539-UNIMOD:214	0.03	17.0	1	1	1
PRT	sp|Q13541|4EBP1_HUMAN	Eukaryotic translation initiation factor 4E-binding protein 1 OS=Homo sapiens OX=9606 GN=EIF4EBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	107-UNIMOD:214	0.11	17.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	330-UNIMOD:214,335-UNIMOD:4	0.03	17.0	2	1	0
PRT	sp|Q9C035|TRIM5_HUMAN	Tripartite motif-containing protein 5 OS=Homo sapiens OX=9606 GN=TRIM5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	482-UNIMOD:214,482-UNIMOD:4,489-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|Q9BRQ0|PYGO2_HUMAN	Pygopus homolog 2 OS=Homo sapiens OX=9606 GN=PYGO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	395-UNIMOD:214	0.03	17.0	1	1	1
PRT	sp|O14763-2|TR10B_HUMAN	Isoform Short of Tumor necrosis factor receptor superfamily member 10B OS=Homo sapiens OX=9606 GN=TNFRSF10B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	399-UNIMOD:214	0.03	17.0	1	1	1
PRT	sp|P30530-2|UFO_HUMAN	Isoform Short of Tyrosine-protein kinase receptor UFO OS=Homo sapiens OX=9606 GN=AXL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	874-UNIMOD:214	0.01	17.0	1	1	1
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	401-UNIMOD:214	0.04	17.0	1	1	1
PRT	sp|Q96FZ5-2|CKLF7_HUMAN	Isoform 2 of CKLF-like MARVEL transmembrane domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CMTM7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	131-UNIMOD:214,133-UNIMOD:4	0.09	17.0	1	1	1
PRT	sp|Q9BUW7|CI016_HUMAN	UPF0184 protein C9orf16 OS=Homo sapiens OX=9606 GN=C9orf16 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	68-UNIMOD:214	0.20	17.0	1	1	1
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	292-UNIMOD:214	0.06	17.0	1	1	1
PRT	sp|O60337-6|MARH6_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase MARCH6 OS=Homo sapiens OX=9606 GN=MARCH6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	793-UNIMOD:214	0.02	17.0	1	1	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	370-UNIMOD:214	0.05	17.0	1	1	1
PRT	sp|O76041-2|NEBL_HUMAN	Isoform 2 of Nebulette OS=Homo sapiens OX=9606 GN=NEBL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	258-UNIMOD:214	0.05	17.0	1	1	1
PRT	sp|O95453|PARN_HUMAN	Poly(A)-specific ribonuclease PARN OS=Homo sapiens OX=9606 GN=PARN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	627-UNIMOD:214	0.02	17.0	1	1	0
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	1171-UNIMOD:214,1179-UNIMOD:4	0.01	17.0	2	1	0
PRT	sp|Q96DZ1|ERLEC_HUMAN	Endoplasmic reticulum lectin 1 OS=Homo sapiens OX=9606 GN=ERLEC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	469-UNIMOD:214	0.03	17.0	1	1	0
PRT	sp|Q96GX9|MTNB_HUMAN	Methylthioribulose-1-phosphate dehydratase OS=Homo sapiens OX=9606 GN=APIP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	227-UNIMOD:214	0.07	17.0	2	1	0
PRT	sp|Q9UNH7|SNX6_HUMAN	Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	390-UNIMOD:214,398-UNIMOD:4	0.04	17.0	2	1	0
PRT	sp|O75648-4|MTU1_HUMAN	Isoform 4 of Mitochondrial tRNA-specific 2-thiouridylase 1 OS=Homo sapiens OX=9606 GN=TRMU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	246-UNIMOD:214	0.09	16.0	2	1	0
PRT	sp|O43657|TSN6_HUMAN	Tetraspanin-6 OS=Homo sapiens OX=9606 GN=TSPAN6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	236-UNIMOD:214	0.04	16.0	1	1	1
PRT	sp|Q12933-4|TRAF2_HUMAN	Isoform 4 of TNF receptor-associated factor 2 OS=Homo sapiens OX=9606 GN=TRAF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	469-UNIMOD:214	0.02	16.0	1	1	1
PRT	sp|Q9Y5B0|CTDP1_HUMAN	RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens OX=9606 GN=CTDP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	952-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|Q16658|FSCN1_HUMAN	Fascin OS=Homo sapiens OX=9606 GN=FSCN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	480-UNIMOD:214	0.03	16.0	1	1	1
PRT	sp|Q15006|EMC2_HUMAN	ER membrane protein complex subunit 2 OS=Homo sapiens OX=9606 GN=EMC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	284-UNIMOD:214	0.05	16.0	1	1	1
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	703-UNIMOD:214,703-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|O14524-2|NEMP1_HUMAN	Isoform 2 of Nuclear envelope integral membrane protein 1 OS=Homo sapiens OX=9606 GN=NEMP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	361-UNIMOD:214,361-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	492-UNIMOD:214	0.03	16.0	2	1	0
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	236-UNIMOD:214	0.04	16.0	1	1	1
PRT	sp|Q9UG56-2|PISD_HUMAN	Isoform 2 of Phosphatidylserine decarboxylase proenzyme, mitochondrial OS=Homo sapiens OX=9606 GN=PISD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	368-UNIMOD:214	0.02	16.0	1	1	1
PRT	sp|Q08345-2|DDR1_HUMAN	Isoform 2 of Epithelial discoidin domain-containing receptor 1 OS=Homo sapiens OX=9606 GN=DDR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	867-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|P50895|BCAM_HUMAN	Basal cell adhesion molecule OS=Homo sapiens OX=9606 GN=BCAM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	619-UNIMOD:214,628-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q9ULX6-2|AKP8L_HUMAN	Isoform 2 of A-kinase anchor protein 8-like OS=Homo sapiens OX=9606 GN=AKAP8L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	568-UNIMOD:214	0.03	16.0	1	1	1
PRT	sp|P22670|RFX1_HUMAN	MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	970-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|P49903-2|SPS1_HUMAN	Isoform 2 of Selenide, water dikinase 1 OS=Homo sapiens OX=9606 GN=SEPHS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	301-UNIMOD:214	0.07	16.0	1	1	1
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	198-UNIMOD:214,203-UNIMOD:4	0.05	16.0	1	1	1
PRT	sp|P36956|SRBP1_HUMAN	Sterol regulatory element-binding protein 1 OS=Homo sapiens OX=9606 GN=SREBF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	1138-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	465-UNIMOD:214	0.02	16.0	1	1	1
PRT	sp|Q14376-2|GALE_HUMAN	Isoform 2 of UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN=GALE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	265-UNIMOD:214	0.04	16.0	1	1	1
PRT	sp|O14545|TRAD1_HUMAN	TRAF-type zinc finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=TRAFD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	570-UNIMOD:214	0.02	16.0	1	1	1
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	896-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|Q6ZVM7-4|TM1L2_HUMAN	Isoform 4 of TOM1-like protein 2 OS=Homo sapiens OX=9606 GN=TOM1L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	233-UNIMOD:214	0.04	16.0	1	1	1
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	139-UNIMOD:214,144-UNIMOD:4	0.07	16.0	1	1	1
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	2128-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|P25685-2|DNJB1_HUMAN	Isoform 2 of DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	232-UNIMOD:214	0.04	16.0	3	1	0
PRT	sp|Q9NR46|SHLB2_HUMAN	Endophilin-B2 OS=Homo sapiens OX=9606 GN=SH3GLB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	386-UNIMOD:214	0.03	16.0	1	1	1
PRT	sp|Q9UK22|FBX2_HUMAN	F-box only protein 2 OS=Homo sapiens OX=9606 GN=FBXO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	16.0	null	287-UNIMOD:214	0.04	16.0	2	1	0
PRT	sp|Q9H993|ARMT1_HUMAN	Protein-glutamate O-methyltransferase OS=Homo sapiens OX=9606 GN=ARMT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	432-UNIMOD:214	0.02	16.0	1	1	1
PRT	sp|Q99720|SGMR1_HUMAN	Sigma non-opioid intracellular receptor 1 OS=Homo sapiens OX=9606 GN=SIGMAR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	212-UNIMOD:214	0.06	16.0	1	1	0
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	377-UNIMOD:214	0.05	16.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	16.0	null	237-UNIMOD:214,248-UNIMOD:35,237-UNIMOD:35	0.05	16.0	4	1	0
PRT	sp|O14939|PLD2_HUMAN	Phospholipase D2 OS=Homo sapiens OX=9606 GN=PLD2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	924-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	16.0	null	799-UNIMOD:214	0.02	16.0	2	1	0
PRT	sp|P0DMV8|HS71A_HUMAN	Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	629-UNIMOD:214	0.02	16.0	1	1	1
PRT	sp|Q13641|TPBG_HUMAN	Trophoblast glycoprotein OS=Homo sapiens OX=9606 GN=TPBG PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	411-UNIMOD:214	0.03	16.0	1	1	1
PRT	sp|Q86U38|NOP9_HUMAN	Nucleolar protein 9 OS=Homo sapiens OX=9606 GN=NOP9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	629-UNIMOD:214	0.01	15.0	1	1	1
PRT	sp|Q9UNW1-4|MINP1_HUMAN	Isoform 4 of Multiple inositol polyphosphate phosphatase 1 OS=Homo sapiens OX=9606 GN=MINPP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	279-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	1071-UNIMOD:214	0.01	15.0	1	1	1
PRT	sp|Q9UHV9|PFD2_HUMAN	Prefoldin subunit 2 OS=Homo sapiens OX=9606 GN=PFDN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	146-UNIMOD:214	0.06	15.0	1	1	1
PRT	sp|P16104|H2AX_HUMAN	Histone H2AX OS=Homo sapiens OX=9606 GN=H2AFX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	136-UNIMOD:214	0.06	15.0	2	1	0
PRT	sp|Q9Y4X5|ARI1_HUMAN	E3 ubiquitin-protein ligase ARIH1 OS=Homo sapiens OX=9606 GN=ARIH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	550-UNIMOD:214	0.02	15.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	223-UNIMOD:214	0.05	15.0	1	1	1
PRT	sp|Q9NPD3|EXOS4_HUMAN	Exosome complex component RRP41 OS=Homo sapiens OX=9606 GN=EXOSC4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	238-UNIMOD:214	0.04	15.0	1	1	1
PRT	sp|P28072|PSB6_HUMAN	Proteasome subunit beta type-6 OS=Homo sapiens OX=9606 GN=PSMB6 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	231-UNIMOD:214	0.04	15.0	5	1	0
PRT	sp|O15160|RPAC1_HUMAN	DNA-directed RNA polymerases I and III subunit RPAC1 OS=Homo sapiens OX=9606 GN=POLR1C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	336-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|O75964|ATP5L_HUMAN	ATP synthase subunit g, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5MG PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	97-UNIMOD:214	0.08	15.0	1	1	1
PRT	sp|O75792|RNH2A_HUMAN	Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	292-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|Q0PNE2|ELP6_HUMAN	Elongator complex protein 6 OS=Homo sapiens OX=9606 GN=ELP6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	260-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|Q9BUE6|ISCA1_HUMAN	Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	119-UNIMOD:214,121-UNIMOD:4,123-UNIMOD:4	0.09	15.0	1	1	1
PRT	sp|P32969|RL9_HUMAN	60S ribosomal protein L9 OS=Homo sapiens OX=9606 GN=RPL9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	185-UNIMOD:214	0.05	15.0	1	1	1
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	132-UNIMOD:214	0.07	15.0	1	1	1
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	580-UNIMOD:214	0.01	15.0	5	1	0
PRT	sp|P45985|MP2K4_HUMAN	Dual specificity mitogen-activated protein kinase kinase 4 OS=Homo sapiens OX=9606 GN=MAP2K4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	384-UNIMOD:214,396-UNIMOD:35	0.04	15.0	2	1	0
PRT	sp|P12830-2|CADH1_HUMAN	Isoform 2 of Cadherin-1 OS=Homo sapiens OX=9606 GN=CDH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	811-UNIMOD:214	0.01	15.0	1	1	1
PRT	sp|O43768-5|ENSA_HUMAN	Isoform 5 of Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	111-UNIMOD:214	0.07	15.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	77-UNIMOD:214	0.12	15.0	2	1	0
PRT	sp|O96018|APBA3_HUMAN	Amyloid-beta A4 precursor protein-binding family A member 3 OS=Homo sapiens OX=9606 GN=APBA3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	565-UNIMOD:214	0.02	15.0	1	1	1
PRT	sp|Q9Y6X5|ENPP4_HUMAN	Bis(5'-adenosyl)-triphosphatase ENPP4 OS=Homo sapiens OX=9606 GN=ENPP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	441-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|P49591|SYSC_HUMAN	Serine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=SARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	506-UNIMOD:214	0.02	15.0	1	1	1
PRT	sp|Q15366-7|PCBP2_HUMAN	Isoform 7 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	308-UNIMOD:214,315-UNIMOD:35	0.04	15.0	3	1	0
PRT	sp|Q9NVM6|DJC17_HUMAN	DnaJ homolog subfamily C member 17 OS=Homo sapiens OX=9606 GN=DNAJC17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	294-UNIMOD:214,294-UNIMOD:35	0.04	15.0	2	1	0
PRT	sp|Q504Q3-2|PAN2_HUMAN	Isoform 2 of PAN2-PAN3 deadenylation complex catalytic subunit PAN2 OS=Homo sapiens OX=9606 GN=PAN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	1188-UNIMOD:214	0.01	15.0	1	1	1
PRT	sp|O94763-4|RMP_HUMAN	Isoform 4 of Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	467-UNIMOD:214	0.02	15.0	1	1	1
PRT	sp|P09668|CATH_HUMAN	Pro-cathepsin H OS=Homo sapiens OX=9606 GN=CTSH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	320-UNIMOD:214,322-UNIMOD:4,327-UNIMOD:4	0.05	15.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	433-UNIMOD:214	0.02	15.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	446-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|Q86TG7-2|PEG10_HUMAN	Isoform 2 of Retrotransposon-derived protein PEG10 OS=Homo sapiens OX=9606 GN=PEG10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	315-UNIMOD:214	0.04	15.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=HIST1H4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	97-UNIMOD:214	0.08	15.0	1	1	1
PRT	sp|Q9GZU8|PIP30_HUMAN	PSME3-interacting protein OS=Homo sapiens OX=9606 GN=FAM192A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	247-UNIMOD:214	0.04	15.0	1	1	1
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	1401-UNIMOD:214,1402-UNIMOD:4,1405-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	623-UNIMOD:214	0.02	15.0	1	1	1
PRT	sp|Q9UBS4|DJB11_HUMAN	DnaJ homolog subfamily B member 11 OS=Homo sapiens OX=9606 GN=DNAJB11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	351-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|P30154-5|2AAB_HUMAN	Isoform 5 of Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	462-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|Q9H009|NACA2_HUMAN	Nascent polypeptide-associated complex subunit alpha-2 OS=Homo sapiens OX=9606 GN=NACA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	201-UNIMOD:214	0.07	15.0	1	1	1
PRT	sp|P10644|KAP0_HUMAN	cAMP-dependent protein kinase type I-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR1A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	369-UNIMOD:214	0.04	15.0	1	1	1
PRT	sp|Q96FV9|THOC1_HUMAN	THO complex subunit 1 OS=Homo sapiens OX=9606 GN=THOC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	640-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|P25685|DNJB1_HUMAN	DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	332-UNIMOD:214	0.03	15.0	1	1	0
PRT	sp|P35241|RADI_HUMAN	Radixin OS=Homo sapiens OX=9606 GN=RDX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	577-UNIMOD:214,583-UNIMOD:35	0.01	15.0	2	1	0
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	15.0	null	172-UNIMOD:214	0.04	15.0	2	1	0
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	15.0	null	695-UNIMOD:214	0.01	15.0	2	1	0
PRT	sp|Q5T200|ZC3HD_HUMAN	Zinc finger CCCH domain-containing protein 13 OS=Homo sapiens OX=9606 GN=ZC3H13 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	1656-UNIMOD:214,1666-UNIMOD:4	0.01	15.0	1	1	1
PRT	sp|Q9HD40|SPCS_HUMAN	O-phosphoseryl-tRNA(Sec) selenium transferase OS=Homo sapiens OX=9606 GN=SEPSECS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	488-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|P67809|YBOX1_HUMAN	Nuclease-sensitive element-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	305-UNIMOD:214	0.06	14.0	1	1	1
PRT	sp|P61927|RL37_HUMAN	60S ribosomal protein L37 OS=Homo sapiens OX=9606 GN=RPL37 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	89-UNIMOD:214	0.10	14.0	1	1	1
PRT	sp|A6NIH7|U119B_HUMAN	Protein unc-119 homolog B OS=Homo sapiens OX=9606 GN=UNC119B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	243-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|O00418|EF2K_HUMAN	Eukaryotic elongation factor 2 kinase OS=Homo sapiens OX=9606 GN=EEF2K PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	716-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|Q13111-3|CAF1A_HUMAN	Isoform 3 of Chromatin assembly factor 1 subunit A OS=Homo sapiens OX=9606 GN=CHAF1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	773-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	537-UNIMOD:214	0.02	14.0	1	1	0
PRT	sp|Q3KQU3-3|MA7D1_HUMAN	Isoform 3 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	366-UNIMOD:214	0.03	14.0	1	1	1
PRT	sp|Q14653-3|IRF3_HUMAN	Isoform 3 of Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	137-UNIMOD:214	0.12	14.0	1	1	1
PRT	sp|O60308|CE104_HUMAN	Centrosomal protein of 104 kDa OS=Homo sapiens OX=9606 GN=CEP104 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	711-UNIMOD:214,719-UNIMOD:214	0.01	14.0	1	1	1
PRT	sp|P30520|PURA2_HUMAN	Adenylosuccinate synthetase isozyme 2 OS=Homo sapiens OX=9606 GN=ADSS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	450-UNIMOD:214	0.02	14.0	3	1	0
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	492-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|Q9NQP4|PFD4_HUMAN	Prefoldin subunit 4 OS=Homo sapiens OX=9606 GN=PFDN4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	123-UNIMOD:214	0.10	14.0	1	1	1
PRT	sp|O60504-2|VINEX_HUMAN	Isoform Beta of Vinexin OS=Homo sapiens OX=9606 GN=SORBS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	318-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|Q8WZ82|OVCA2_HUMAN	Esterase OVCA2 OS=Homo sapiens OX=9606 GN=OVCA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	221-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|Q9NRY6|PLS3_HUMAN	Phospholipid scramblase 3 OS=Homo sapiens OX=9606 GN=PLSCR3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	286-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|Q14444|CAPR1_HUMAN	Caprin-1 OS=Homo sapiens OX=9606 GN=CAPRIN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	699-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|Q9UK45|LSM7_HUMAN	U6 snRNA-associated Sm-like protein LSm7 OS=Homo sapiens OX=9606 GN=LSM7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	78-UNIMOD:214,85-UNIMOD:4	0.26	14.0	1	1	1
PRT	sp|Q6UWU4-3|CF089_HUMAN	Isoform 3 of Bombesin receptor-activated protein C6orf89 OS=Homo sapiens OX=9606 GN=C6orf89	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	226-UNIMOD:214,233-UNIMOD:4	0.07	14.0	1	1	1
PRT	sp|P35241-4|RADI_HUMAN	Isoform 4 of Radixin OS=Homo sapiens OX=9606 GN=RDX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	441-UNIMOD:214,447-UNIMOD:35	0.02	14.0	2	1	0
PRT	sp|Q8NC54|KCT2_HUMAN	Keratinocyte-associated transmembrane protein 2 OS=Homo sapiens OX=9606 GN=KCT2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	259-UNIMOD:214	0.03	14.0	1	1	1
PRT	sp|Q86WA6-2|BPHL_HUMAN	Isoform 2 of Valacyclovir hydrolase OS=Homo sapiens OX=9606 GN=BPHL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	268-UNIMOD:214	0.03	14.0	1	1	1
PRT	sp|P41440-2|S19A1_HUMAN	Isoform 2 of Folate transporter 1 OS=Homo sapiens OX=9606 GN=SLC19A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	536-UNIMOD:214,540-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|O14579-3|COPE_HUMAN	Isoform 3 of Coatomer subunit epsilon OS=Homo sapiens OX=9606 GN=COPE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	248-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|Q96DI7|SNR40_HUMAN	U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP40 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	351-UNIMOD:214,353-UNIMOD:35	0.02	14.0	2	1	0
PRT	sp|Q9UBB6-2|NCDN_HUMAN	Isoform 2 of Neurochondrin OS=Homo sapiens OX=9606 GN=NCDN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	702-UNIMOD:214,702-UNIMOD:35,708-UNIMOD:4	0.02	14.0	2	1	0
PRT	sp|Q7L2H7-2|EIF3M_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	234-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|Q5JPI3-2|CC038_HUMAN	Isoform 2 of Uncharacterized protein C3orf38 OS=Homo sapiens OX=9606 GN=C3orf38	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	317-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|P53680-2|AP2S1_HUMAN	Isoform 2 of AP-2 complex subunit sigma OS=Homo sapiens OX=9606 GN=AP2S1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	96-UNIMOD:214	0.10	14.0	1	1	1
PRT	sp|Q9Y624-2|JAM1_HUMAN	Isoform 2 of Junctional adhesion molecule A OS=Homo sapiens OX=9606 GN=F11R	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	244-UNIMOD:214	0.03	14.0	1	1	1
PRT	sp|P61221|ABCE1_HUMAN	ATP-binding cassette sub-family E member 1 OS=Homo sapiens OX=9606 GN=ABCE1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	591-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|Q8NHZ8|CDC26_HUMAN	Anaphase-promoting complex subunit CDC26 OS=Homo sapiens OX=9606 GN=CDC26 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	77-UNIMOD:214	0.12	14.0	1	1	1
PRT	sp|P61966|AP1S1_HUMAN	AP-1 complex subunit sigma-1A OS=Homo sapiens OX=9606 GN=AP1S1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	150-UNIMOD:214	0.06	14.0	1	1	1
PRT	sp|Q7Z6J6-2|FRMD5_HUMAN	Isoform 2 of FERM domain-containing protein 5 OS=Homo sapiens OX=9606 GN=FRMD5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	547-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|Q9Y608-3|LRRF2_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 2 OS=Homo sapiens OX=9606 GN=LRRFIP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	94-UNIMOD:214	0.08	14.0	1	1	1
PRT	sp|Q8WV60-2|PTCD2_HUMAN	Isoform 2 of Pentatricopeptide repeat-containing protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	205-UNIMOD:214	0.06	14.0	1	1	1
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	921-UNIMOD:214	0.01	14.0	2	1	0
PRT	sp|Q14114-3|LRP8_HUMAN	Isoform 3 of Low-density lipoprotein receptor-related protein 8 OS=Homo sapiens OX=9606 GN=LRP8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	894-UNIMOD:214	0.01	14.0	1	1	1
PRT	sp|P53611|PGTB2_HUMAN	Geranylgeranyl transferase type-2 subunit beta OS=Homo sapiens OX=9606 GN=RABGGTB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	323-UNIMOD:214	0.03	14.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	577-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	798-UNIMOD:214,803-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	14.0	null	696-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|Q9NQ92|COPRS_HUMAN	Coordinator of PRMT5 and differentiation stimulator OS=Homo sapiens OX=9606 GN=COPRS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	172-UNIMOD:214	0.08	14.0	1	1	1
PRT	sp|P06737|PYGL_HUMAN	Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	14.0	null	623-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|P26599|PTBP1_HUMAN	Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	14.0	null	219-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|Q9Y4Y9|LSM5_HUMAN	U6 snRNA-associated Sm-like protein LSm5 OS=Homo sapiens OX=9606 GN=LSM5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	69-UNIMOD:214	0.26	14.0	1	1	1
PRT	sp|Q15904|VAS1_HUMAN	V-type proton ATPase subunit S1 OS=Homo sapiens OX=9606 GN=ATP6AP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	461-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|P26038|MOES_HUMAN	Moesin OS=Homo sapiens OX=9606 GN=MSN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	571-UNIMOD:214,577-UNIMOD:35	0.01	14.0	1	1	1
PRT	sp|P62899|RL31_HUMAN	60S ribosomal protein L31 OS=Homo sapiens OX=9606 GN=RPL31 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	116-UNIMOD:214	0.09	14.0	1	1	1
PRT	sp|P46199|IF2M_HUMAN	Translation initiation factor IF-2, mitochondrial OS=Homo sapiens OX=9606 GN=MTIF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	721-UNIMOD:214	0.01	14.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	97-UNIMOD:214	0.10	14.0	1	1	0
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	2789-UNIMOD:214,2804-UNIMOD:214	0.01	14.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	ALNVEPDGTGLTCSLAPNIISQL	1	sp|P30044-4|PRDX5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,13-UNIMOD:4	ms_run[2]:scan=25750	122.76	3	2526.3121	2526.3121	K	-	103	126
PSM	VEEPSGAVTTPAGVIAAAGPQGPGTGE	2	sp|P85037-2|FOXK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=17144	80.934	3	2563.2888	2563.2888	R	-	544	571
PSM	AAQQAASSSGQGQQAQTPTGF	3	sp|P48729-3|KC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=7800	41.303	3	2164.0267	2164.0267	K	-	305	326
PSM	LLAQDQGQGAPLLEPAP	4	sp|Q15102|PA1B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=18264	85.904	2	1861.0067	1861.0067	R	-	215	232
PSM	ADAEAVLAPPEPAQ	5	sp|Q8WZA9|IRGQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=12081	59.175	2	1521.7797	1521.7797	R	-	610	624
PSM	EMPQAPVLISCADQ	6	sp|Q8WY36-2|BBX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,11-UNIMOD:4	ms_run[2]:scan=16113	76.723	2	1701.8188	1701.8188	K	-	898	912
PSM	NNSNDIVNAIMELTM	7	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,15-UNIMOD:35	ms_run[2]:scan=28053	137.14	2	1837.8672	1837.8672	K	-	2064	2079
PSM	SGMTTGSTLPVEGGFWAC	8	sp|Q7Z4W1|DCXR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214,18-UNIMOD:4	ms_run[1]:scan=21371	99.63933666666667	2	2001.914228	2000.909384	R	-	227	245
PSM	AAALAAAVAQDPAASGAPSS	9	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=13887	67.13	3	1839.9448	1839.9448	R	-	203	223
PSM	DGVLVDEFGLPQIPAS	10	sp|Q9NZZ3|CHMP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=24349	114.74	2	1799.9427	1799.9427	K	-	204	220
PSM	ALTSETNGTDSNGSNSSNIQ	11	sp|Q08209-4|PP2BA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:214	ms_run[2]:scan=5370	30.423	3	2139.9638	2139.9638	K	-	270	290
PSM	ELIEIISGAAALD	12	sp|P36542|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:214	ms_run[2]:scan=26459	127.11	3	1457.8099	1457.8099	K	-	286	299
PSM	GFDPTASPFCQ	13	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:214,10-UNIMOD:4	ms_run[2]:scan=15582	74.466	2	1369.6094	1369.6094	K	-	1293	1304
PSM	IEIEAVAIQGPLTTASL	14	sp|P52758|RIDA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:214	ms_run[2]:scan=24973	118.18	3	1869.0581	1869.0581	R	-	121	138
PSM	ISQTAPEWTAQAMEAQMAQ	15	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:214	ms_run[2]:scan=20227	94.526	3	2235.0422	2235.0422	K	-	388	407
PSM	NNSNDIVNAIMELTM	16	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:214,11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=25562	121.62	2	1853.8621	1853.8621	K	-	2064	2079
PSM	AGEAPTENPAPPTQQSSAE	17	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214	ms_run[2]:scan=4973	28.745	2	2024.9409	2024.9409	K	-	285	304
PSM	AGGANYDAQTE	18	sp|Q14019|COTL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214	ms_run[2]:scan=1761	13.01	2	1239.5489	1239.5489	K	-	132	143
PSM	AGGANYDAQTE	19	sp|Q14019|COTL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214	ms_run[2]:scan=1992	14.408	2	1239.5489	1239.5489	K	-	132	143
PSM	FAEPIGGFQCVFPGC	20	sp|Q9Y570-2|PPME1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=23314	109.24	2	1828.8398	1828.8398	R	-	185	200
PSM	FMEDGLEGMMF	21	sp|P40938|RFC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214	ms_run[2]:scan=26084	124.8	2	1449.61	1449.6100	K	-	346	357
PSM	IDFDSVSSIMASSQ	22	sp|Q9UBQ5|EIF3K_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214	ms_run[2]:scan=22244	103.7	3	1629.7678	1629.7678	K	-	205	219
PSM	MVQQLQEDVDMEDAP	23	sp|Q9UHA3|RLP24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214	ms_run[2]:scan=19449	91.049	3	1890.8461	1890.8461	K	-	149	164
PSM	NNSNDIVNAIMELTM	24	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214,11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=25356	120.42	3	1853.8621	1853.8621	K	-	2064	2079
PSM	SWDVETATELLLSN	25	sp|P61086-2|UBE2K_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214	ms_run[2]:scan=26353	126.46	2	1720.8641	1720.8641	K	-	136	150
PSM	AQALVQYLEEPLTQVAAS	26	sp|Q9Y2Q5|LTOR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:214	ms_run[1]:scan=26625	128.12576	3	2074.106637	2074.106821	K	-	108	126
PSM	IDFDSVSSIMASSQ	27	sp|Q9UBQ5|EIF3K_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:214	ms_run[1]:scan=22222	103.59002166666667	2	1629.768049	1629.767788	K	-	205	219
PSM	GVEAGPDLLQ	28	sp|O60506-5|HNRPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214	ms_run[2]:scan=12947	62.698	2	1141.6101	1141.6101	K	-	401	411
PSM	ISQTAPEWTAQAMEAQMAQ	29	sp|Q9BT78|CSN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214	ms_run[2]:scan=20254	94.643	2	2235.0422	2235.0422	K	-	388	407
PSM	IVSAQSLAEDDVE	30	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214	ms_run[2]:scan=14288	68.921	3	1518.7535	1518.7535	R	-	133	146
PSM	LTTASALGYQ	31	sp|Q96F45-3|ZN503_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214	ms_run[2]:scan=12118	59.328	2	1167.6257	1167.6257	R	-	274	284
PSM	MVQQLQEDVDMEDAP	32	sp|Q9UHA3|RLP24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214,1-UNIMOD:35	ms_run[2]:scan=15084	72.332	3	1906.841	1906.8410	K	-	149	164
PSM	NITYLPAGQSVLLQLPQ	33	sp|P35232|PHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214	ms_run[2]:scan=23930	112.48	2	1998.1272	1998.1272	R	-	256	273
PSM	TIAPLVASGAVQLI	34	sp|Q9BRT9|SLD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214	ms_run[2]:scan=24238	114.11	2	1495.9096	1495.9096	K	-	210	224
PSM	TLSEVEESISTLISQPN	35	sp|Q8N668|COMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214	ms_run[2]:scan=27026	130.65	2	1990.0228	1990.0228	K	-	174	191
PSM	IDFDSVSSIMASSQ	36	sp|Q9UBQ5|EIF3K_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:214	ms_run[1]:scan=22459	104.85364	2	1629.768049	1629.767788	K	-	205	219
PSM	AAAGACTPPCT	37	sp|Q96P11-2|NSUN5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=2967	19.478	2	1219.5447	1219.5447	R	-	456	467
PSM	AASSAAQGAFQGN	38	sp|O15127|SCAM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=4833	28.134	2	1322.6337	1322.6337	R	-	317	330
PSM	EQSEVGSMGALLF	39	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,8-UNIMOD:35	ms_run[2]:scan=18069	84.985	2	1526.7408	1526.7408	K	-	344	357
PSM	EQSEVGSMGALLF	40	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=23399	109.7	2	1510.7459	1510.7459	K	-	344	357
PSM	ILDTADENGLLSLPN	41	sp|Q96DZ1-3|ERLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=22167	103.33	2	1727.9063	1727.9063	K	-	443	458
PSM	ISAEGSGLSF	42	sp|Q8WV07|LTO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=15755	75.235	2	1110.5679	1110.5679	K	-	128	138
PSM	ITIADCGQLE	43	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=14159	68.349	2	1262.6298	1262.6298	K	-	96	106
PSM	LACGVIGIAQ	44	sp|P00441|SODC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=15351	73.47	2	1144.6396	1144.6396	R	-	145	155
PSM	LDNGQVGLYPANYVEAIQ	45	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=21685	101.04	2	2107.0708	2107.0708	R	-	428	446
PSM	NAQPLLLVGPEGAEA	46	sp|Q6ZMU5|TRI72_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=18201	85.591	3	1621.8797	1621.8797	K	-	463	478
PSM	NENLAANFLLQQNFDED	47	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=23232	108.83	3	2138.0038	2138.0038	K	-	321	338
PSM	NNSNDIVNAIMELTM	48	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,11-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=25373	120.51	2	1853.8621	1853.8621	K	-	2064	2079
PSM	NNSNDIVNAIMELTM	49	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,11-UNIMOD:35	ms_run[2]:scan=26729	128.78	2	1837.8672	1837.8672	K	-	2064	2079
PSM	NNSNDIVNAIMELTM	50	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,11-UNIMOD:35	ms_run[2]:scan=26942	130.13	3	1837.8672	1837.8672	K	-	2064	2079
PSM	NNSNDIVNAIMELTM	51	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,15-UNIMOD:35	ms_run[2]:scan=28057	137.17	3	1837.8672	1837.8672	K	-	2064	2079
PSM	NSPATLFEVPDTW	52	sp|O95453-4|PARN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=25015	118.41	2	1619.7953	1619.7953	K	-	452	465
PSM	QGGAPDAGQE	53	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=761	7.1169	2	1072.4907	1072.4907	R	-	498	508
PSM	QIDQQNCTC	54	sp|Q14145|KEAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,7-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=1349	10.658	2	1309.5513	1309.5513	K	-	616	625
PSM	QNDVFGEAEQ	55	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=8294	43.352	2	1279.5802	1279.5802	K	-	438	448
PSM	VSSGSCFALE	56	sp|Q9NZJ7-3|MTCH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=12179	59.573	2	1199.5614	1199.5614	R	-	162	172
PSM	LTDYVAFLEN	57	sp|Q99627|CSN8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:214	ms_run[1]:scan=23902	112.33468333333333	2	1327.678987	1327.678168	R	-	200	210
PSM	AAALAAAVAQDPAASGAPSS	58	sp|Q8TAE8|G45IP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=13889	67.139	2	1839.9448	1839.9448	R	-	203	223
PSM	DNLTLWTSDTQGDEAEAGEGGEN	59	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=16573	78.597	3	2552.0908	2552.0908	R	-	223	246
PSM	FPSGNQGGAGPSQGSGGGTGGSVYTEDNDDDLYG	60	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=14220	68.621	3	3363.4158	3363.4158	R	-	773	807
PSM	GAAPESSLITFEAAPPTL	61	sp|Q12893|TM115_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=22735	106.26	2	1915.006	1915.0060	K	-	334	352
PSM	GNLVDLITL	62	sp|Q9UL63-2|MKLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=25120	119.02	2	1100.6563	1100.6563	K	-	520	529
PSM	IEIEAVAIQGPLTTASL	63	sp|P52758|RIDA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=24956	118.08	2	1869.0581	1869.0581	R	-	121	138
PSM	IITYNEAMDSPDQ	64	sp|Q7Z417|NUFP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214,8-UNIMOD:35	ms_run[2]:scan=10637	53.099	2	1655.7471	1655.7471	R	-	683	696
PSM	LDNGQVGLYPANYVEAIQ	65	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=21681	101.02	3	2107.0708	2107.0708	R	-	428	446
PSM	LELTTYLFGQDP	66	sp|Q99720-5|SGMR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=25439	120.88	3	1539.7943	1539.7943	R	-	176	188
PSM	LNMGEIETLDDY	67	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=21658	100.91	2	1555.7198	1555.7198	R	-	1275	1287
PSM	NAQPLLLVGPEGAEA	68	sp|Q6ZMU5|TRI72_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=18401	86.533	2	1621.8797	1621.8797	K	-	463	478
PSM	NLSDIDLMAPQPGV	69	sp|Q96B49|TOM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=20037	93.697	2	1612.8252	1612.8252	R	-	61	75
PSM	SAYNSYSWGAN	70	sp|Q14157|UBP2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=11052	54.844	2	1362.5962	1362.5962	K	-	1077	1088
PSM	SEAPNWATQDSGFY	71	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=16842	79.689	2	1715.7549	1715.7549	R	-	432	446
PSM	SFSTALYGESDL	72	sp|O43707-3|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=18318	86.124	2	1432.6844	1432.6844	K	-	510	522
PSM	SGSPTVPIN	73	sp|Q13557-12|KCC2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=5820	32.45	2	1014.5468	1014.5468	R	-	470	479
PSM	SLEELPVDIILASVG	74	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=30300	151.89	2	1697.9573	1697.9573	R	-	860	875
PSM	TLSEVEESISTLISQPN	75	sp|Q8N668|COMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=27044	130.76	3	1990.0228	1990.0228	K	-	174	191
PSM	VGLDPSQLPVGENGIV	76	sp|Q96GX9-3|MTNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=20495	95.758	2	1736.943	1736.9430	K	-	189	205
PSM	VQAELSQPLTAGGAISELL	77	sp|Q15291|RBBP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=25920	123.8	2	2040.1225	2040.1225	K	-	520	539
PSM	VVYTSLQWASLQ	78	sp|Q9BSV6|SEN34_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=21704	101.13	2	1537.8262	1537.8262	K	-	299	311
PSM	VYLGASTPDLQ	79	sp|Q9BYN0|SRXN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=14389	69.335	2	1306.6891	1306.6891	R	-	127	138
PSM	LNMGEIETLDDY	80	sp|Q6Y7W6|GGYF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:214,3-UNIMOD:35	ms_run[1]:scan=17229	81.321395	2	1571.716284	1571.714690	R	-	1288	1300
PSM	AVNSATGVPTV	81	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:214	ms_run[1]:scan=9629	48.89768333333333	2	1158.638521	1158.636638	K	-	626	637
PSM	VTQQVNPIFSEAC	82	sp|Q9P2T1|GMPR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:214,13-UNIMOD:4	ms_run[1]:scan=15163	72.65755	2	1635.805619	1635.804842	R	-	336	349
PSM	AAAFSPADQDDFVI	83	sp|Q9P0V3-2|SH3B4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=20926	97.673	2	1609.7746	1609.7746	R	-	539	553
PSM	AGGEESQFEMDI	84	sp|Q13541|4EBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=16576	78.61	2	1455.631	1455.6310	R	-	107	119
PSM	ALLYLCGGDD	85	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=17053	80.531	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	86	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=17289	81.591	2	1239.5927	1239.5927	K	-	330	340
PSM	CGVPMTLCSPSS	87	sp|Q9C035|TRIM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,1-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=11870	58.298	2	1438.6376	1438.6376	K	-	482	494
PSM	EGMGQLVAANDG	88	sp|Q9BRQ0|PYGO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=10117	50.889	2	1304.6152	1304.6153	R	-	395	407
PSM	EMPQAPVLISCADQ	89	sp|Q8WY36-2|BBX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,11-UNIMOD:4	ms_run[2]:scan=16137	76.827	3	1701.8188	1701.8188	K	-	898	912
PSM	FMYLEGNADSAMS	90	sp|O14763-2|TR10B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=18137	85.293	2	1578.6816	1578.6816	K	-	399	412
PSM	GSPAAPGQEDGA	91	sp|P30530-2|UFO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=1785	13.138	2	1199.554	1199.5540	R	-	874	886
PSM	ILLDIDNDTESTAL	92	sp|Q68EM7-7|RHG17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=22225	103.6	2	1675.8638	1675.8638	R	-	401	415
PSM	ISCVTQSTDAAV	93	sp|Q96FZ5-2|CKLF7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=10057	50.648	2	1394.6833	1394.6833	K	-	131	143
PSM	IVSAQSLAEDDVE	94	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=14267	68.832	2	1518.7535	1518.7535	R	-	133	146
PSM	LEFQQQLGEAPSDASP	95	sp|Q9BUW7|CI016_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=15797	75.409	2	1859.9023	1859.9023	R	-	68	84
PSM	MVQQLQEDVDMEDAP	96	sp|Q9UHA3|RLP24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,11-UNIMOD:35	ms_run[2]:scan=17508	82.587	2	1906.841	1906.8410	K	-	149	164
PSM	NENLAANFLLSQNFDDE	97	sp|P54725-2|RD23A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=23868	112.17	2	2096.9773	2096.9773	K	-	292	309
PSM	NNSNDIVNAIMELTM	98	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,11-UNIMOD:35	ms_run[2]:scan=26734	128.83	3	1837.8672	1837.8672	K	-	2064	2079
PSM	QGSSPPPPQSSQE	99	sp|O60337-6|MARH6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=863	7.7479	2	1468.6916	1468.6916	K	-	793	806
PSM	SSASAPDVDDPEAFPALA	100	sp|Q8NC51-4|PAIRB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=18158	85.38	2	1902.8969	1902.8969	K	-	370	388
PSM	TGMLPANYIEFVN	101	sp|O76041-2|NEBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=22519	105.15	2	1611.8089	1611.8089	R	-	258	271
PSM	NSPATLFEVPDTW	102	sp|O95453|PARN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:214	ms_run[1]:scan=24953	118.055245	2	1619.799016	1619.795323	K	-	627	640
PSM	NGVDLGPICGPPNGII	103	sp|Q14671|PUM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:214,9-UNIMOD:4	ms_run[1]:scan=21600	100.65265833333333	2	1736.888840	1735.904891	K	-	1171	1187
PSM	ILDTADENGLLSLPN	104	sp|Q96DZ1|ERLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:214	ms_run[1]:scan=22270	103.84321333333332	2	1728.891754	1727.906330	K	-	469	484
PSM	VGLDPSQLPVGENGIV	105	sp|Q96GX9|MTNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:214	ms_run[1]:scan=20688	96.66185333333333	2	1737.927711	1736.943050	K	-	227	243
PSM	GNLQLLQNCLAVLNGDT	106	sp|Q9UNH7|SNX6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:214,9-UNIMOD:4	ms_run[1]:scan=23401	109.71301166666667	2	1987.016483	1986.032611	K	-	390	407
PSM	AGMATESPSDSPEDGPGLSPLL	107	sp|O75648-4|MTU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=19767	92.448	3	2271.0698	2271.0698	R	-	246	268
PSM	AGMATESPSDSPEDGPGLSPLL	108	sp|O75648-4|MTU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=19790	92.555	2	2271.0698	2271.0698	R	-	246	268
PSM	AITNNQYEIV	109	sp|O43657|TSN6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=13033	63.037	2	1307.6843	1307.6843	R	-	236	246
PSM	AIVDLTGL	110	sp|Q12933-4|TRAF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=20514	95.854	2	944.56643	944.5664	K	-	469	477
PSM	ALEAELNDLM	111	sp|Q9Y5B0|CTDP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=22878	106.98	2	1261.6346	1261.6346	K	-	952	962
PSM	ALNVEPDGTGLTCSLAPNIISQL	112	sp|P30044-4|PRDX5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,13-UNIMOD:4	ms_run[2]:scan=25758	122.82	2	2526.3121	2526.3121	K	-	103	126
PSM	ASAETVDPASLWEY	113	sp|Q16658|FSCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=21742	101.31	2	1681.7957	1681.7957	K	-	480	494
PSM	AVEDMLETLQITQS	114	sp|Q15006|EMC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=24807	117.23	2	1720.8675	1720.8675	K	-	284	298
PSM	CLNVDWIP	115	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,1-UNIMOD:4	ms_run[2]:scan=21889	102	2	1159.5818	1159.5818	R	-	703	711
PSM	CPAITQNNFLT	116	sp|O14524-2|NEMP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,1-UNIMOD:4	ms_run[2]:scan=15080	72.307	2	1421.7095	1421.7095	R	-	361	372
PSM	EIVTNFLAGFEA	117	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=26293	126.1	2	1453.7575	1453.7575	K	-	492	504
PSM	ESAFEFLSSA	118	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=21595	100.63	2	1230.589	1230.5890	K	-	236	246
PSM	FGEALGSL	119	sp|Q9UG56-2|PISD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=17943	84.475	2	936.50383	936.5038	R	-	368	376
PSM	FLAEDALNTV	120	sp|Q08345-2|DDR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=20016	93.595	2	1235.652	1235.6520	R	-	867	877
PSM	GGSGGFGDEC	121	sp|P50895|BCAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,10-UNIMOD:4	ms_run[2]:scan=2956	19.427	2	1085.4206	1085.4206	R	-	619	629
PSM	GIPGLDVEDDEEGGGGAP	122	sp|Q9ULX6-2|AKP8L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=16153	76.888	2	1826.8292	1826.8292	R	-	568	586
PSM	GLFVQALPSS	123	sp|P22670|RFX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=17711	83.475	2	1161.6516	1161.6516	R	-	970	980
PSM	IIEVAPQVATQNVNPTPGATS	124	sp|P49903-2|SPS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=15566	74.401	2	2250.1978	2250.1978	R	-	301	322
PSM	ITIADCGQLE	125	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=13695	66.214	2	1262.6298	1262.6298	K	-	96	106
PSM	ITIADCGQLE	126	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=13915	67.256	2	1262.6298	1262.6298	K	-	96	106
PSM	ITIADCGQLE	127	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=30733	154.68	2	1262.6298	1262.6298	K	-	96	106
PSM	ITIADCGQLE	128	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=30875	155.68	2	1262.6298	1262.6298	K	-	96	106
PSM	ITIADCGQLE	129	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=31021	156.69	2	1262.6298	1262.6298	K	-	96	106
PSM	ITIADCGQLE	130	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=31300	158.73	2	1262.6298	1262.6298	K	-	96	106
PSM	IVITDCGQLS	131	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=13241	63.84	2	1248.6506	1248.6506	K	-	198	208
PSM	LGGGTTVTSS	132	sp|P36956|SRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=4106	24.816	2	1022.5366	1022.5366	R	-	1138	1148
PSM	LVTTVTEIAG	133	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=16759	79.344	2	1146.6618	1146.6618	K	-	465	475
PSM	MVQQLQEDVDMEDAP	134	sp|Q9UHA3|RLP24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=19430	90.966	2	1890.8461	1890.8461	K	-	149	164
PSM	NENLAANFLLQQNFDED	135	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=23252	108.94	2	2138.0038	2138.0038	K	-	321	338
PSM	NNSNDIVNAIMELTM	136	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,11-UNIMOD:35	ms_run[2]:scan=26904	129.9	2	1837.8672	1837.8672	K	-	2064	2079
PSM	NNSNDIVNAIMELTM	137	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=29701	147.86	2	1821.8723	1821.8723	K	-	2064	2079
PSM	NNSNDIVNAIMELTM	138	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=29770	148.31	3	1821.8723	1821.8723	K	-	2064	2079
PSM	QNPSGFGTQA	139	sp|Q14376-2|GALE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=4872	28.292	2	1149.5536	1149.5536	K	-	265	275
PSM	QQGAGDAEEEEEE	140	sp|O14545|TRAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=1475	11.399	2	1563.6294	1563.6294	K	-	570	583
PSM	QQQSQTAY	141	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=1259	10.139	2	1096.5271	1096.5271	R	-	896	904
PSM	SEDALFAL	142	sp|Q6ZVM7-4|TM1L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=20560	96.057	2	1008.525	1008.5250	R	-	233	241
PSM	SFSTALYGESDL	143	sp|O43707-3|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=18325	86.164	3	1432.6844	1432.6844	K	-	510	522
PSM	SVGGACVLVA	144	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=11388	56.187	2	1075.5818	1075.5818	K	-	139	149
PSM	TIQQLETVLGEPLQSYF	145	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=28826	142.11	3	2109.1116	2109.1116	K	-	2128	2145
PSM	TVLEQVLPI	146	sp|P25685-2|DNJB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=23614	110.87	2	1154.7033	1154.7033	R	-	232	241
PSM	VPVTYLELLS	147	sp|Q9NR46|SHLB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=25058	118.66	2	1276.74	1276.7400	K	-	386	396
PSM	VTNSSVWVEP	148	sp|Q9UK22|FBX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=14303	68.978	2	1260.6472	1260.6472	R	-	287	297
PSM	YGIFQYDGPL	149	sp|Q9H993|ARMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=23398	109.7	2	1315.657	1315.6570	K	-	432	442
PSM	NNSNDIVNAIMELTM	150	sp|E9PAV3|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214,11-UNIMOD:35,15-UNIMOD:35	ms_run[1]:scan=25561	121.61151666666667	3	1853.860621	1853.862100	K	-	2064	2079
PSM	LELTTYLFGQDP	151	sp|Q99720|SGMR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=25397	120.630555	2	1539.794317	1539.794261	R	-	212	224
PSM	TAENATSGETLEENEAGD	152	sp|Q9UQ80|PA2G4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=6500	35.53668833333334	2	1980.853636	1980.851788	K	-	377	395
PSM	MLDQTLLDLNEM	153	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=23965	112.64001666666667	2	1578.774434	1578.775516	R	-	237	249
PSM	EGMIPLEVWT	154	sp|O14939|PLD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=24154	113.65585	2	1317.678321	1317.676060	K	-	924	934
PSM	LMEALEPPLEEQQI	155	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=22793	106.56558500000001	2	1782.919513	1782.919538	K	-	799	813
PSM	VGLDPSQLPVGENGIV	156	sp|Q96GX9|MTNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=21071	98.272275	2	1737.927328	1736.943050	K	-	227	243
PSM	GGSGSGPTIEEVD	157	sp|P0DMV8|HS71A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=7221	38.75168333333333	2	1347.629722	1347.627589	K	-	629	642
PSM	LTNLSSNSDV	158	sp|Q13641|TPBG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=10075	50.71693	2	1192.607094	1192.605731	R	-	411	421
PSM	FMEDGLEGMMF	159	sp|P40938|RFC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214,10-UNIMOD:35	ms_run[1]:scan=23720	111.40246	2	1465.604216	1465.604945	K	-	346	357
PSM	ALNSILED	160	sp|Q86U38|NOP9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=15058	72.194	2	1017.5464	1017.5464	R	-	629	637
PSM	ANSTSDEL	161	sp|Q9UNW1-4|MINP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=3213	20.648	2	979.458	979.4580	R	-	279	287
PSM	AQELQAVLGLS	162	sp|Q8TEX9|IPO4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=21176	98.767	2	1271.7207	1271.7207	K	-	1071	1082
PSM	ASSAGVLVS	163	sp|Q9UHV9|PFD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=6593	35.942	2	933.5253	933.5253	K	-	146	155
PSM	ATQASQEY	164	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=2052	14.713	2	1040.4896	1040.4896	K	-	136	144
PSM	ATQASQEY	165	sp|P16104|H2AX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=2331	16.247	2	1040.4896	1040.4896	K	-	136	144
PSM	DLWEYIED	166	sp|Q9Y4X5|ARI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=22939	107.26	2	1225.5625	1225.5625	K	-	550	558
PSM	EALQDVEDENQ	167	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=7972	42.016	2	1432.644	1432.6440	K	-	223	234
PSM	EASILLGD	168	sp|Q9NPD3|EXOS4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=13329	64.216	2	960.52496	960.5250	R	-	238	246
PSM	ELIEIISGAAALD	169	sp|P36542|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=26456	127.1	2	1457.8099	1457.8099	K	-	286	299
PSM	FAVATLPPA	170	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=15439	73.831	2	1029.5981	1029.5981	K	-	231	240
PSM	FLDELDAVQMD	171	sp|O15160|RPAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=22538	105.25	2	1438.6772	1438.6772	R	-	336	347
PSM	GIIGYDV	172	sp|O75964|ATP5L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=14622	70.34	2	879.48237	879.4824	R	-	97	104
PSM	GLESATSL	173	sp|O75792|RNH2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=10363	51.942	2	920.49366	920.4937	R	-	292	300
PSM	GMSPAVL	174	sp|Q0PNE2|ELP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=11248	55.648	2	817.44896	817.4490	K	-	260	267
PSM	GTCGCGESFNI	175	sp|Q9BUE6|ISCA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,3-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=11825	58.104	2	1344.556	1344.5560	K	-	119	130
PSM	GTVQQADE	176	sp|P32969|RL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=803	7.3765	2	990.47399	990.4740	K	-	185	193
PSM	IASNAGSIA	177	sp|P62829|RL23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=6628	36.108	2	946.52054	946.5205	R	-	132	141
PSM	IDEFEAL	178	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=17983	84.638	2	979.49841	979.4984	R	-	580	587
PSM	ILDQMPATPSSPMYVD	179	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,13-UNIMOD:35	ms_run[2]:scan=17297	81.64	2	1923.908	1923.9080	K	-	384	400
PSM	LADMYGGGEDD	180	sp|P12830-2|CADH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=10786	53.717	2	1285.5254	1285.5254	K	-	811	822
PSM	LAGGQVE	181	sp|O43768-5|ENSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=3790	23.282	2	816.44632	816.4463	K	-	111	118
PSM	LEATINELV	182	sp|P10599-2|THIO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=21217	98.936	2	1144.6461	1144.6461	K	-	77	86
PSM	LEATINELV	183	sp|P10599-2|THIO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=21448	99.968	2	1144.6461	1144.6461	K	-	77	86
PSM	LLTGQEQPVYL	184	sp|O96018|APBA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=19218	90.038	2	1403.7782	1403.7782	R	-	565	576
PSM	LQLQEDDDDPLIG	185	sp|Q9Y6X5|ENPP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=18279	85.963	2	1613.7906	1613.7906	R	-	441	454
PSM	LQNMEVTDA	186	sp|P49591|SYSC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=10443	52.259	2	1163.5614	1163.5614	R	-	506	515
PSM	LSSETGGMGSS	187	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,8-UNIMOD:35	ms_run[2]:scan=1639	12.332	2	1171.5149	1171.5149	R	-	308	319
PSM	LSSETGGMGSS	188	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=4970	28.734	2	1155.52	1155.5200	R	-	308	319
PSM	LSSETGGMGSS	189	sp|Q15366-7|PCBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=5218	29.81	2	1155.52	1155.5200	R	-	308	319
PSM	MLDQTLLDLNEM	190	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,12-UNIMOD:35	ms_run[2]:scan=21933	102.19	2	1594.7704	1594.7704	R	-	237	249
PSM	MQQEDQEGPPT	191	sp|Q9NVM6|DJC17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,1-UNIMOD:35	ms_run[2]:scan=1701	12.678	2	1418.6106	1418.6106	R	-	294	305
PSM	MQQEDQEGPPT	192	sp|Q9NVM6|DJC17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=3957	24.092	2	1402.6156	1402.6156	R	-	294	305
PSM	NAAVFSSVLAL	193	sp|Q504Q3-2|PAN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=24158	113.68	2	1234.7043	1234.7043	K	-	1188	1199
PSM	NLAPLNVIL	194	sp|O94763-4|RMP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=23508	110.31	2	1109.693	1109.6930	R	-	467	476
PSM	NMCGLAACASYPIPLV	195	sp|P09668|CATH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=23528	110.42	2	1879.9116	1879.9116	K	-	320	336
PSM	QYADVEGF	196	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=12886	62.456	2	1071.4995	1071.4995	K	-	433	441
PSM	SNTAGSQSQVETEA	197	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=2375	16.486	2	1551.7134	1551.7134	K	-	446	460
PSM	SSPAGNSPAPL	198	sp|Q86TG7-2|PEG10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=6534	35.682	2	1140.5897	1140.5897	K	-	315	326
PSM	TLYGFGG	199	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=30670	154.27	2	857.4405	857.4405	R	-	97	104
PSM	TNTFLEAP	200	sp|Q9GZU8|PIP30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=13115	63.352	2	1035.5359	1035.5359	R	-	247	255
PSM	VCDACFNDLQG	201	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=12402	60.461	2	1441.6088	1441.6088	R	-	1401	1412
PSM	VGAVAAATS	202	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=4496	26.551	2	889.49908	889.4991	K	-	623	632
PSM	VYNGLQGY	203	sp|Q9UBS4|DJB11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=11555	56.926	2	1056.5362	1056.5362	K	-	351	359
PSM	YFAQEAISVLALA	204	sp|P30154-5|2AAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=28485	139.91	2	1538.8466	1538.8466	K	-	462	475
PSM	NNSNDIVNAIMELTV	205	sp|Q9H009|NACA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=26357	126.49380166666666	2	1789.867264	1789.900199	K	-	201	216
PSM	NLSDIDLMAPQPGV	206	sp|Q96B49|TOM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214,8-UNIMOD:35	ms_run[1]:scan=17333	81.80641833333334	2	1628.825583	1628.820158	R	-	61	75
PSM	AVNSATGVPTV	207	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=9883	49.93192166666667	2	1158.638521	1158.636638	K	-	626	637
PSM	AVNSATGVPTV	208	sp|P11940|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=9376	47.80112833333333	2	1158.638521	1158.636638	K	-	626	637
PSM	NIQQYNSFVSLSV	209	sp|P10644|KAP0_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=20792	97.08962	2	1641.849561	1641.848421	R	-	369	382
PSM	SGLSDLAESLTNDNETNS	210	sp|Q96FV9|THOC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=19036	89.26092166666666	2	2009.914553	2009.914723	K	-	640	658
PSM	MLDQTLLDLNEM	211	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214,1-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=19199	89.96317333333333	2	1610.766797	1610.765346	R	-	237	249
PSM	MLDQTLLDLNEM	212	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=25421	120.786855	2	1578.774551	1578.775516	R	-	237	249
PSM	TVLEQVLPI	213	sp|P25685|DNJB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=23839	112.01318333333333	2	1154.703492	1154.703261	R	-	332	341
PSM	IDEFEAM	214	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214,7-UNIMOD:35	ms_run[1]:scan=10050	50.61844	2	1013.450133	1013.449748	R	-	577	584
PSM	SLSGPGQ	215	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=1749	12.96547	1	788.418391	788.415017	K	-	172	179
PSM	SLASETN	216	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=1661	12.461026666666667	2	864.432423	864.431062	R	-	695	702
PSM	LSQSSIQQELCVS	217	sp|Q5T200|ZC3HD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214,11-UNIMOD:4	ms_run[1]:scan=15940	75.98666999999999	2	1620.813821	1621.810322	K	-	1656	1669
PSM	LDNVLLDTYQDASS	218	sp|Q9HD40|SPCS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=21054	98.20287833333333	2	1695.827330	1696.827746	K	-	488	502
PSM	AADPPAENSSAPEAEQGGAE	219	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=4169	25.083	2	2040.8994	2040.8994	K	-	305	325
PSM	AAVAASSSS	220	sp|P61927|RL37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=689	6.6666	2	893.45761	893.4576	R	-	89	98
PSM	ADYAYNGGQ	221	sp|A6NIH7|U119B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=3966	24.139	2	1101.4849	1101.4849	K	-	243	252
PSM	AEEAWAQMEE	222	sp|O00418|EF2K_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=13138	63.446	2	1336.5727	1336.5727	K	-	716	726
PSM	ATLTASPLGAS	223	sp|Q13111-3|CAF1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=10633	53.079	2	1131.6257	1131.6257	K	-	773	784
PSM	AVNSATGVPTV	224	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=6312	34.727	2	1158.6366	1158.6366	K	-	537	548
PSM	AVVQSPQVTEVL	225	sp|Q3KQU3-3|MA7D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=15989	76.201	2	1412.7997	1412.7997	K	-	366	378
PSM	AYLQDLVEGMDFQGPGES	226	sp|Q14653-3|IRF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=25710	122.52	3	2098.9639	2098.9639	K	-	137	155
PSM	EIQAEVQEK	227	sp|O60308|CE104_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,9-UNIMOD:214	ms_run[2]:scan=28167	137.87	2	1360.7442	1360.7442	K	E	711	720
PSM	EIVTNFLAGFEA	228	sp|P25705-2|ATPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=26317	126.26	3	1453.7575	1453.7575	K	-	492	504
PSM	EQSEVGSMGALLF	229	sp|P61619-3|S61A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=23446	109.97	3	1510.7459	1510.7459	K	-	344	357
PSM	ESMIQLF	230	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=22046	102.72	2	1010.5229	1010.5229	R	-	450	457
PSM	ESMIQLF	231	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=22267	103.82	2	1010.5229	1010.5229	R	-	450	457
PSM	ESMIQLF	232	sp|P30520|PURA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=22501	105.06	2	1010.5229	1010.5229	R	-	450	457
PSM	FAVATLPPA	233	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=15666	74.846	2	1029.5981	1029.5981	K	-	231	240
PSM	FAVATLPPA	234	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=15918	75.898	2	1029.5981	1029.5981	K	-	231	240
PSM	FAVATLPPA	235	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=16172	76.962	2	1029.5981	1029.5981	K	-	231	240
PSM	FAVATLPPA	236	sp|P28072|PSB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=16469	78.178	2	1029.5981	1029.5981	K	-	231	240
PSM	FDNSDLSA	237	sp|Q9UHX1-4|PUF60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=8631	44.752	2	1011.4631	1011.4631	R	-	492	500
PSM	FGSNINLEADES	238	sp|Q9NQP4|PFD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=13520	65.233	2	1438.6698	1438.6698	K	-	123	135
PSM	FGTFPGNYVAPV	239	sp|O60504-2|VINEX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=20085	93.91	2	1411.7258	1411.7258	K	-	318	330
PSM	FLDQFAE	240	sp|Q8WZ82|OVCA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=17668	83.272	2	1012.4987	1012.4987	K	-	221	228
PSM	GGAGPSAVTS	241	sp|Q9NRY6|PLS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=1469	11.348	2	946.48416	946.4842	R	-	286	296
PSM	GMPQMNTQQVN	242	sp|Q14444|CAPR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=7759	41.105	2	1390.6455	1390.6455	R	-	699	710
PSM	GTSVVLICPQDGMEAIPNPFIQQQDA	243	sp|Q9UK45|LSM7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,8-UNIMOD:4	ms_run[2]:scan=25716	122.57	3	2971.4541	2971.4541	R	-	78	104
PSM	GVQPLVICDGTAFSEL	244	sp|Q6UWU4-3|CF089_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,8-UNIMOD:4	ms_run[2]:scan=23632	110.97	2	1848.9413	1848.9413	R	-	226	242
PSM	IDEFEAL	245	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=18234	85.732	2	979.49841	979.4984	R	-	580	587
PSM	IDEFEAL	246	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=18715	87.866	2	979.49841	979.4984	R	-	580	587
PSM	IDEFEAL	247	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=18947	88.882	2	979.49841	979.4984	R	-	580	587
PSM	IDEFEAL	248	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=31404	159.49	2	979.49841	979.4984	R	-	580	587
PSM	IDEFEAM	249	sp|P35241-4|RADI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,7-UNIMOD:35	ms_run[2]:scan=10036	50.569	2	1013.4497	1013.4497	R	-	441	448
PSM	IDEFEAM	250	sp|P35241-4|RADI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=15564	74.392	2	997.45483	997.4548	R	-	441	448
PSM	ILDQMPATPSSPMYVD	251	sp|P45985|MP2K4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=19745	92.35	2	1907.9131	1907.9131	K	-	384	400
PSM	ITIADCGQLE	252	sp|P62937-2|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=13510	65.188	2	1262.6298	1262.6298	K	-	96	106
PSM	ITNDYIF	253	sp|Q8NC54|KCT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=18419	86.609	2	1028.53	1028.5300	K	-	259	266
PSM	IVSAQSLAEDDVE	254	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=14516	69.885	2	1518.7535	1518.7535	R	-	133	146
PSM	LAEDFLQ	255	sp|Q86WA6-2|BPHL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=17031	80.436	2	978.5144	978.5144	K	-	268	275
PSM	LGLQCLPSDGVQNVNQ	256	sp|P41440-2|S19A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,5-UNIMOD:4	ms_run[2]:scan=15612	74.627	2	1884.9485	1884.9485	K	-	536	552
PSM	LMEALEPPLEEQQI	257	sp|Q96JM3|CHAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=22941	107.27	3	1782.9195	1782.9195	K	-	799	813
PSM	LVLQYAPSA	258	sp|O14579-3|COPE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=15776	75.321	2	1104.6301	1104.6301	R	-	248	257
PSM	LYMGEIQ	259	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,3-UNIMOD:35	ms_run[2]:scan=9214	47.166	2	1012.5021	1012.5021	R	-	351	358
PSM	LYMGEIQ	260	sp|Q96DI7|SNR40_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=13932	67.321	2	996.5072	996.5072	R	-	351	358
PSM	MAALEQCLSEP	261	sp|Q9UBB6-2|NCDN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=11932	58.557	2	1407.6496	1407.6496	R	-	702	713
PSM	MAALEQCLSEP	262	sp|Q9UBB6-2|NCDN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,7-UNIMOD:4	ms_run[2]:scan=17107	80.773	2	1391.6547	1391.6547	R	-	702	713
PSM	NSLLSLSDT	263	sp|Q7L2H7-2|EIF3M_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=15162	72.654	2	1092.5785	1092.5785	K	-	234	243
PSM	QASDSGTGDQV	264	sp|Q5JPI3-2|CC038_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=1224	9.9573	2	1207.5439	1207.5439	K	-	317	328
PSM	QLLMLQSLE	265	sp|P53680-2|AP2S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=22353	104.27	2	1217.6811	1217.6811	K	-	96	105
PSM	QTSSFLV	266	sp|Q9Y624-2|JAM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=12904	62.529	2	924.50383	924.5038	K	-	244	251
PSM	SGNYFFLDD	267	sp|P61221|ABCE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=19721	92.241	2	1220.5472	1220.5472	K	-	591	600
PSM	SLASETN	268	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=1678	12.549	2	864.43106	864.4311	R	-	695	702
PSM	SLEELPVDIILASVG	269	sp|Q9Y678|COPG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=30319	152	3	1697.9573	1697.9573	R	-	860	875
PSM	SLSGPGQ	270	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=1743	12.915	2	788.41502	788.4150	K	-	172	179
PSM	SSQFGSLEF	271	sp|Q8NHZ8|CDC26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=18301	86.052	2	1144.5522	1144.5522	R	-	77	86
PSM	SVLEEMGLA	272	sp|P61966|AP1S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=21574	100.55	2	1091.5654	1091.5654	R	-	150	159
PSM	SVVSLLIDT	273	sp|Q7Z6J6-2|FRMD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=22962	107.38	2	1089.6403	1089.6403	R	-	547	556
PSM	TALLAQQ	274	sp|Q9Y608-3|LRRF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=6552	35.759	2	887.51982	887.5198	R	-	94	101
PSM	TFQPLSQSLLAE	275	sp|Q8WV60-2|PTCD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=20415	95.359	2	1476.7946	1476.7946	R	-	205	217
PSM	TLLEQLDDDQ	276	sp|O75400-2|PR40A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=17688	83.375	2	1332.6531	1332.6531	R	-	921	931
PSM	TLLEQLDDDQ	277	sp|O75400-2|PR40A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=17709	83.466	2	1332.6531	1332.6531	R	-	921	931
PSM	TVLEQVLPI	278	sp|P25685-2|DNJB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=23629	110.95	2	1154.7033	1154.7033	R	-	232	241
PSM	TVLEQVLPI	279	sp|P25685-2|DNJB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=23951	112.58	2	1154.7033	1154.7033	R	-	232	241
PSM	VALSLEDDGLP	280	sp|Q14114-3|LRP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=19856	92.866	2	1271.6731	1271.6731	R	-	894	905
PSM	VNVQPELVS	281	sp|P53611|PGTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=11795	57.97	2	1127.6308	1127.6308	R	-	323	332
PSM	VQAELSQPLTAGGAISELL	282	sp|Q15291|RBBP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=25897	123.66	3	2040.1225	2040.1225	K	-	520	539
PSM	YFAQEALTVLSLA	283	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=29393	145.79	2	1568.8572	1568.8572	K	-	577	590
PSM	QDWSSCPDIF	284	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,6-UNIMOD:4	ms_run[1]:scan=18568	87.262235	2	1397.605174	1397.604352	K	-	798	808
PSM	VVSIGVPVSELLDD	285	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:214	ms_run[1]:scan=24687	116.57205166666667	2	1584.8641	1584.8727	R	P	696	710
PSM	MVFETGQFDDAED	286	sp|Q9NQ92|COPRS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=17354	81.89857833333333	2	1646.689830	1646.689203	K	-	172	185
PSM	LITSVADVVNND	287	sp|P06737|PYGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:214	ms_run[1]:scan=18595	87.37891	2	1402.7411	1402.7420	K	P	623	635
PSM	NNQFQALLQYAD	288	sp|P26599|PTBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:214	ms_run[1]:scan=21916	102.121905	2	1567.7756	1567.7747	K	P	219	231
PSM	LDQILLNGNNITMLVPGGEGPEV	289	sp|Q9Y4Y9|LSM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=26835	129.45001166666668	3	2537.314721	2536.332875	K	-	69	92
PSM	GPTISLTQIV	290	sp|Q15904|VAS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=20839	97.30868166666667	2	1171.695133	1171.693424	K	-	461	471
PSM	GNLQLLQNCLAVLNGDT	291	sp|Q9UNH7|SNX6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,9-UNIMOD:4	ms_run[1]:scan=23400	109.70765166666666	3	1987.016785	1986.032611	K	-	390	407
PSM	IDEFEAM	292	sp|P35241|RADI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=15688	74.93603333333334	2	997.456504	997.454833	R	-	577	584
PSM	IDEFESM	293	sp|P26038|MOES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,7-UNIMOD:35	ms_run[1]:scan=9290	47.456181666666666	2	1029.448326	1029.444663	R	-	571	578
PSM	NLQTVNVDEN	294	sp|P62899|RL31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=7179	38.582015000000006	2	1288.640684	1288.638094	K	-	116	126
PSM	TSWDPGF	295	sp|P46199|IF2M_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=15357	73.49865833333334	2	951.449339	952.441232	K	-	721	728
PSM	LEATINELV	296	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=22580	105.45976166666667	2	1145.629636	1144.646140	K	-	97	106
PSM	VTNSSVWVEP	297	sp|Q9UK22|FBX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=12698	61.694115000000004	2	1263.660039	1260.647202	R	-	287	297
PSM	APRESAQAIEDLAGFK	298	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,16-UNIMOD:214	ms_run[1]:scan=21450	99.97694666666666	3	1993.065302	1990.072725	R	D	2789	2805
PSM	NGVDLGPICGPPNGII	299	sp|Q14671|PUM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,9-UNIMOD:4	ms_run[1]:scan=22073	102.85137666666667	2	1736.888087	1735.904891	K	-	1171	1187