MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	mHCT116_iTRAQ_JPST000205
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190823\20190823215055952307^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_CH_1\120307_mHCT116_iTRAQ_03.CID.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190823\20190823215055952307^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\120307_mHCT116_iTRAQ_03.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, ]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[1]-setting	variableModifications=iTRAQ4plex (Y),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[2]-setting	IT_MODS=Oxidation (M),iTRAQ4plex (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[3]-setting	VarMod=iTRAQ4plex (Y),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	fixed_mod[2]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	fixed_mod[2]-site	K
MTD	fixed_mod[2]-position	Anywhere
MTD	fixed_mod[3]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	fixed_mod[3]-site	N-term
MTD	fixed_mod[3]-position	Any N-term
MTD	variable_mod[1]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	variable_mod[1]-site	Y
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	53.0	null	555-UNIMOD:214,558-UNIMOD:35,568-UNIMOD:35,561-UNIMOD:35,572-UNIMOD:35,564-UNIMOD:35	0.03	53.0	26	1	0
PRT	sp|P67809|YBOX1_HUMAN	Nuclease-sensitive element-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	46.0	null	305-UNIMOD:214	0.06	46.0	1	1	1
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	43.0	null	213-UNIMOD:214,218-UNIMOD:35	0.11	43.0	3	1	0
PRT	sp|Q9Y4Y9-2|LSM5_HUMAN	Isoform 2 of U6 snRNA-associated Sm-like protein LSm5 OS=Homo sapiens OX=9606 GN=LSM5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	40-UNIMOD:214,52-UNIMOD:35	0.39	41.0	1	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	610-UNIMOD:214,617-UNIMOD:35,621-UNIMOD:35	0.06	41.0	7	1	0
PRT	sp|Q5SRD0|WAC2D_HUMAN	WASH complex subunit 2D OS=Homo sapiens OX=9606 GN=WASHC2D PE=3 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	294-UNIMOD:214	0.05	40.0	1	1	1
PRT	sp|Q9UNH7-2|SNX6_HUMAN	Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	274-UNIMOD:214,282-UNIMOD:4	0.06	39.0	2	1	0
PRT	sp|P41440-2|S19A1_HUMAN	Isoform 2 of Folate transporter 1 OS=Homo sapiens OX=9606 GN=SLC19A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	536-UNIMOD:214,540-UNIMOD:4	0.03	39.0	2	1	0
PRT	sp|O00308-3|WWP2_HUMAN	Isoform 3 of NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	418-UNIMOD:214	0.03	39.0	1	1	1
PRT	sp|E9PAV3-2|NACAM_HUMAN	Isoform skNAC-2 of Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	911-UNIMOD:214,925-UNIMOD:35	0.02	39.0	2	1	0
PRT	sp|Q8IZ52-2|CHSS2_HUMAN	Isoform 2 of Chondroitin sulfate synthase 2 OS=Homo sapiens OX=9606 GN=CHPF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	300-UNIMOD:214	0.05	39.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39.0	null	354-UNIMOD:214	0.05	39.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	752-UNIMOD:214	0.02	38.0	1	1	1
PRT	sp|Q9HAU4|SMUF2_HUMAN	E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens OX=9606 GN=SMURF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	735-UNIMOD:214,743-UNIMOD:4	0.02	38.0	1	1	1
PRT	sp|Q14671-4|PUM1_HUMAN	Isoform 4 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	1112-UNIMOD:214,1120-UNIMOD:4	0.02	38.0	1	1	0
PRT	sp|Q9Y4Y9|LSM5_HUMAN	U6 snRNA-associated Sm-like protein LSm5 OS=Homo sapiens OX=9606 GN=LSM5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38.0	null	69-UNIMOD:214	0.26	38.0	2	1	0
PRT	sp|Q9UI30|TR112_HUMAN	Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens OX=9606 GN=TRMT112 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37.0	null	112-UNIMOD:214,116-UNIMOD:35	0.12	37.0	2	1	0
PRT	sp|Q9Y570-2|PPME1_HUMAN	Isoform 2 of Protein phosphatase methylesterase 1 OS=Homo sapiens OX=9606 GN=PPME1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	185-UNIMOD:214,194-UNIMOD:4,199-UNIMOD:4	0.08	36.0	2	1	0
PRT	sp|Q6VMQ6-5|MCAF1_HUMAN	Isoform 4 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	1251-UNIMOD:214,1255-UNIMOD:4	0.02	36.0	2	1	0
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	133-UNIMOD:214	0.10	36.0	2	1	0
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	215-UNIMOD:214	0.08	36.0	3	1	0
PRT	sp|Q96PU5-9|NED4L_HUMAN	Isoform 8 of E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	820-UNIMOD:214	0.02	36.0	1	1	1
PRT	sp|A6NDG6|PGP_HUMAN	Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	303-UNIMOD:214,303-UNIMOD:35	0.06	36.0	1	1	1
PRT	sp|Q92945|FUBP2_HUMAN	Far upstream element-binding protein 2 OS=Homo sapiens OX=9606 GN=KHSRP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	684-UNIMOD:214	0.04	36.0	1	1	1
PRT	sp|P52735|VAV2_HUMAN	Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	36.0	null	864-UNIMOD:214	0.02	36.0	1	1	1
PRT	sp|P51668|UB2D1_HUMAN	Ubiquitin-conjugating enzyme E2 D1 OS=Homo sapiens OX=9606 GN=UBE2D1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36.0	null	102-UNIMOD:214,107-UNIMOD:4,111-UNIMOD:4	0.12	36.0	1	1	1
PRT	sp|Q99436|PSB7_HUMAN	Proteasome subunit beta type-7 OS=Homo sapiens OX=9606 GN=PSMB7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	259-UNIMOD:214,274-UNIMOD:35	0.07	35.0	4	1	0
PRT	sp|Q6XQN6-3|PNCB_HUMAN	Isoform 3 of Nicotinate phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=NAPRT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	512-UNIMOD:214,520-UNIMOD:4	0.03	35.0	2	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	370-UNIMOD:214,370-UNIMOD:35	0.04	35.0	2	1	0
PRT	sp|Q8IVD9|NUDC3_HUMAN	NudC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NUDCD3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	347-UNIMOD:214	0.04	34.0	1	1	1
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	440-UNIMOD:214	0.03	34.0	1	1	1
PRT	sp|O15127|SCAM2_HUMAN	Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null	317-UNIMOD:214	0.04	34.0	1	1	1
PRT	sp|Q9P0V3-2|SH3B4_HUMAN	Isoform 2 of SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	539-UNIMOD:214	0.03	33.0	1	1	1
PRT	sp|Q15038-4|DAZP2_HUMAN	Isoform 4 of DAZ-associated protein 2 OS=Homo sapiens OX=9606 GN=DAZAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	72-UNIMOD:214	0.19	33.0	1	1	1
PRT	sp|P60228|EIF3E_HUMAN	Eukaryotic translation initiation factor 3 subunit E OS=Homo sapiens OX=9606 GN=EIF3E PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33.0	null	432-UNIMOD:214	0.03	33.0	1	1	1
PRT	sp|P30044-4|PRDX5_HUMAN	Isoform 4 of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	103-UNIMOD:214,115-UNIMOD:4	0.19	32.0	1	1	1
PRT	sp|P42224|STAT1_HUMAN	Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	737-UNIMOD:214	0.02	32.0	1	1	1
PRT	sp|Q86UD0|SAPC2_HUMAN	Suppressor APC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SAPCD2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	380-UNIMOD:214	0.04	32.0	1	1	1
PRT	sp|O15397-2|IPO8_HUMAN	Isoform 2 of Importin-8 OS=Homo sapiens OX=9606 GN=IPO8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	818-UNIMOD:214	0.02	31.0	1	1	1
PRT	sp|P84074|HPCA_HUMAN	Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens OX=9606 GN=HPCA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	182-UNIMOD:214,185-UNIMOD:4	0.07	31.0	1	1	1
PRT	sp|Q86UX6-2|ST32C_HUMAN	Isoform 2 of Serine/threonine-protein kinase 32C OS=Homo sapiens OX=9606 GN=STK32C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	354-UNIMOD:214,359-UNIMOD:4,363-UNIMOD:4	0.05	31.0	1	1	1
PRT	sp|Q99717|SMAD5_HUMAN	Mothers against decapentaplegic homolog 5 OS=Homo sapiens OX=9606 GN=SMAD5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	450-UNIMOD:214,454-UNIMOD:35	0.04	31.0	2	1	0
PRT	sp|Q96IQ9-2|ZN414_HUMAN	Isoform 2 of Zinc finger protein 414 OS=Homo sapiens OX=9606 GN=ZNF414	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	375-UNIMOD:214	0.04	31.0	1	1	1
PRT	sp|Q13546|RIPK1_HUMAN	Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=RIPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	659-UNIMOD:214	0.02	31.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	446-UNIMOD:214	0.03	31.0	1	1	1
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	341-UNIMOD:214	0.04	31.0	1	1	1
PRT	sp|Q9NQP4|PFD4_HUMAN	Prefoldin subunit 4 OS=Homo sapiens OX=9606 GN=PFDN4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	123-UNIMOD:214	0.10	31.0	1	1	1
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	191-UNIMOD:214	0.07	30.0	1	1	1
PRT	sp|Q9BY32-3|ITPA_HUMAN	Isoform 3 of Inosine triphosphate pyrophosphatase OS=Homo sapiens OX=9606 GN=ITPA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	140-UNIMOD:214	0.10	30.0	1	1	1
PRT	sp|Q9UBQ5|EIF3K_HUMAN	Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	205-UNIMOD:214,214-UNIMOD:35	0.07	30.0	3	1	0
PRT	sp|Q8N0W3|FUK_HUMAN	L-fucose kinase OS=Homo sapiens OX=9606 GN=FUK PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1072-UNIMOD:214,1080-UNIMOD:4,1081-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q9P2T1-3|GMPR2_HUMAN	Isoform 3 of GMP reductase 2 OS=Homo sapiens OX=9606 GN=GMPR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	308-UNIMOD:214,320-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|P49795|RGS19_HUMAN	Regulator of G-protein signaling 19 OS=Homo sapiens OX=9606 GN=RGS19 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	204-UNIMOD:214	0.07	30.0	1	1	1
PRT	sp|Q15366|PCBP2_HUMAN	Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	355-UNIMOD:214,362-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|Q9P0U1|TOM7_HUMAN	Mitochondrial import receptor subunit TOM7 homolog OS=Homo sapiens OX=9606 GN=TOMM7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	39-UNIMOD:214,44-UNIMOD:35	0.33	30.0	2	1	0
PRT	sp|Q9UI30-2|TR112_HUMAN	Isoform 2 of Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens OX=9606 GN=TRMT112	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	107-UNIMOD:214	0.13	29.0	2	1	0
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	470-UNIMOD:214,471-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|O43447-2|PPIH_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	124-UNIMOD:214,131-UNIMOD:4,134-UNIMOD:35	0.09	29.0	4	1	0
PRT	sp|Q8TB72-2|PUM2_HUMAN	Isoform 2 of Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	972-UNIMOD:214	0.02	29.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	237-UNIMOD:214	0.05	29.0	2	1	0
PRT	sp|O75319|DUS11_HUMAN	RNA/RNP complex-1-interacting phosphatase OS=Homo sapiens OX=9606 GN=DUSP11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	367-UNIMOD:214,372-UNIMOD:4	0.03	29.0	1	1	1
PRT	sp|Q96GZ6-5|S41A3_HUMAN	Isoform 5 of Solute carrier family 41 member 3 OS=Homo sapiens OX=9606 GN=SLC41A3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	465-UNIMOD:214	0.03	29.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	1900-UNIMOD:214	0.01	29.0	1	1	1
PRT	sp|Q9BU61|NDUF3_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Homo sapiens OX=9606 GN=NDUFAF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	162-UNIMOD:214	0.13	29.0	1	1	1
PRT	sp|P62166-2|NCS1_HUMAN	Isoform 2 of Neuronal calcium sensor 1 OS=Homo sapiens OX=9606 GN=NCS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	157-UNIMOD:214	0.10	28.0	1	1	1
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	184-UNIMOD:214	0.06	28.0	1	1	1
PRT	sp|Q9NRZ9-6|HELLS_HUMAN	Isoform 6 of Lymphoid-specific helicase OS=Homo sapiens OX=9606 GN=HELLS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	695-UNIMOD:214,706-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q9Y6G5|COMDA_HUMAN	COMM domain-containing protein 10 OS=Homo sapiens OX=9606 GN=COMMD10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	191-UNIMOD:214	0.06	28.0	1	1	1
PRT	sp|P06753-7|TPM3_HUMAN	Isoform 7 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	147-UNIMOD:214,158-UNIMOD:35,147-UNIMOD:35	0.08	28.0	4	1	0
PRT	sp|Q99640-4|PMYT1_HUMAN	Isoform 4 of Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens OX=9606 GN=PKMYT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	418-UNIMOD:214	0.03	28.0	1	1	1
PRT	sp|Q9BRT9|SLD5_HUMAN	DNA replication complex GINS protein SLD5 OS=Homo sapiens OX=9606 GN=GINS4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	210-UNIMOD:214	0.07	28.0	1	1	1
PRT	sp|Q9Y5V0|ZN706_HUMAN	Zinc finger protein 706 OS=Homo sapiens OX=9606 GN=ZNF706 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	65-UNIMOD:214	0.17	28.0	3	1	0
PRT	sp|Q99720|SGMR1_HUMAN	Sigma non-opioid intracellular receptor 1 OS=Homo sapiens OX=9606 GN=SIGMAR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	212-UNIMOD:214	0.06	28.0	1	1	1
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28.0	null	117-UNIMOD:214	0.04	28.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	330-UNIMOD:214,335-UNIMOD:4	0.03	27.0	15	1	0
PRT	sp|Q9BT78|CSN4_HUMAN	COP9 signalosome complex subunit 4 OS=Homo sapiens OX=9606 GN=COPS4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	388-UNIMOD:214	0.05	27.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	145-UNIMOD:214,147-UNIMOD:4	0.07	27.0	3	1	0
PRT	sp|Q13641|TPBG_HUMAN	Trophoblast glycoprotein OS=Homo sapiens OX=9606 GN=TPBG PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	411-UNIMOD:214	0.03	27.0	1	1	1
PRT	sp|Q92997-2|DVL3_HUMAN	Isoform 2 of Segment polarity protein dishevelled homolog DVL-3 OS=Homo sapiens OX=9606 GN=DVL3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	686-UNIMOD:214,686-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|O43929-2|ORC4_HUMAN	Isoform 2 of Origin recognition complex subunit 4 OS=Homo sapiens OX=9606 GN=ORC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	343-UNIMOD:214	0.03	27.0	1	1	1
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	921-UNIMOD:214	0.01	27.0	1	1	1
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	1171-UNIMOD:214,1179-UNIMOD:4	0.01	27.0	1	1	0
PRT	sp|Q5JVF3|PCID2_HUMAN	PCI domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PCID2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	389-UNIMOD:214,399-UNIMOD:4	0.03	27.0	2	1	0
PRT	sp|Q15819|UB2V2_HUMAN	Ubiquitin-conjugating enzyme E2 variant 2 OS=Homo sapiens OX=9606 GN=UBE2V2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	134-UNIMOD:214	0.09	27.0	2	1	0
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	2337-UNIMOD:214	0.00	27.0	1	1	1
PRT	sp|P52815|RM12_HUMAN	39S ribosomal protein L12, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	186-UNIMOD:214	0.07	26.0	1	1	1
PRT	sp|Q96IK1|BOD1_HUMAN	Biorientation of chromosomes in cell division protein 1 OS=Homo sapiens OX=9606 GN=BOD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	163-UNIMOD:214	0.13	26.0	1	1	1
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	632-UNIMOD:214,637-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	311-UNIMOD:214,316-UNIMOD:4	0.03	26.0	12	1	0
PRT	sp|O95229-2|ZWINT_HUMAN	Isoform 2 of ZW10 interactor OS=Homo sapiens OX=9606 GN=ZWINT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	218-UNIMOD:214	0.06	26.0	1	1	1
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	492-UNIMOD:214	0.03	26.0	1	1	1
PRT	sp|P36542|ATPG_HUMAN	ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	286-UNIMOD:214	0.05	26.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	96-UNIMOD:214,101-UNIMOD:4	0.10	26.0	1	1	1
PRT	sp|Q8N6M0-2|OTU6B_HUMAN	Isoform 2 of Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=OTUD6B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	183-UNIMOD:214,191-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q9NVC6|MED17_HUMAN	Mediator of RNA polymerase II transcription subunit 17 OS=Homo sapiens OX=9606 GN=MED17 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	639-UNIMOD:214,639-UNIMOD:35,649-UNIMOD:4	0.02	26.0	2	1	0
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	228-UNIMOD:214,233-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|Q9Y606-2|TRUA_HUMAN	Isoform 2 of tRNA pseudouridine synthase A OS=Homo sapiens OX=9606 GN=PUS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	385-UNIMOD:214	0.04	26.0	1	1	1
PRT	sp|Q05DH4|F16A1_HUMAN	Protein FAM160A1 OS=Homo sapiens OX=9606 GN=FAM160A1 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	1031-UNIMOD:214,1039-UNIMOD:4,1040-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q14019|COTL1_HUMAN	Coactosin-like protein OS=Homo sapiens OX=9606 GN=COTL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	132-UNIMOD:214	0.08	25.0	1	1	1
PRT	sp|Q9UIJ5|ZDHC2_HUMAN	Palmitoyltransferase ZDHHC2 OS=Homo sapiens OX=9606 GN=ZDHHC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	354-UNIMOD:214	0.04	25.0	1	1	1
PRT	sp|Q92785-2|REQU_HUMAN	Isoform 2 of Zinc finger protein ubi-d4 OS=Homo sapiens OX=9606 GN=DPF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	198-UNIMOD:214	0.05	25.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	691-UNIMOD:214	0.02	25.0	2	1	0
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	245-UNIMOD:27	0.05	25.0	1	1	1
PRT	sp|P23246|SFPQ_HUMAN	Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	612-UNIMOD:214	0.02	25.0	1	1	1
PRT	sp|Q15031|SYLM_HUMAN	Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	894-UNIMOD:214	0.01	25.0	1	1	1
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	293-UNIMOD:214	0.04	24.0	1	1	1
PRT	sp|Q96DZ1-2|ERLEC_HUMAN	Isoform 2 of Endoplasmic reticulum lectin 1 OS=Homo sapiens OX=9606 GN=ERLEC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	415-UNIMOD:214	0.04	24.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	338-UNIMOD:214,343-UNIMOD:4	0.03	24.0	4	1	0
PRT	sp|Q7Z2W9-2|RM21_HUMAN	Isoform 2 of 39S ribosomal protein L21, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	110-UNIMOD:214,118-UNIMOD:4	0.10	24.0	1	1	1
PRT	sp|P02768-3|ALBU_HUMAN	Isoform 3 of Serum albumin OS=Homo sapiens OX=9606 GN=ALB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	386-UNIMOD:214	0.03	24.0	1	1	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1155-UNIMOD:214,1156-UNIMOD:4,1159-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q6P1L8|RM14_HUMAN	39S ribosomal protein L14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL14 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	137-UNIMOD:214	0.07	24.0	1	1	1
PRT	sp|P63146|UBE2B_HUMAN	Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	141-UNIMOD:214	0.09	24.0	1	1	1
PRT	sp|Q8IV63-3|VRK3_HUMAN	Isoform 3 of Inactive serine/threonine-protein kinase VRK3 OS=Homo sapiens OX=9606 GN=VRK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	412-UNIMOD:214	0.03	24.0	1	1	1
PRT	sp|Q7Z6J0|SH3R1_HUMAN	E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens OX=9606 GN=SH3RF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	877-UNIMOD:214	0.01	24.0	1	1	1
PRT	sp|P46108|CRK_HUMAN	Adapter molecule crk OS=Homo sapiens OX=9606 GN=CRK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	293-UNIMOD:214	0.04	24.0	1	1	1
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	152-UNIMOD:214,163-UNIMOD:4	0.09	24.0	1	1	1
PRT	sp|O75864|PPR37_HUMAN	Protein phosphatase 1 regulatory subunit 37 OS=Homo sapiens OX=9606 GN=PPP1R37 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	674-UNIMOD:214	0.03	24.0	1	1	1
PRT	sp|Q15075|EEA1_HUMAN	Early endosome antigen 1 OS=Homo sapiens OX=9606 GN=EEA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1401-UNIMOD:214,1402-UNIMOD:4,1405-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q5J8M3|EMC4_HUMAN	ER membrane protein complex subunit 4 OS=Homo sapiens OX=9606 GN=EMC4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	174-UNIMOD:214,174-UNIMOD:35	0.06	24.0	1	1	1
PRT	sp|Q9H8H0|NOL11_HUMAN	Nucleolar protein 11 OS=Homo sapiens OX=9606 GN=NOL11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	709-UNIMOD:214	0.02	24.0	1	1	1
PRT	sp|Q9Y5B0|CTDP1_HUMAN	RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens OX=9606 GN=CTDP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	952-UNIMOD:214	0.01	23.0	1	1	1
PRT	sp|Q86VV8|RTTN_HUMAN	Rotatin OS=Homo sapiens OX=9606 GN=RTTN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2215-UNIMOD:214,2215-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	132-UNIMOD:214	0.07	23.0	1	1	1
PRT	sp|Q96RT7-2|GCP6_HUMAN	Isoform 2 of Gamma-tubulin complex component 6 OS=Homo sapiens OX=9606 GN=TUBGCP6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1776-UNIMOD:214	0.01	23.0	1	1	1
PRT	sp|Q8TCG1-2|CIP2A_HUMAN	Isoform 2 of Protein CIP2A OS=Homo sapiens OX=9606 GN=CIP2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	737-UNIMOD:214	0.01	23.0	1	1	1
PRT	sp|Q13404-6|UB2V1_HUMAN	Isoform 4 of Ubiquitin-conjugating enzyme E2 variant 1 OS=Homo sapiens OX=9606 GN=UBE2V1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	92-UNIMOD:214,100-UNIMOD:4	0.13	23.0	1	1	1
PRT	sp|Q6ZMU5|TRI72_HUMAN	Tripartite motif-containing protein 72 OS=Homo sapiens OX=9606 GN=TRIM72 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	463-UNIMOD:214	0.03	23.0	1	1	1
PRT	sp|P53680-2|AP2S1_HUMAN	Isoform 2 of AP-2 complex subunit sigma OS=Homo sapiens OX=9606 GN=AP2S1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	96-UNIMOD:214,99-UNIMOD:35	0.10	23.0	2	1	0
PRT	sp|Q9Y371-3|SHLB1_HUMAN	Isoform 3 of Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	256-UNIMOD:214	0.04	23.0	1	1	1
PRT	sp|O60506-3|HNRPQ_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	313-UNIMOD:214	0.02	23.0	1	1	1
PRT	sp|Q3KNT7-3|NSN5B_HUMAN	Isoform 3 of Putative NOL1/NOP2/Sun domain family member 5B OS=Homo sapiens OX=9606 GN=NSUN5P1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	144-UNIMOD:214,149-UNIMOD:4,153-UNIMOD:4	0.08	23.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DPGMGAMGGMGGGMGGGMF	1	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	53	1-UNIMOD:214	ms_run[2]:scan=20487	100.96	2	1817.7149	1817.7149	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	2	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	52	1-UNIMOD:214,4-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=14595	74.976	2	1849.7048	1849.7048	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	3	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	50	1-UNIMOD:214	ms_run[2]:scan=20253	99.889	2	1817.7149	1817.7149	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	4	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:214,7-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=13018	68.187	2	1849.7048	1849.7048	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	5	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:214,10-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=13433	69.986	2	1849.7048	1849.7048	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	6	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:214,14-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=13832	71.682	2	1849.7048	1849.7048	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	7	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:214,10-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=14344	73.891	2	1849.7048	1849.7048	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	8	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	49	1-UNIMOD:214,10-UNIMOD:35	ms_run[2]:scan=17197	86.331	2	1833.7098	1833.7098	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	9	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:214,4-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=14087	72.726	2	1849.7048	1849.7048	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	10	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:214,14-UNIMOD:35	ms_run[2]:scan=17491	87.604	2	1833.7098	1833.7098	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	11	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	48	1-UNIMOD:214,4-UNIMOD:35	ms_run[2]:scan=17782	88.922	2	1833.7098	1833.7098	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	12	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46	1-UNIMOD:214,18-UNIMOD:35	ms_run[2]:scan=16759	84.41	2	1833.7098	1833.7098	K	-	555	574
PSM	AADPPAENSSAPEAEQGGAE	13	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	46	1-UNIMOD:214	ms_run[1]:scan=3934	25.434616666666667	2	2040.897394	2040.899407	K	-	305	325
PSM	DPGMGAMGGMGGGMGGGMF	14	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:214,4-UNIMOD:35,10-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=11206	60.292	2	1865.6997	1865.6997	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	15	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:214,7-UNIMOD:35,14-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=9930	54.692	2	1865.6997	1865.6997	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	16	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:214,4-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=14831	76.004	2	1849.7048	1849.7048	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	17	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	1-UNIMOD:214,18-UNIMOD:35	ms_run[2]:scan=16761	84.414	3	1833.7098	1833.7098	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	18	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	43	1-UNIMOD:214,4-UNIMOD:35,10-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=10839	58.66712833333333	2	1865.694253	1865.699668	K	-	555	574
PSM	DYEDGMEVDTTPTVAGQFEDADVDH	19	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	43	1-UNIMOD:214	ms_run[1]:scan=15861	80.54781666666666	3	2899.204754	2899.209978	R	-	213	238
PSM	DPGMGAMGGMGGGMGGGMF	20	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	1-UNIMOD:214,7-UNIMOD:35,10-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=10179	55.772	2	1865.6997	1865.6997	K	-	555	574
PSM	LDQILLNGNNITMLVPGGEGPEV	21	sp|Q9Y4Y9-2|LSM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:214,13-UNIMOD:35	ms_run[2]:scan=25002	123.85	3	2552.3278	2552.3278	K	-	40	63
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	22	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:214,8-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=15388	78.46	3	3521.5837	3521.5837	K	-	610	647
PSM	DYEDGMEVDTTPTVAGQFEDADVDH	23	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:214,6-UNIMOD:35	ms_run[2]:scan=13521	70.346	3	2915.2049	2915.2049	R	-	213	238
PSM	DYEDGMEVDTTPTVAGQFEDADVDH	24	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:214	ms_run[2]:scan=15412	78.549	3	2899.21	2899.2100	R	-	213	238
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	25	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:214,8-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=15291	78.034	3	3521.5837	3521.5837	K	-	610	647
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	26	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:214,8-UNIMOD:35	ms_run[2]:scan=17446	87.421	3	3505.5888	3505.5888	K	-	610	647
PSM	VSNIFDDPLNAFGGQ	27	sp|Q5SRD0|WAC2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:214	ms_run[2]:scan=24182	119.18	2	1736.8491	1736.8491	K	-	294	309
PSM	DPGMGAMGGMGGGMGGGMF	28	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:214,4-UNIMOD:35	ms_run[2]:scan=18075	90.203	2	1833.7098	1833.7098	K	-	555	574
PSM	GNLQLLQNCLAVLNGDT	29	sp|Q9UNH7-2|SNX6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=23639	116.22	2	1986.0326	1986.0326	K	-	274	291
PSM	LGLQCLPSDGVQNVNQ	30	sp|P41440-2|S19A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:214,5-UNIMOD:4	ms_run[2]:scan=14867	76.181	2	1884.9485	1884.9485	K	-	536	552
PSM	LLYAIEETEGFGQE	31	sp|O00308-3|WWP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:214	ms_run[2]:scan=23191	113.87	2	1741.8532	1741.8532	K	-	418	432
PSM	NNSNDIVNAIMELTM	32	sp|E9PAV3-2|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:214,15-UNIMOD:35	ms_run[2]:scan=27213	137.31	2	1837.8672	1837.8672	K	-	911	926
PSM	TQLAMLLFEQEQGNST	33	sp|Q8IZ52-2|CHSS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:214	ms_run[2]:scan=21934	107.73	2	1952.9635	1952.9635	R	-	300	316
PSM	AGEAPTENPAPPTQQSSAE	34	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39	1-UNIMOD:214	ms_run[1]:scan=4601	28.7477	2	2024.938098	2024.940878	K	-	354	373
PSM	FAWAIDMADEDYEF	35	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:214	ms_run[2]:scan=26291	131.51	2	1865.794	1865.7940	K	-	752	766
PSM	LLTAIEETCGFAVE	36	sp|Q9HAU4|SMUF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=23254	114.19	2	1695.8511	1695.8511	K	-	735	749
PSM	NGVDLGPICGPPNGII	37	sp|Q14671-4|PUM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=20238	99.816	2	1735.9049	1735.9049	K	-	1112	1128
PSM	LDQILLNGNNITMLVPGGEGPEV	38	sp|Q9Y4Y9|LSM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:214	ms_run[1]:scan=26079	130.22448166666666	3	2536.329023	2536.332875	K	-	69	92
PSM	DPGMGAMGGMGGGMGGGMF	39	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:214,10-UNIMOD:35	ms_run[2]:scan=17278	86.691	3	1833.7098	1833.7098	K	-	555	574
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	40	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:214,12-UNIMOD:35	ms_run[2]:scan=17214	86.414	3	3505.5888	3505.5888	K	-	610	647
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	41	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:214	ms_run[2]:scan=19173	95.068	3	3489.5939	3489.5939	K	-	610	647
PSM	GIPNMLLSEEETES	42	sp|Q9UI30|TR112_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37	1-UNIMOD:214,5-UNIMOD:35	ms_run[1]:scan=14143	72.96676666666666	2	1707.797268	1707.799482	R	-	112	126
PSM	FAEPIGGFQCVFPGC	43	sp|Q9Y570-2|PPME1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=22261	109.22	2	1828.8398	1828.8398	R	-	185	200
PSM	FGPFCDPQSTDVISSTQSS	44	sp|Q6VMQ6-5|MCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214,5-UNIMOD:4	ms_run[2]:scan=16682	84.065	2	2202.9861	2202.9861	R	-	1251	1270
PSM	IVSAQSLAEDDVE	45	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214	ms_run[2]:scan=13183	68.887	2	1518.7535	1518.7535	R	-	133	146
PSM	LLAQDQGQGAPLLEPAP	46	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214	ms_run[2]:scan=17240	86.534	2	1861.0067	1861.0067	R	-	215	232
PSM	LLMAVENAQGFEGVD	47	sp|Q96PU5-9|NED4L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214	ms_run[2]:scan=21130	103.97	2	1735.8573	1735.8573	K	-	820	835
PSM	MVPDFYVDSIADLLPALQG	48	sp|A6NDG6|PGP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214,1-UNIMOD:35	ms_run[2]:scan=29321	151.52	2	2223.1255	2223.1255	K	-	303	322
PSM	QQAAYYGQTPGPGGPQPPPTQQGQQQAQ	49	sp|Q92945|FUBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:214	ms_run[2]:scan=7837	45.109	3	3051.4557	3051.4557	R	-	684	712
PSM	IGWFPSTYVEEEGIQ	50	sp|P52735|VAV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	36	1-UNIMOD:214	ms_run[1]:scan=22814	111.98362333333334	2	1897.919505	1897.921980	R	-	864	879
PSM	VLLSICSLLCDPNPDD	51	sp|P51668|UB2D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:214,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=25771	128.35175666666666	2	1973.9513	1973.9555	K	P	102	118
PSM	DPGMGAMGGMGGGMGGGMF	52	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214,14-UNIMOD:35	ms_run[2]:scan=17530	87.788	3	1833.7098	1833.7098	K	-	555	574
PSM	DPGMGAMGGMGGGMGGGMF	53	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214	ms_run[2]:scan=20256	99.895	3	1817.7149	1817.7149	K	-	555	574
PSM	ITPLEIEVLEETVQTMDTS	54	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214,16-UNIMOD:35	ms_run[2]:scan=24820	122.82	2	2307.1525	2307.1525	K	-	259	278
PSM	LQALVNSLCAGQSP	55	sp|Q6XQN6-3|PNCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=19984	98.674	2	1600.8365	1600.8365	R	-	512	526
PSM	MFGSSVDLGNLGQ	56	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:214	ms_run[2]:scan=18351	91.433	2	1467.715	1467.7150	K	-	370	383
PSM	FDPAMFNISPGAVQF	57	sp|Q8IVD9|NUDC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=25317	125.65	2	1783.8725	1783.8725	R	-	347	362
PSM	LLDISASSTEQIL	58	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:214	ms_run[2]:scan=21822	107.23	2	1532.8419	1532.8419	R	-	440	453
PSM	AASSAAQGAFQGN	59	sp|O15127|SCAM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	1-UNIMOD:214	ms_run[1]:scan=4481	28.134241666666668	2	1322.633132	1322.633678	R	-	317	330
PSM	AAAFSPADQDDFVI	60	sp|Q9P0V3-2|SH3B4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=19777	97.661	2	1609.7746	1609.7746	R	-	539	553
PSM	GNFFMGGSDGGYTIW	61	sp|Q15038-4|DAZP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=24374	120.26	2	1751.7735	1751.7735	K	-	72	87
PSM	ITPLEIEVLEETVQTMDTS	62	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=28637	146.61	2	2291.1576	2291.1576	K	-	259	278
PSM	LLAQDQGQGAPLLEPAP	63	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=16986	85.377	2	1861.0067	1861.0067	R	-	215	232
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	64	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214	ms_run[2]:scan=19417	96.118	3	3489.5939	3489.5939	K	-	610	647
PSM	MFGSSVDLGNLGQ	65	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:214,1-UNIMOD:35	ms_run[2]:scan=14927	76.463	2	1483.7099	1483.7099	K	-	370	383
PSM	SEAPNWATQDSGFY	66	sp|P60228|EIF3E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33	1-UNIMOD:214	ms_run[1]:scan=15714	79.906785	2	1715.751293	1715.754915	R	-	432	446
PSM	ALNVEPDGTGLTCSLAPNIISQL	67	sp|P30044-4|PRDX5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214,13-UNIMOD:4	ms_run[2]:scan=24834	122.92	3	2526.3121	2526.3121	K	-	103	126
PSM	ITPLEIEVLEETVQTMDTS	68	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214	ms_run[2]:scan=28649	146.69	3	2291.1576	2291.1576	K	-	259	278
PSM	IVGSVEFDSMMNTV	69	sp|P42224|STAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:214	ms_run[2]:scan=22518	110.46	2	1671.797	1671.7970	R	-	737	751
PSM	ALSQQDGGPLDSTFI	70	sp|Q86UD0|SAPC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	1-UNIMOD:214	ms_run[1]:scan=18733	93.1861	2	1691.847926	1691.848815	R	-	380	395
PSM	DPGMGAMGGMGGGMGGGMF	71	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214,10-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=13498	70.247	3	1849.7048	1849.7048	K	-	555	574
PSM	GVLSAFNFGTVPSNN	72	sp|O15397-2|IPO8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=21493	105.69	2	1666.8437	1666.8437	K	-	818	833
PSM	IVSAQSLAEDDVE	73	sp|Q15388|TOM20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=13268	69.251	2	1518.7535	1518.7535	R	-	133	146
PSM	LLQCDPSSASQF	74	sp|P84074|HPCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214,4-UNIMOD:4	ms_run[2]:scan=13640	70.868	2	1495.7099	1495.7099	R	-	182	194
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	75	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214,12-UNIMOD:35	ms_run[2]:scan=16964	85.289	3	3505.5888	3505.5888	K	-	610	647
PSM	SALPMCGPICPSAGSG	76	sp|Q86UX6-2|ST32C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=12834	67.402	2	1704.7755	1704.7755	R	-	354	370
PSM	VLTQMGSPLNPISSVS	77	sp|Q99717|SMAD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214,5-UNIMOD:35	ms_run[2]:scan=16113	81.629	2	1788.9413	1788.9413	K	-	450	466
PSM	VSPLLSEGELPVFSQL	78	sp|Q96IQ9-2|ZN414_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=26576	133.32	2	1858.021	1858.0210	K	-	375	391
PSM	IDLLSSLIYVSQN	79	sp|Q13546|RIPK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:214	ms_run[1]:scan=26454	132.54215666666667	2	1607.886848	1607.889224	R	-	659	672
PSM	SNTAGSQSQVETEA	80	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:214	ms_run[1]:scan=2374	16.518193333333333	2	1551.711811	1551.713444	K	-	446	460
PSM	LFMAQALQEYNN	81	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:214	ms_run[1]:scan=19779	97.66592	2	1584.770533	1584.772814	K	-	341	353
PSM	FGSNINLEADES	82	sp|Q9NQP4|PFD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:214	ms_run[1]:scan=12477	65.88555666666666	2	1437.663554	1438.669788	K	-	123	135
PSM	ALEEELEDLELGL	83	sp|Q9BRP8-2|PYM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=26959	135.72	2	1615.8314	1615.8314	R	-	191	204
PSM	ALLELQEYFGSLAA	84	sp|Q9BY32-3|ITPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=28079	142.85	2	1667.8892	1667.8892	R	-	140	154
PSM	DPGMGAMGGMGGGMGGGMF	85	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214,7-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=13044	68.28	3	1849.7048	1849.7048	K	-	555	574
PSM	IDFDSVSSIMASSQ	86	sp|Q9UBQ5|EIF3K_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214,10-UNIMOD:35	ms_run[2]:scan=15604	79.397	2	1645.7627	1645.7627	K	-	205	219
PSM	LLAQDQGQGAPLLEPAP	87	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214	ms_run[2]:scan=17004	85.455	3	1861.0067	1861.0067	R	-	215	232
PSM	LLGTEASTCCPFP	88	sp|Q8N0W3|FUK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214,9-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=17217	86.421	2	1595.7445	1595.7446	K	-	1072	1085
PSM	VTQQVNPIFSEAC	89	sp|Q9P2T1-3|GMPR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:214,13-UNIMOD:4	ms_run[2]:scan=14006	72.407	2	1635.8048	1635.8048	R	-	308	321
PSM	ALLLQGPSQSSSEA	90	sp|P49795|RGS19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:214	ms_run[1]:scan=11662	62.331345	2	1530.800437	1530.801137	R	-	204	218
PSM	LSSETGGMGSS	91	sp|Q15366|PCBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:214,8-UNIMOD:35	ms_run[1]:scan=1713	12.731616666666667	2	1171.513059	1171.514868	R	-	355	366
PSM	GADPGMPEPTVLSLLWG	92	sp|Q9P0U1|TOM7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:214,6-UNIMOD:35	ms_run[1]:scan=27393	138.45073833333333	2	1898.954759	1898.956986	R	-	39	56
PSM	DPGMGAMGGMGGGMGGGMF	93	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,14-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=13880	71.878	3	1849.7048	1849.7048	K	-	555	574
PSM	FAEPIGGFQCVFPGC	94	sp|Q9Y570-2|PPME1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=22283	109.33	3	1828.8398	1828.8398	R	-	185	200
PSM	GIPNMLLSEEETES	95	sp|Q9UI30-2|TR112_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=18013	89.946	2	1691.8046	1691.8046	R	-	107	121
PSM	ITPLEIEVLEETVQTMDTS	96	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,16-UNIMOD:35	ms_run[2]:scan=24790	122.67	3	2307.1525	2307.1525	K	-	259	278
PSM	LCATQFNNIFFLD	97	sp|P86791|CCZ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,2-UNIMOD:4	ms_run[2]:scan=25999	129.73	2	1745.8569	1745.8569	K	-	470	483
PSM	LGLQCLPSDGVQNVNQ	98	sp|P41440-2|S19A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,5-UNIMOD:4	ms_run[2]:scan=14882	76.26	3	1884.9485	1884.9485	K	-	536	552
PSM	LPVVISQCGEM	99	sp|O43447-2|PPIH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,8-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=13284	69.326	2	1391.6911	1391.6911	K	-	124	135
PSM	LPVVISQCGEM	100	sp|O43447-2|PPIH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,8-UNIMOD:4	ms_run[2]:scan=16779	84.495	2	1375.6961	1375.6961	K	-	124	135
PSM	NSPDLGPIGGPPNGML	101	sp|Q8TB72-2|PUM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214	ms_run[2]:scan=17975	89.775	2	1678.847	1678.8470	K	-	972	988
PSM	MLDQTLLDLNEM	102	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214	ms_run[1]:scan=24648	121.83094333333334	2	1578.772650	1578.775516	R	-	237	249
PSM	GIPNMLLSEEETES	103	sp|Q9UI30|TR112_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214,5-UNIMOD:35	ms_run[1]:scan=14061	72.63818666666667	2	1707.797268	1707.799482	R	-	112	126
PSM	LSYPACWEWTQ	104	sp|O75319|DUS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214,6-UNIMOD:4	ms_run[1]:scan=20240	99.82011333333332	2	1583.718100	1583.720050	R	-	367	378
PSM	LDQILLNGNNITMLVPGGEGPEV	105	sp|Q9Y4Y9|LSM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214	ms_run[1]:scan=26590	133.40081166666667	3	2537.313070	2536.332875	K	-	69	92
PSM	AELGGISELASGPP	106	sp|Q96GZ6-5|S41A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214	ms_run[1]:scan=16739	84.32575166666668	2	1440.755177	1440.758209	K	-	465	479
PSM	APEPTPQQVAQQQ	107	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214	ms_run[1]:scan=5713	34.503190000000004	2	1564.794535	1564.796720	R	-	1900	1913
PSM	VTGAALIPPPGGTSLTSLGQAAQ	108	sp|Q9BU61|NDUF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:214	ms_run[1]:scan=18830	93.64282333333333	3	2250.231796	2250.234147	R	-	162	185
PSM	ADPSIVQALSLYDGLV	109	sp|P62166-2|NCS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=27399	138.47	2	1803.974	1803.9740	K	-	157	173
PSM	DVNFEFPEFQL	110	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=25571	127.12	2	1527.7367	1527.7367	K	-	184	195
PSM	FGPFCDPQSTDVISSTQSS	111	sp|Q6VMQ6-5|MCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,5-UNIMOD:4	ms_run[2]:scan=16697	84.145	3	2202.9861	2202.9861	R	-	1251	1270
PSM	GNLQLLQNCLAVLNGDT	112	sp|Q9UNH7-2|SNX6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=23640	116.22	3	1986.0326	1986.0326	K	-	274	291
PSM	ILENSEDSSPECLF	113	sp|Q9NRZ9-6|HELLS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,12-UNIMOD:4	ms_run[2]:scan=19422	96.128	2	1782.8104	1782.8104	K	-	695	709
PSM	LETIQAQLDSLT	114	sp|Q9Y6G5|COMDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=21383	105.18	2	1474.8001	1474.8001	K	-	191	203
PSM	MLDQTLLDLNEM	115	sp|P06753-7|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,12-UNIMOD:35	ms_run[2]:scan=20757	102.12	2	1594.7704	1594.7704	R	-	147	159
PSM	MLDQTLLDLNEM	116	sp|P06753-7|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214,1-UNIMOD:35	ms_run[2]:scan=22080	108.38	2	1594.7704	1594.7704	R	-	147	159
PSM	NLLSLFEDTLDPT	117	sp|Q99640-4|PMYT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=29249	151.02	2	1620.8369	1620.8369	R	-	418	431
PSM	NNSNDIVNAIMELTM	118	sp|E9PAV3-2|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=28832	147.98	2	1821.8723	1821.8723	K	-	911	926
PSM	TIAPLVASGAVQLI	119	sp|Q9BRT9|SLD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=23253	114.19	2	1495.9096	1495.9096	K	-	210	224
PSM	VLTQMGSPLNPISSVS	120	sp|Q99717|SMAD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:214	ms_run[2]:scan=19378	95.95	2	1772.9464	1772.9464	K	-	450	466
PSM	MLDQTLLDLNEM	121	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:214	ms_run[1]:scan=24458	120.73876166666668	2	1578.772650	1578.775516	R	-	237	249
PSM	TPLPPELADVQA	122	sp|Q9Y5V0|ZN706_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:214	ms_run[1]:scan=16716	84.23270666666666	2	1393.755837	1393.757481	K	-	65	77
PSM	LELTTYLFGQDP	123	sp|Q99720|SGMR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	1-UNIMOD:214	ms_run[1]:scan=24496	120.95077666666666	2	1540.792779	1539.794261	R	-	212	224
PSM	VGQAGLQLLTSSD	124	sp|Q9Y2Z0|SGT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:214	ms_run[1]:scan=16362	82.74011333333333	2	1431.7670	1431.7686	R	P	117	130
PSM	ALLYLCGGDD	125	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=16149	81.807	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	126	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=16381	82.821	2	1239.5927	1239.5927	K	-	330	340
PSM	ISQTAPEWTAQAMEAQMAQ	127	sp|Q9BT78|CSN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=19148	94.963	3	2235.0422	2235.0422	K	-	388	407
PSM	LACGVIGIAQ	128	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=14298	73.693	2	1144.6396	1144.6396	R	-	145	155
PSM	LTNLSSNSDV	129	sp|Q13641|TPBG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=9116	51.04	2	1192.6057	1192.6057	R	-	411	421
PSM	MAMGNPSEFFVDVM	130	sp|Q92997-2|DVL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,1-UNIMOD:35	ms_run[2]:scan=24336	120.03	2	1733.7585	1733.7585	R	-	686	700
PSM	QWATSSLSWL	131	sp|O43929-2|ORC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=23332	114.59	2	1321.6788	1321.6788	R	-	343	353
PSM	TLLEQLDDDQ	132	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214	ms_run[2]:scan=16569	83.622	2	1332.6531	1332.6531	R	-	921	931
PSM	TPLPPELADVQA	133	sp|Q9Y5V0|ZN706_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214	ms_run[1]:scan=16464	83.17498	2	1393.755837	1393.757481	K	-	65	77
PSM	NGVDLGPICGPPNGII	134	sp|Q14671|PUM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214,9-UNIMOD:4	ms_run[1]:scan=20906	102.86115833333334	2	1736.887136	1735.904891	K	-	1171	1187
PSM	QNPFPPLSTVC	135	sp|Q5JVF3|PCID2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214,11-UNIMOD:4	ms_run[1]:scan=15385	78.453925	2	1402.703407	1402.703672	K	-	389	400
PSM	LPQPPEGQTYNN	136	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214	ms_run[1]:scan=8401	47.74458666666666	2	1500.731710	1500.733057	K	-	134	146
PSM	ILSTMDSPST	137	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:214	ms_run[1]:scan=10874	58.822005000000004	2	1194.589964	1194.592390	R	-	2337	2347
PSM	AALEAVGGTVVLE	138	sp|P52815|RM12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=16681	84.062	2	1371.7731	1371.7731	K	-	186	199
PSM	AAVPAPPPEPEGQDPPAPSQDTS	139	sp|Q96IK1|BOD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=8502	48.212	3	2398.141	2398.1410	K	-	163	186
PSM	ALLALCGGED	140	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=14367	73.988	2	1161.5822	1161.5822	K	-	632	642
PSM	ALLLLCGEDD	141	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=18372	91.544	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLLLCGEDD	142	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=18598	92.624	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLLLCGEDD	143	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=18829	93.641	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLLLCGEDD	144	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=29108	149.96	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLLLCGEDD	145	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=29251	151.03	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLYLCGGDD	146	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=15905	80.739	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	147	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=16640	83.899	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	148	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=29061	149.59	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	149	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=30128	157.28	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	150	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=30386	159.3	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	151	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=29587	153.18	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	152	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=29993	156.24	2	1239.5927	1239.5927	K	-	330	340
PSM	AVGLQPAGDVNLP	153	sp|O95229-2|ZWINT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=15208	77.658	2	1393.7687	1393.7687	K	-	218	231
PSM	DPGMGAMGGMGGGMGGGMF	154	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,7-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=14618	75.066	3	1849.7048	1849.7048	K	-	555	574
PSM	EIVTNFLAGFEA	155	sp|P25705-2|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=25403	126.14	2	1453.7575	1453.7575	K	-	492	504
PSM	ELIEIISGAAALD	156	sp|P36542|ATPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=25545	126.98	2	1457.8099	1457.8099	K	-	286	299
PSM	GADPGMPEPTVLSLLWG	157	sp|Q9P0U1|TOM7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=28510	145.75	2	1882.9621	1882.9621	R	-	39	56
PSM	IDFDSVSSIMASSQ	158	sp|Q9UBQ5|EIF3K_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=21089	103.76	2	1629.7678	1629.7678	K	-	205	219
PSM	ITIADCGQLE	159	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=12416	65.622	2	1262.6298	1262.6298	K	-	96	106
PSM	LVNIVTENCS	160	sp|Q8N6M0-2|OTU6B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=12825	67.384	2	1291.6564	1291.6564	R	-	183	193
PSM	MELLMSALSPCLL	161	sp|Q9NVC6|MED17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,1-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=25324	125.67	2	1636.836	1636.8360	K	-	639	652
PSM	MLDQTLLDLNEM	162	sp|P06753-7|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=18012	89.944	2	1610.7653	1610.7653	R	-	147	159
PSM	MLDQTLLDLNEM	163	sp|P06753-7|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,12-UNIMOD:35	ms_run[2]:scan=20966	103.16	2	1594.7704	1594.7704	R	-	147	159
PSM	VLLVLCGGDD	164	sp|P09525-2|ANXA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=18103	90.309	2	1203.6291	1203.6291	K	-	228	238
PSM	VPSPLEGSEGDGDTD	165	sp|Q9Y606-2|TRUA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=9412	52.393	2	1617.7128	1617.7128	K	-	385	400
PSM	QNPFPPLSTVC	166	sp|Q5JVF3|PCID2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:214,11-UNIMOD:4	ms_run[1]:scan=15132	77.32379499999999	2	1402.703407	1402.703672	K	-	389	400
PSM	ILGDFEDSCC	167	sp|Q05DH4|F16A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:214,9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=14992	76.74468666666667	2	1358.560848	1358.560438	K	-	1031	1041
PSM	AGGANYDAQTE	168	sp|Q14019|COTL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=2025	14.585	2	1239.5489	1239.5489	K	-	132	143
PSM	AGMSNPALTMENET	169	sp|Q9UIJ5|ZDHC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=11648	62.257	2	1608.7245	1608.7245	K	-	354	368
PSM	ALLLLCGEDD	170	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=19090	94.695	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLLLCGEDD	171	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=29643	153.59	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLLLCGEDD	172	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=29929	155.75	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLLLCGEDD	173	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=30068	156.83	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLLLCGEDD	174	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=28449	145.33	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLYLCGGDD	175	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=28775	147.55	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	176	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=28917	148.57	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	177	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=29726	154.2	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	178	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=29862	155.23	2	1239.5927	1239.5927	K	-	330	340
PSM	ALLYLCGGDD	179	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=30257	158.29	2	1239.5927	1239.5927	K	-	330	340
PSM	ASIYQNQNSS	180	sp|Q92785-2|REQU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=2911	19.481	2	1254.5962	1254.5962	K	-	198	208
PSM	IDFDSVSSIMASSQ	181	sp|Q9UBQ5|EIF3K_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=21136	103.98	3	1629.7678	1629.7678	K	-	205	219
PSM	LPVVISQCGEM	182	sp|O43447-2|PPIH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,8-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=13185	68.891	2	1391.6911	1391.6911	K	-	124	135
PSM	LPVVISQCGEM	183	sp|O43447-2|PPIH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,8-UNIMOD:4	ms_run[2]:scan=17390	87.163	2	1375.6961	1375.6961	K	-	124	135
PSM	MELLMSALSPCLL	184	sp|Q9NVC6|MED17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214,11-UNIMOD:4	ms_run[2]:scan=28214	143.71	2	1620.8411	1620.8411	K	-	639	652
PSM	VALILQNVDLPN	185	sp|Q04446|GLGB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:214	ms_run[2]:scan=21528	105.86	2	1451.847	1451.8470	R	-	691	703
PSM	TPLPPELADVQA	186	sp|Q9Y5V0|ZN706_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:214	ms_run[1]:scan=16963	85.28739166666666	2	1393.755837	1393.757481	K	-	65	77
PSM	LPQPPEGQTYNN	187	sp|Q15819|UB2V2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:214	ms_run[1]:scan=8617	48.75036666666667	2	1500.731710	1500.733057	K	-	134	146
PSM	EALQDVEDENQ	188	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:27	ms_run[1]:scan=7073	41.492945	2	1414.6314	1414.6329	K	-	245	256
PSM	MGGGGAMNMGD	189	sp|P23246|SFPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:214	ms_run[1]:scan=6540	39.06026166666666	2	1140.4468	1140.4479	R	P	612	623
PSM	TALINFLVQD	190	sp|Q15031|SYLM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:214	ms_run[1]:scan=23103	113.411625	2	1277.731387	1276.714888	R	-	894	904
PSM	ALLLLCGEDD	191	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=28282	144.18	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLLLCGEDD	192	sp|P08758|ANXA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=28015	142.44	2	1261.6346	1261.6346	K	-	311	321
PSM	ALLYLCGGDD	193	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=28293	144.25	2	1239.5927	1239.5927	K	-	330	340
PSM	IFDPQNPDENE	194	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=10076	55.337	2	1460.6541	1460.6541	K	-	293	304
PSM	ILDTADENGLLSLPN	195	sp|Q96DZ1-2|ERLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=21075	103.66	2	1727.9063	1727.9063	K	-	415	430
PSM	ILVALCGGN	196	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=15322	78.193	2	1059.5868	1059.5869	K	-	338	347
PSM	ILVALCGGN	197	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=28887	148.36	2	1059.5868	1059.5869	K	-	338	347
PSM	INSIEIAPCLL	198	sp|Q7Z2W9-2|RM21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=22301	109.42	2	1385.771	1385.7710	R	-	110	121
PSM	LQALVNSLCAGQSP	199	sp|Q6XQN6-3|PNCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=20004	98.761	3	1600.8365	1600.8365	R	-	512	526
PSM	LVAASQAALGL	200	sp|P02768-3|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=18017	89.955	2	1156.6938	1156.6938	K	-	386	397
PSM	VCNICFDVLTLGGVS	201	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=24652	121.84	2	1796.8923	1796.8923	R	-	1155	1170
PSM	VLAIAQNFV	202	sp|Q6P1L8|RM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=21906	107.63	2	1117.6617	1117.6617	K	-	137	146
PSM	VSAIVEQSWNDS	203	sp|P63146|UBE2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=14883	76.262	2	1477.7171	1477.7171	R	-	141	153
PSM	VSPYDPIGLPMVP	204	sp|Q8IV63-3|VRK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214	ms_run[2]:scan=24022	118.28	2	1527.8129	1527.8129	R	-	412	425
PSM	TGLFPGSFVENI	205	sp|Q7Z6J0|SH3R1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=23431	115.10191999999999	2	1423.746767	1423.746916	K	-	877	889
PSM	LLDQQNPDEDFS	206	sp|P46108|CRK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=12977	68.01859	2	1563.717876	1563.717467	R	-	293	305
PSM	LGGSLIVAFEGCPV	207	sp|P60981|DEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214,12-UNIMOD:4	ms_run[1]:scan=23828	117.25849833333334	2	1561.829080	1561.829601	K	-	152	166
PSM	ELEELLLEASQESGQETL	208	sp|O75864|PPR37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=26084	130.24137666666667	3	2161.074578	2161.075975	K	-	674	692
PSM	VCDACFNDLQG	209	sp|Q15075|EEA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214,2-UNIMOD:4,5-UNIMOD:4	ms_run[1]:scan=11397	61.18210666666666	2	1441.605770	1441.608785	R	-	1401	1412
PSM	MEFSGGGLLL	210	sp|Q5J8M3|EMC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214,1-UNIMOD:35	ms_run[1]:scan=18586	92.53658	2	1182.609245	1182.607646	R	-	174	184
PSM	GLYSIEVLELF	211	sp|Q9H8H0|NOL11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:214	ms_run[1]:scan=28752	147.373185	2	1425.786619	1425.787719	R	-	709	720
PSM	ALEAELNDLM	212	sp|Q9Y5B0|CTDP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=21804	107.14	2	1261.6346	1261.6346	K	-	952	962
PSM	CLENLVQLLNSS	213	sp|Q86VV8|RTTN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,1-UNIMOD:4	ms_run[2]:scan=25088	124.31	2	1532.799	1532.7990	K	-	2215	2227
PSM	GIPNMLLSEEETES	214	sp|Q9UI30-2|TR112_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=18057	90.127	3	1691.8046	1691.8046	R	-	107	121
PSM	IASNAGSIA	215	sp|P62829|RL23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=5927	35.701	2	946.52054	946.5205	R	-	132	141
PSM	ILVALCGGN	216	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=15558	79.212	2	1059.5868	1059.5869	K	-	338	347
PSM	ILVALCGGN	217	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=15794	80.276	2	1059.5868	1059.5869	K	-	338	347
PSM	INFNNYYQDA	218	sp|Q96RT7-2|GCP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=14928	76.465	2	1404.6432	1404.6432	R	-	1776	1786
PSM	INPETVNLSI	219	sp|Q8TCG1-2|CIP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=17235	86.524	2	1242.6942	1242.6942	K	-	737	747
PSM	LACGVIGIAQ	220	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=14446	74.341	2	1144.6396	1144.6396	R	-	145	155
PSM	LPQPPEGQCYSN	221	sp|Q13404-6|UB2V1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=8607	48.696	2	1532.7051	1532.7051	K	-	92	104
PSM	NAQPLLLVGPEGAEA	222	sp|Q6ZMU5|TRI72_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=17033	85.566	2	1621.8797	1621.8797	K	-	463	478
PSM	QLLMLQSLE	223	sp|P53680-2|AP2S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214,4-UNIMOD:35	ms_run[2]:scan=17865	89.284	2	1233.6761	1233.6761	K	-	96	105
PSM	QLLMLQSLE	224	sp|P53680-2|AP2S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=21151	104.06	2	1217.6811	1217.6811	K	-	96	105
PSM	VALILQNVDLPN	225	sp|Q04446|GLGB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=21551	105.96	3	1451.847	1451.8470	R	-	691	703
PSM	VPITYLELLN	226	sp|Q9Y371-3|SHLB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=24266	119.65	2	1317.7666	1317.7666	K	-	256	266
PSM	VWGNVGTVEWAD	227	sp|O60506-3|HNRPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:214	ms_run[1]:scan=19000	94.336085	2	1475.7152	1475.7162	K	P	313	325
PSM	LACGVIGIAQ	228	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:214,3-UNIMOD:4	ms_run[1]:scan=15390	78.46374333333334	2	1144.638251	1144.639615	R	-	145	155
PSM	AAAGACTPPCT	229	sp|Q3KNT7-3|NSN5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:214,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=2862	19.23074666666667	2	1219.540823	1219.544728	R	-	144	155