MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	mHCT116_iTRAQ_JPST000205
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190823\20190823215055952307^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_CH_1\120307_mHCT116_iTRAQ_03.HCD.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190823\20190823215055952307^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\120307_mHCT116_iTRAQ_03.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[1]-setting	variableModifications=iTRAQ4plex (Y),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[2]-setting	IT_MODS=Oxidation (M),iTRAQ4plex (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=5
MTD	software[2]-setting	ITOLU=ppm
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C),iTRAQ4plex (K),iTRAQ4plex (N-term)
MTD	software[3]-setting	VarMod=iTRAQ4plex (Y),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=0.02
MTD	software[3]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	fixed_mod[2]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	fixed_mod[2]-site	K
MTD	fixed_mod[2]-position	Anywhere
MTD	fixed_mod[3]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	fixed_mod[3]-site	N-term
MTD	fixed_mod[3]-position	Any N-term
MTD	variable_mod[1]	[UNIMOD, UNIMOD:214, iTRAQ4plex,]
MTD	variable_mod[1]-site	Y
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P54105|ICLN_HUMAN	Methylosome subunit pICln OS=Homo sapiens OX=9606 GN=CLNS1A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	213-UNIMOD:214,218-UNIMOD:35	0.11	38.0	2	1	0
PRT	sp|Q15102|PA1B3_HUMAN	Platelet-activating factor acetylhydrolase IB subunit gamma OS=Homo sapiens OX=9606 GN=PAFAH1B3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	215-UNIMOD:214	0.08	31.0	2	1	0
PRT	sp|Q9Y570-2|PPME1_HUMAN	Isoform 2 of Protein phosphatase methylesterase 1 OS=Homo sapiens OX=9606 GN=PPME1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	185-UNIMOD:214,194-UNIMOD:4,199-UNIMOD:4	0.08	29.0	2	1	0
PRT	sp|P30044-4|PRDX5_HUMAN	Isoform 4 of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	103-UNIMOD:214,115-UNIMOD:4	0.19	27.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	555-UNIMOD:214,572-UNIMOD:35,558-UNIMOD:35,568-UNIMOD:35,564-UNIMOD:35,561-UNIMOD:35	0.03	27.0	7	1	0
PRT	sp|Q9Y4Y9-2|LSM5_HUMAN	Isoform 2 of U6 snRNA-associated Sm-like protein LSm5 OS=Homo sapiens OX=9606 GN=LSM5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	40-UNIMOD:214,52-UNIMOD:35	0.39	24.0	1	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	370-UNIMOD:214	0.04	23.0	1	1	1
PRT	sp|Q5SRD0|WAC2D_HUMAN	WASH complex subunit 2D OS=Homo sapiens OX=9606 GN=WASHC2D PE=3 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	294-UNIMOD:214	0.05	22.0	1	1	1
PRT	sp|Q14019|COTL1_HUMAN	Coactosin-like protein OS=Homo sapiens OX=9606 GN=COTL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	132-UNIMOD:214	0.08	21.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	691-UNIMOD:214	0.02	21.0	1	1	1
PRT	sp|Q9UBQ5|EIF3K_HUMAN	Eukaryotic translation initiation factor 3 subunit K OS=Homo sapiens OX=9606 GN=EIF3K PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	205-UNIMOD:214	0.07	20.0	1	1	1
PRT	sp|Q9HAU4|SMUF2_HUMAN	E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens OX=9606 GN=SMURF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	735-UNIMOD:214,743-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q9Y4Y9|LSM5_HUMAN	U6 snRNA-associated Sm-like protein LSm5 OS=Homo sapiens OX=9606 GN=LSM5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	69-UNIMOD:214	0.26	20.0	1	1	0
PRT	sp|Q86UD0|SAPC2_HUMAN	Suppressor APC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SAPCD2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	380-UNIMOD:214	0.04	20.0	1	1	1
PRT	sp|Q9BU61|NDUF3_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 3 OS=Homo sapiens OX=9606 GN=NDUFAF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	162-UNIMOD:214	0.13	20.0	1	1	1
PRT	sp|Q9P0V3-2|SH3B4_HUMAN	Isoform 2 of SH3 domain-binding protein 4 OS=Homo sapiens OX=9606 GN=SH3BP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	539-UNIMOD:214	0.03	19.0	1	1	1
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	1293-UNIMOD:214,1302-UNIMOD:4	0.01	19.0	1	1	1
PRT	sp|Q15038-4|DAZP2_HUMAN	Isoform 4 of DAZ-associated protein 2 OS=Homo sapiens OX=9606 GN=DAZAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	72-UNIMOD:214	0.19	19.0	1	1	1
PRT	sp|Q9Y5Y2|NUBP2_HUMAN	Cytosolic Fe-S cluster assembly factor NUBP2 OS=Homo sapiens OX=9606 GN=NUBP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	262-UNIMOD:214,269-UNIMOD:4	0.04	19.0	2	1	0
PRT	sp|Q7Z2W9-2|RM21_HUMAN	Isoform 2 of 39S ribosomal protein L21, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	110-UNIMOD:214,118-UNIMOD:4	0.10	19.0	2	1	0
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	96-UNIMOD:214,101-UNIMOD:4	0.10	19.0	1	1	1
PRT	sp|P00441|SODC_HUMAN	Superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	145-UNIMOD:214,147-UNIMOD:4	0.07	19.0	36	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	19.0	null	610-UNIMOD:214,621-UNIMOD:35,617-UNIMOD:35	0.06	19.0	3	1	0
PRT	sp|Q6ZMU5|TRI72_HUMAN	Tripartite motif-containing protein 72 OS=Homo sapiens OX=9606 GN=TRIM72 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	463-UNIMOD:214	0.03	19.0	1	1	1
PRT	sp|E9PAV3-2|NACAM_HUMAN	Isoform skNAC-2 of Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	911-UNIMOD:214,925-UNIMOD:35	0.02	19.0	1	1	1
PRT	sp|Q8TB72-2|PUM2_HUMAN	Isoform 2 of Pumilio homolog 2 OS=Homo sapiens OX=9606 GN=PUM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	972-UNIMOD:214	0.02	19.0	1	1	1
PRT	sp|Q96GZ6-5|S41A3_HUMAN	Isoform 5 of Solute carrier family 41 member 3 OS=Homo sapiens OX=9606 GN=SLC41A3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	465-UNIMOD:214	0.03	19.0	1	1	1
PRT	sp|Q13546|RIPK1_HUMAN	Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=RIPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	659-UNIMOD:214	0.02	19.0	1	1	1
PRT	sp|O60762|DPM1_HUMAN	Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=DPM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	252-UNIMOD:214	0.04	18.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	338-UNIMOD:214,343-UNIMOD:4	0.03	18.0	3	1	0
PRT	sp|Q99436|PSB7_HUMAN	Proteasome subunit beta type-7 OS=Homo sapiens OX=9606 GN=PSMB7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	18.0	null	259-UNIMOD:214,274-UNIMOD:35	0.07	18.0	5	1	0
PRT	sp|O43447-2|PPIH_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase H OS=Homo sapiens OX=9606 GN=PPIH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	124-UNIMOD:214,131-UNIMOD:4,134-UNIMOD:35	0.09	18.0	3	1	0
PRT	sp|Q14671-4|PUM1_HUMAN	Isoform 4 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	1112-UNIMOD:214,1120-UNIMOD:4	0.02	18.0	1	1	1
PRT	sp|O15127|SCAM2_HUMAN	Secretory carrier-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=SCAMP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	317-UNIMOD:214	0.04	18.0	1	1	1
PRT	sp|P16989|YBOX3_HUMAN	Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	354-UNIMOD:214	0.05	18.0	1	1	1
PRT	sp|P36542|ATPG_HUMAN	ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	286-UNIMOD:214	0.05	17.0	1	1	1
PRT	sp|Q8IVD9|NUDC3_HUMAN	NudC domain-containing protein 3 OS=Homo sapiens OX=9606 GN=NUDCD3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	347-UNIMOD:214	0.04	17.0	1	1	1
PRT	sp|Q9UNH7-2|SNX6_HUMAN	Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	274-UNIMOD:214,282-UNIMOD:4	0.06	17.0	2	1	0
PRT	sp|Q9NRZ9-6|HELLS_HUMAN	Isoform 6 of Lymphoid-specific helicase OS=Homo sapiens OX=9606 GN=HELLS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	695-UNIMOD:214,706-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|P42224|STAT1_HUMAN	Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	737-UNIMOD:214	0.02	17.0	1	1	1
PRT	sp|Q96PU5-9|NED4L_HUMAN	Isoform 8 of E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	820-UNIMOD:214	0.02	17.0	1	1	0
PRT	sp|Q9Y619|ORNT1_HUMAN	Mitochondrial ornithine transporter 1 OS=Homo sapiens OX=9606 GN=SLC25A15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	293-UNIMOD:214	0.03	17.0	1	1	1
PRT	sp|P55809-2|SCOT1_HUMAN	Isoform 2 of Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=OXCT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	115-UNIMOD:214	0.08	17.0	1	1	1
PRT	sp|Q96PV6|LENG8_HUMAN	Leukocyte receptor cluster member 8 OS=Homo sapiens OX=9606 GN=LENG8 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	792-UNIMOD:214	0.01	17.0	1	1	1
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	688-UNIMOD:214,691-UNIMOD:35	0.01	17.0	2	1	0
PRT	sp|P06753-7|TPM3_HUMAN	Isoform 7 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	147-UNIMOD:214,158-UNIMOD:35,147-UNIMOD:35	0.08	17.0	4	1	0
PRT	sp|P53680-2|AP2S1_HUMAN	Isoform 2 of AP-2 complex subunit sigma OS=Homo sapiens OX=9606 GN=AP2S1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	96-UNIMOD:214,99-UNIMOD:35	0.10	17.0	2	1	0
PRT	sp|Q86UX6-2|ST32C_HUMAN	Isoform 2 of Serine/threonine-protein kinase 32C OS=Homo sapiens OX=9606 GN=STK32C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	354-UNIMOD:214,359-UNIMOD:4,363-UNIMOD:4	0.05	17.0	1	1	1
PRT	sp|Q99717|SMAD5_HUMAN	Mothers against decapentaplegic homolog 5 OS=Homo sapiens OX=9606 GN=SMAD5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17.0	null	450-UNIMOD:214,454-UNIMOD:35	0.04	17.0	2	1	0
PRT	sp|Q5BKZ1|ZN326_HUMAN	DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1,12-UNIMOD:4	0.02	17.0	1	1	1
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	446-UNIMOD:214	0.03	17.0	1	1	1
PRT	sp|Q9Y5B0|CTDP1_HUMAN	RNA polymerase II subunit A C-terminal domain phosphatase OS=Homo sapiens OX=9606 GN=CTDP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	952-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|Q9BRP8-2|PYM1_HUMAN	Isoform 2 of Partner of Y14 and mago OS=Homo sapiens OX=9606 GN=PYM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	191-UNIMOD:214	0.07	16.0	1	1	1
PRT	sp|Q96R06|SPAG5_HUMAN	Sperm-associated antigen 5 OS=Homo sapiens OX=9606 GN=SPAG5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	1184-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|O96008|TOM40_HUMAN	Mitochondrial import receptor subunit TOM40 homolog OS=Homo sapiens OX=9606 GN=TOMM40 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	352-UNIMOD:214,354-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|P22670|RFX1_HUMAN	MHC class II regulatory factor RFX1 OS=Homo sapiens OX=9606 GN=RFX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	970-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|Q8NEM2|SHCBP_HUMAN	SHC SH2 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SHCBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	665-UNIMOD:214	0.01	16.0	1	1	1
PRT	sp|P61421|VA0D1_HUMAN	V-type proton ATPase subunit d 1 OS=Homo sapiens OX=9606 GN=ATP6V0D1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	344-UNIMOD:214	0.03	16.0	1	1	1
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	470-UNIMOD:214,471-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|O75385|ULK1_HUMAN	Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	1041-UNIMOD:214,1049-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|Q8N6M0-2|OTU6B_HUMAN	Isoform 2 of Deubiquitinase OTUD6B OS=Homo sapiens OX=9606 GN=OTUD6B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	183-UNIMOD:214,191-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|Q5J8M3|EMC4_HUMAN	ER membrane protein complex subunit 4 OS=Homo sapiens OX=9606 GN=EMC4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	16.0	null	174-UNIMOD:214,174-UNIMOD:35	0.06	16.0	2	1	0
PRT	sp|O15145|ARPC3_HUMAN	Actin-related protein 2/3 complex subunit 3 OS=Homo sapiens OX=9606 GN=ARPC3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	16.0	null	172-UNIMOD:214	0.04	16.0	2	1	0
PRT	sp|P46776|RL27A_HUMAN	60S ribosomal protein L27a OS=Homo sapiens OX=9606 GN=RPL27A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	139-UNIMOD:214,144-UNIMOD:4	0.07	16.0	1	1	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	1155-UNIMOD:214,1156-UNIMOD:4,1159-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|Q9Y371-3|SHLB1_HUMAN	Isoform 3 of Endophilin-B1 OS=Homo sapiens OX=9606 GN=SH3GLB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16.0	null	256-UNIMOD:214	0.04	16.0	1	1	1
PRT	sp|Q96PU5|NED4L_HUMAN	E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	961-UNIMOD:214	0.02	16.0	1	1	0
PRT	sp|Q9Y2Z0|SGT1_HUMAN	Protein SGT1 homolog OS=Homo sapiens OX=9606 GN=SUGT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16.0	null	117-UNIMOD:214	0.04	16.0	1	1	1
PRT	sp|P06753-2|TPM3_HUMAN	Isoform 2 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	237-UNIMOD:214	0.05	16.0	1	1	0
PRT	sp|P78356|PI42B_HUMAN	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	407-UNIMOD:214	0.03	16.0	1	1	1
PRT	sp|Q99720|SGMR1_HUMAN	Sigma non-opioid intracellular receptor 1 OS=Homo sapiens OX=9606 GN=SIGMAR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	212-UNIMOD:214	0.06	16.0	1	1	1
PRT	sp|O75319|DUS11_HUMAN	RNA/RNP complex-1-interacting phosphatase OS=Homo sapiens OX=9606 GN=DUSP11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	367-UNIMOD:214,372-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q9BY32-3|ITPA_HUMAN	Isoform 3 of Inosine triphosphate pyrophosphatase OS=Homo sapiens OX=9606 GN=ITPA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	140-UNIMOD:214	0.10	15.0	1	1	1
PRT	sp|Q9BYD2|RM09_HUMAN	39S ribosomal protein L9, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	259-UNIMOD:214	0.04	15.0	1	1	1
PRT	sp|O95229-2|ZWINT_HUMAN	Isoform 2 of ZW10 interactor OS=Homo sapiens OX=9606 GN=ZWINT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	218-UNIMOD:214	0.06	15.0	1	1	1
PRT	sp|P62829|RL23_HUMAN	60S ribosomal protein L23 OS=Homo sapiens OX=9606 GN=RPL23 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	15.0	null	132-UNIMOD:214	0.07	15.0	4	1	0
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	580-UNIMOD:214	0.01	15.0	1	1	1
PRT	sp|P30046|DOPD_HUMAN	D-dopachrome decarboxylase OS=Homo sapiens OX=9606 GN=DDT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	111-UNIMOD:214	0.08	15.0	2	1	0
PRT	sp|Q5W111-2|SPRY7_HUMAN	Isoform 2 of SPRY domain-containing protein 7 OS=Homo sapiens OX=9606 GN=SPRYD7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	150-UNIMOD:214	0.06	15.0	1	1	1
PRT	sp|P10599-2|THIO_HUMAN	Isoform 2 of Thioredoxin OS=Homo sapiens OX=9606 GN=TXN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	77-UNIMOD:214	0.12	15.0	1	1	0
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	440-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|Q05932-3|FOLC_HUMAN	Isoform 3 of Folylpolyglutamate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=FPGS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	530-UNIMOD:214	0.02	15.0	1	1	1
PRT	sp|O75712|CXB3_HUMAN	Gap junction beta-3 protein OS=Homo sapiens OX=9606 GN=GJB3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	260-UNIMOD:214	0.04	15.0	1	1	1
PRT	sp|P02768-3|ALBU_HUMAN	Isoform 3 of Serum albumin OS=Homo sapiens OX=9606 GN=ALB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	386-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|A6NDG6|PGP_HUMAN	Glycerol-3-phosphate phosphatase OS=Homo sapiens OX=9606 GN=PGP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	303-UNIMOD:214,303-UNIMOD:35	0.06	15.0	1	1	1
PRT	sp|Q99640-4|PMYT1_HUMAN	Isoform 4 of Membrane-associated tyrosine- and threonine-specific cdc2-inhibitory kinase OS=Homo sapiens OX=9606 GN=PKMYT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	418-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|Q8IZ52-2|CHSS2_HUMAN	Isoform 2 of Chondroitin sulfate synthase 2 OS=Homo sapiens OX=9606 GN=CHPF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	300-UNIMOD:214	0.05	15.0	2	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	4089-UNIMOD:214,4097-UNIMOD:35	0.00	15.0	1	1	1
PRT	sp|O43301|HS12A_HUMAN	Heat shock 70 kDa protein 12A OS=Homo sapiens OX=9606 GN=HSPA12A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	668-UNIMOD:214	0.01	15.0	1	1	1
PRT	sp|Q6P1L8|RM14_HUMAN	39S ribosomal protein L14, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL14 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	137-UNIMOD:214	0.07	15.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15.0	null	379-UNIMOD:214	0.03	15.0	1	1	1
PRT	sp|Q5JVF3|PCID2_HUMAN	PCI domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PCID2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	389-UNIMOD:214,399-UNIMOD:4	0.03	15.0	1	1	1
PRT	sp|Q15366|PCBP2_HUMAN	Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	355-UNIMOD:214,362-UNIMOD:35	0.03	15.0	1	1	1
PRT	sp|P52735|VAV2_HUMAN	Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	864-UNIMOD:214	0.02	15.0	1	1	1
PRT	sp|Q3KNT7-3|NSN5B_HUMAN	Isoform 3 of Putative NOL1/NOP2/Sun domain family member 5B OS=Homo sapiens OX=9606 GN=NSUN5P1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15.0	null	144-UNIMOD:214,149-UNIMOD:4,153-UNIMOD:4	0.08	15.0	1	1	1
PRT	sp|P52815|RM12_HUMAN	39S ribosomal protein L12, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	186-UNIMOD:214	0.07	14.0	1	1	1
PRT	sp|P82921|RT21_HUMAN	28S ribosomal protein S21, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS21 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	81-UNIMOD:214,87-UNIMOD:4	0.09	14.0	1	1	1
PRT	sp|P52655|TF2AA_HUMAN	Transcription initiation factor IIA subunit 1 OS=Homo sapiens OX=9606 GN=GTF2A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	370-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|P08758|ANXA5_HUMAN	Annexin A5 OS=Homo sapiens OX=9606 GN=ANXA5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	311-UNIMOD:214,316-UNIMOD:4	0.03	14.0	1	1	1
PRT	sp|Q86VV8|RTTN_HUMAN	Rotatin OS=Homo sapiens OX=9606 GN=RTTN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	2215-UNIMOD:214,2215-UNIMOD:4	0.01	14.0	1	1	1
PRT	sp|P25705-2|ATPA_HUMAN	Isoform 2 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	492-UNIMOD:214	0.03	14.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	752-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|P21964-2|COMT_HUMAN	Isoform Soluble of Catechol O-methyltransferase OS=Homo sapiens OX=9606 GN=COMT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	214-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|P46109|CRKL_HUMAN	Crk-like protein OS=Homo sapiens OX=9606 GN=CRKL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	293-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|Q86XL3-3|ANKL2_HUMAN	Isoform 3 of Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	287-UNIMOD:214	0.03	14.0	1	1	1
PRT	sp|Q9Y6G5|COMDA_HUMAN	COMM domain-containing protein 10 OS=Homo sapiens OX=9606 GN=COMMD10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	191-UNIMOD:214	0.06	14.0	1	1	1
PRT	sp|P41440-2|S19A1_HUMAN	Isoform 2 of Folate transporter 1 OS=Homo sapiens OX=9606 GN=SLC19A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	536-UNIMOD:214,540-UNIMOD:4	0.03	14.0	2	1	0
PRT	sp|O43795-2|MYO1B_HUMAN	Isoform 2 of Unconventional myosin-Ib OS=Homo sapiens OX=9606 GN=MYO1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	1072-UNIMOD:214	0.01	14.0	1	1	1
PRT	sp|P84074|HPCA_HUMAN	Neuron-specific calcium-binding protein hippocalcin OS=Homo sapiens OX=9606 GN=HPCA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	182-UNIMOD:214,185-UNIMOD:4	0.07	14.0	1	1	1
PRT	sp|O00308-3|WWP2_HUMAN	Isoform 3 of NEDD4-like E3 ubiquitin-protein ligase WWP2 OS=Homo sapiens OX=9606 GN=WWP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	418-UNIMOD:214	0.03	14.0	1	1	1
PRT	sp|O95985|TOP3B_HUMAN	DNA topoisomerase 3-beta-1 OS=Homo sapiens OX=9606 GN=TOP3B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	854-UNIMOD:214	0.01	14.0	1	1	1
PRT	sp|P23743|DGKA_HUMAN	Diacylglycerol kinase alpha OS=Homo sapiens OX=9606 GN=DGKA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	727-UNIMOD:214	0.01	14.0	1	1	1
PRT	sp|Q9BRT9|SLD5_HUMAN	DNA replication complex GINS protein SLD5 OS=Homo sapiens OX=9606 GN=GINS4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	210-UNIMOD:214	0.07	14.0	1	1	1
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	921-UNIMOD:214	0.01	14.0	1	1	1
PRT	sp|P25685-2|DNJB1_HUMAN	Isoform 2 of DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	232-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|Q13310-3|PABP4_HUMAN	Isoform 3 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	652-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|Q9Y277|VDAC3_HUMAN	Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens OX=9606 GN=VDAC3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	275-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|P63146|UBE2B_HUMAN	Ubiquitin-conjugating enzyme E2 B OS=Homo sapiens OX=9606 GN=UBE2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14.0	null	141-UNIMOD:214	0.09	14.0	1	1	1
PRT	sp|P60981|DEST_HUMAN	Destrin OS=Homo sapiens OX=9606 GN=DSTN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	152-UNIMOD:214,163-UNIMOD:4	0.09	14.0	1	1	1
PRT	sp|Q9NRM2|ZN277_HUMAN	Zinc finger protein 277 OS=Homo sapiens OX=9606 GN=ZNF277 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	441-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	97-UNIMOD:214	0.10	14.0	1	1	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	341-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|Q8WZ82|OVCA2_HUMAN	Esterase OVCA2 OS=Homo sapiens OX=9606 GN=OVCA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	221-UNIMOD:214	0.04	14.0	1	1	1
PRT	sp|Q53EU6|GPAT3_HUMAN	Glycerol-3-phosphate acyltransferase 3 OS=Homo sapiens OX=9606 GN=GPAT3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	426-UNIMOD:214	0.02	14.0	1	1	1
PRT	sp|Q13085|ACACA_HUMAN	Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	2337-UNIMOD:214	0.00	14.0	1	1	1
PRT	sp|Q8WV07|LTO1_HUMAN	Protein LTO1 homolog OS=Homo sapiens OX=9606 GN=LTO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	128-UNIMOD:214	0.08	14.0	1	1	1
PRT	sp|P52758|RIDA_HUMAN	2-iminobutanoate/2-iminopropanoate deaminase OS=Homo sapiens OX=9606 GN=RIDA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	14.0	null	121-UNIMOD:214	0.13	14.0	1	1	1
PRT	sp|Q9H0R1|AP5M1_HUMAN	AP-5 complex subunit mu-1 OS=Homo sapiens OX=9606 GN=AP5M1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	479-UNIMOD:214	0.03	14.0	1	1	1
PRT	sp|Q7Z4Q2|HEAT3_HUMAN	HEAT repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=HEATR3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	521-UNIMOD:214,529-UNIMOD:214	0.01	14.0	1	1	1
PRT	sp|B2RTY4-5|MYO9A_HUMAN	Isoform 5 of Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14.0	null	38-UNIMOD:214,50-UNIMOD:214	0.01	14.0	1	1	1
PRT	sp|P04424-3|ARLY_HUMAN	Isoform 3 of Argininosuccinate lyase OS=Homo sapiens OX=9606 GN=ASL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	431-UNIMOD:214	0.02	13.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	330-UNIMOD:214,335-UNIMOD:4	0.03	13.0	1	1	1
PRT	sp|Q676U5-4|A16L1_HUMAN	Isoform 4 of Autophagy-related protein 16-1 OS=Homo sapiens OX=9606 GN=ATG16L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	422-UNIMOD:214	0.02	13.0	1	1	1
PRT	sp|P62081|RS7_HUMAN	40S ribosomal protein S7 OS=Homo sapiens OX=9606 GN=RPS7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	184-UNIMOD:214	0.06	13.0	1	1	1
PRT	sp|P40925-2|MDHC_HUMAN	Isoform 2 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	236-UNIMOD:214	0.04	13.0	1	1	1
PRT	sp|Q96BZ9|TBC20_HUMAN	TBC1 domain family member 20 OS=Homo sapiens OX=9606 GN=TBC1D20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	397-UNIMOD:214	0.02	13.0	1	1	1
PRT	sp|Q9UI30-2|TR112_HUMAN	Isoform 2 of Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens OX=9606 GN=TRMT112	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	107-UNIMOD:214	0.13	13.0	1	1	1
PRT	sp|O60506-5|HNRPQ_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens OX=9606 GN=SYNCRIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	401-UNIMOD:214	0.03	13.0	1	1	1
PRT	sp|Q8WUZ0|BCL7C_HUMAN	B-cell CLL/lymphoma 7 protein family member C OS=Homo sapiens OX=9606 GN=BCL7C PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	210-UNIMOD:214,211-UNIMOD:4	0.04	13.0	1	1	1
PRT	sp|Q96DZ1-2|ERLEC_HUMAN	Isoform 2 of Endoplasmic reticulum lectin 1 OS=Homo sapiens OX=9606 GN=ERLEC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	415-UNIMOD:214	0.04	13.0	1	1	1
PRT	sp|Q96RT7-2|GCP6_HUMAN	Isoform 2 of Gamma-tubulin complex component 6 OS=Homo sapiens OX=9606 GN=TUBGCP6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	1776-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|Q53FA7|QORX_HUMAN	Quinone oxidoreductase PIG3 OS=Homo sapiens OX=9606 GN=TP53I3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	326-UNIMOD:214	0.02	13.0	1	1	1
PRT	sp|Q15388|TOM20_HUMAN	Mitochondrial import receptor subunit TOM20 homolog OS=Homo sapiens OX=9606 GN=TOMM20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	133-UNIMOD:214	0.10	13.0	1	1	1
PRT	sp|Q92973-3|TNPO1_HUMAN	Isoform 3 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	842-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|Q96ME1-4|FXL18_HUMAN	Isoform 4 of F-box/LRR-repeat protein 18 OS=Homo sapiens OX=9606 GN=FBXL18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	709-UNIMOD:214	0.02	13.0	1	1	1
PRT	sp|Q5VT66-3|MARC1_HUMAN	Isoform 3 of Mitochondrial amidoxime-reducing component 1 OS=Homo sapiens OX=9606 GN=MARC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	243-UNIMOD:214	0.04	13.0	1	1	1
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	1035-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|Q9NYC9-2|DYH9_HUMAN	Isoform 2 of Dynein heavy chain 9, axonemal OS=Homo sapiens OX=9606 GN=DNAH9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13.0	null	648-UNIMOD:214,651-UNIMOD:35,657-UNIMOD:214	0.00	13.0	1	1	1
PRT	sp|P19404|NDUV2_HUMAN	NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	240-UNIMOD:214	0.04	13.0	1	1	1
PRT	sp|A8MTJ6|FOXI3_HUMAN	Forkhead box protein I3 OS=Homo sapiens OX=9606 GN=FOXI3 PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	257-UNIMOD:214,272-UNIMOD:214	0.04	13.0	1	1	1
PRT	sp|Q9H8H0|NOL11_HUMAN	Nucleolar protein 11 OS=Homo sapiens OX=9606 GN=NOL11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	709-UNIMOD:214	0.02	13.0	1	1	1
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	997-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|O00716|E2F3_HUMAN	Transcription factor E2F3 OS=Homo sapiens OX=9606 GN=E2F3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	456-UNIMOD:214,464-UNIMOD:4	0.02	13.0	1	1	1
PRT	sp|P98082|DAB2_HUMAN	Disabled homolog 2 OS=Homo sapiens OX=9606 GN=DAB2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	763-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|Q8WUH1|CHUR_HUMAN	Protein Churchill OS=Homo sapiens OX=9606 GN=CHURC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	134-UNIMOD:214	0.05	13.0	1	1	1
PRT	sp|Q05DH4|F16A1_HUMAN	Protein FAM160A1 OS=Homo sapiens OX=9606 GN=FAM160A1 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	1031-UNIMOD:214,1039-UNIMOD:4,1040-UNIMOD:4	0.01	13.0	1	1	1
PRT	sp|Q9HDC9|APMAP_HUMAN	Adipocyte plasma membrane-associated protein OS=Homo sapiens OX=9606 GN=APMAP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	411-UNIMOD:214	0.02	13.0	1	1	1
PRT	sp|P62633|CNBP_HUMAN	Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	170-UNIMOD:214,171-UNIMOD:4	0.05	13.0	1	1	1
PRT	sp|Q9NXF7|DCA16_HUMAN	DDB1- and CUL4-associated factor 16 OS=Homo sapiens OX=9606 GN=DCAF16 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	211-UNIMOD:214	0.03	13.0	1	1	1
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	448-UNIMOD:214	0.02	13.0	1	1	1
PRT	sp|Q9UBD5|ORC3_HUMAN	Origin recognition complex subunit 3 OS=Homo sapiens OX=9606 GN=ORC3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	706-UNIMOD:214,711-UNIMOD:4	0.01	13.0	1	1	1
PRT	sp|P35240|MERL_HUMAN	Merlin OS=Homo sapiens OX=9606 GN=NF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	589-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|Q9UGT4|SUSD2_HUMAN	Sushi domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SUSD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	13.0	null	446-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|Q9Y2Q9|RT28_HUMAN	28S ribosomal protein S28, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS28 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	59-UNIMOD:214,65-UNIMOD:214	0.04	13.0	1	1	1
PRT	sp|P50990|TCPQ_HUMAN	T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	1-UNIMOD:214,7-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|Q9ULM3|YETS2_HUMAN	YEATS domain-containing protein 2 OS=Homo sapiens OX=9606 GN=YEATS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	924-UNIMOD:214,930-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|Q9Y530|OARD1_HUMAN	O-acetyl-ADP-ribose deacetylase 1 OS=Homo sapiens OX=9606 GN=OARD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	120-UNIMOD:214,122-UNIMOD:4	0.05	13.0	1	1	1
PRT	sp|Q92747|ARC1A_HUMAN	Actin-related protein 2/3 complex subunit 1A OS=Homo sapiens OX=9606 GN=ARPC1A PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	168-UNIMOD:214,174-UNIMOD:214	0.02	13.0	1	1	1
PRT	sp|O60566|BUB1B_HUMAN	Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	1041-UNIMOD:214	0.01	13.0	1	1	1
PRT	sp|Q8WZ42|TITIN_HUMAN	Titin OS=Homo sapiens OX=9606 GN=TTN PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13.0	null	33484-UNIMOD:214	0.00	13.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	DYEDGMEVDTTPTVAGQFEDADVDH	1	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:214	ms_run[1]:scan=15871	80.586985	3	2899.204754	2899.209978	R	-	213	238
PSM	LLAQDQGQGAPLLEPAP	2	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:214	ms_run[2]:scan=17014	85.481	3	1861.0067	1861.0067	R	-	215	232
PSM	DYEDGMEVDTTPTVAGQFEDADVDH	3	sp|P54105|ICLN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,6-UNIMOD:35	ms_run[2]:scan=13531	70.389	3	2915.2049	2915.2049	R	-	213	238
PSM	FAEPIGGFQCVFPGC	4	sp|Q9Y570-2|PPME1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:214,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=22293	109.37	3	1828.8398	1828.8398	R	-	185	200
PSM	ALNVEPDGTGLTCSLAPNIISQL	5	sp|P30044-4|PRDX5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,13-UNIMOD:4	ms_run[2]:scan=24844	122.95	3	2526.3121	2526.3121	K	-	103	126
PSM	DPGMGAMGGMGGGMGGGMF	6	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:214,18-UNIMOD:35	ms_run[2]:scan=16771	84.446	3	1833.7098	1833.7098	K	-	555	574
PSM	FAEPIGGFQCVFPGC	7	sp|Q9Y570-2|PPME1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=22271	109.26	2	1828.8398	1828.8398	R	-	185	200
PSM	LLAQDQGQGAPLLEPAP	8	sp|Q15102|PA1B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:214	ms_run[2]:scan=16996	85.408	2	1861.0067	1861.0067	R	-	215	232
PSM	DPGMGAMGGMGGGMGGGMF	9	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,4-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=14628	75.107	3	1849.7048	1849.7048	K	-	555	574
PSM	LDQILLNGNNITMLVPGGEGPEV	10	sp|Q9Y4Y9-2|LSM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:214,13-UNIMOD:35	ms_run[2]:scan=25012	123.89	3	2552.3278	2552.3278	K	-	40	63
PSM	MFGSSVDLGNLGQ	11	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:214	ms_run[2]:scan=18361	91.472	2	1467.715	1467.7150	K	-	370	383
PSM	VSNIFDDPLNAFGGQ	12	sp|Q5SRD0|WAC2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:214	ms_run[2]:scan=24192	119.21	2	1736.8491	1736.8491	K	-	294	309
PSM	AGGANYDAQTE	13	sp|Q14019|COTL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214	ms_run[2]:scan=2032	14.614	2	1239.5489	1239.5489	K	-	132	143
PSM	VALILQNVDLPN	14	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:214	ms_run[2]:scan=21561	106	3	1451.847	1451.8470	R	-	691	703
PSM	IDFDSVSSIMASSQ	15	sp|Q9UBQ5|EIF3K_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214	ms_run[2]:scan=21099	103.79	2	1629.7678	1629.7678	K	-	205	219
PSM	LLTAIEETCGFAVE	16	sp|Q9HAU4|SMUF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=23264	114.25	2	1695.8511	1695.8511	K	-	735	749
PSM	LDQILLNGNNITMLVPGGEGPEV	17	sp|Q9Y4Y9|LSM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:214	ms_run[1]:scan=26089	130.26394666666667	3	2536.329023	2536.332875	K	-	69	92
PSM	ALSQQDGGPLDSTFI	18	sp|Q86UD0|SAPC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:214	ms_run[1]:scan=18743	93.25603833333334	2	1691.847926	1691.848815	R	-	380	395
PSM	VTGAALIPPPGGTSLTSLGQAAQ	19	sp|Q9BU61|NDUF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:214	ms_run[1]:scan=18840	93.67085	3	2250.231796	2250.234147	R	-	162	185
PSM	AAAFSPADQDDFVI	20	sp|Q9P0V3-2|SH3B4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=19787	97.698	2	1609.7746	1609.7746	R	-	539	553
PSM	DPGMGAMGGMGGGMGGGMF	21	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,10-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=14354	73.928	2	1849.7048	1849.7048	K	-	555	574
PSM	GFDPTASPFCQ	22	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,10-UNIMOD:4	ms_run[2]:scan=14394	74.105	2	1369.6094	1369.6094	K	-	1293	1304
PSM	GNFFMGGSDGGYTIW	23	sp|Q15038-4|DAZP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=24384	120.32	2	1751.7735	1751.7735	K	-	72	87
PSM	ILDATPACLP	24	sp|Q9Y5Y2|NUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,8-UNIMOD:4	ms_run[2]:scan=16629	83.861	2	1213.6498	1213.6498	K	-	262	272
PSM	INSIEIAPCLL	25	sp|Q7Z2W9-2|RM21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=22311	109.45	2	1385.771	1385.7710	R	-	110	121
PSM	ITIADCGQLE	26	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=12426	65.652	2	1262.6298	1262.6298	K	-	96	106
PSM	LACGVIGIAQ	27	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=14050	72.583	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	28	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=14308	73.719	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	29	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=14456	74.364	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	30	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=14561	74.827	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	31	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=14812	75.925	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	32	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=14192	73.188	3	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	33	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=27205	137.27	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	34	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=27367	138.27	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	35	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=28232	143.84	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	36	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=28537	145.92	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	37	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=28841	148.04	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	38	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=28988	149.05	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	39	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=29125	150.08	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	40	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=29265	151.13	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	41	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=29459	152.37	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	42	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=29608	153.32	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	43	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=29743	154.33	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	44	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=29876	155.34	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	45	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=30007	156.35	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	46	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=30141	157.38	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	47	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=30269	158.39	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	48	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=30397	159.39	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	49	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=27738	140.63	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	50	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=27901	141.7	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	51	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=28066	142.75	2	1144.6396	1144.6396	R	-	145	155
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	52	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=19427	96.143	3	3489.5939	3489.5939	K	-	610	647
PSM	NAQPLLLVGPEGAEA	53	sp|Q6ZMU5|TRI72_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=17043	85.622	2	1621.8797	1621.8797	K	-	463	478
PSM	NNSNDIVNAIMELTM	54	sp|E9PAV3-2|NACAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214,15-UNIMOD:35	ms_run[2]:scan=27223	137.37	2	1837.8672	1837.8672	K	-	911	926
PSM	NSPDLGPIGGPPNGML	55	sp|Q8TB72-2|PUM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:214	ms_run[2]:scan=17985	89.814	2	1678.847	1678.8470	K	-	972	988
PSM	AELGGISELASGPP	56	sp|Q96GZ6-5|S41A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:214	ms_run[1]:scan=16749	84.35481999999999	2	1440.755177	1440.758209	K	-	465	479
PSM	IDLLSSLIYVSQN	57	sp|Q13546|RIPK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:214	ms_run[1]:scan=26464	132.58080166666667	2	1607.886848	1607.889224	R	-	659	672
PSM	LACGVIGIAQ	58	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:214,3-UNIMOD:4	ms_run[1]:scan=27683	140.27488666666667	2	1146.640946	1144.639615	R	-	145	155
PSM	DPGMGAMGGMGGGMGGGMF	59	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=20263	99.915	2	1817.7149	1817.7149	K	-	555	574
PSM	GLLTLFATT	60	sp|O60762|DPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=24448	120.68	2	1079.6348	1079.6348	K	-	252	261
PSM	ILVALCGGN	61	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=15332	78.219	2	1059.5868	1059.5869	K	-	338	347
PSM	ITPLEIEVLEETVQTMDTS	62	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214	ms_run[2]:scan=28652	146.7	3	2291.1576	2291.1576	K	-	259	278
PSM	LPVVISQCGEM	63	sp|O43447-2|PPIH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214,8-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=13294	69.353	2	1391.6911	1391.6911	K	-	124	135
PSM	NGVDLGPICGPPNGII	64	sp|Q14671-4|PUM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=20248	99.856	2	1735.9049	1735.9049	K	-	1112	1128
PSM	DPGMGAMGGMGGGMGGGMF	65	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:214,18-UNIMOD:35	ms_run[1]:scan=16769	84.43691833333334	2	1833.704907	1833.709838	K	-	555	574
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	66	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:214,12-UNIMOD:35	ms_run[1]:scan=16974	85.319215	3	3505.581037	3505.588785	K	-	610	647
PSM	AASSAAQGAFQGN	67	sp|O15127|SCAM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:214	ms_run[1]:scan=4487	28.151635	2	1322.633132	1322.633678	R	-	317	330
PSM	AGEAPTENPAPPTQQSSAE	68	sp|P16989|YBOX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	1-UNIMOD:214	ms_run[1]:scan=4607	28.784438333333338	2	2024.938098	2024.940878	K	-	354	373
PSM	ELIEIISGAAALD	69	sp|P36542|ATPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=25555	127.02	2	1457.8099	1457.8099	K	-	286	299
PSM	FDPAMFNISPGAVQF	70	sp|Q8IVD9|NUDC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=25348	125.82	3	1783.8725	1783.8725	R	-	347	362
PSM	GNLQLLQNCLAVLNGDT	71	sp|Q9UNH7-2|SNX6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=23650	116.26	3	1986.0326	1986.0326	K	-	274	291
PSM	ILENSEDSSPECLF	72	sp|Q9NRZ9-6|HELLS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,12-UNIMOD:4	ms_run[2]:scan=19432	96.166	2	1782.8104	1782.8104	K	-	695	709
PSM	ILVALCGGN	73	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=15804	80.301	2	1059.5868	1059.5869	K	-	338	347
PSM	IVGSVEFDSMMNTV	74	sp|P42224|STAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=22528	110.51	2	1671.797	1671.7970	R	-	737	751
PSM	LLMAVENAQGFEGVD	75	sp|Q96PU5-9|NED4L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=21140	104	2	1735.8573	1735.8573	K	-	820	835
PSM	LMMNQLEAY	76	sp|Q9Y619|ORNT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=17568	87.936	2	1255.6063	1255.6063	K	-	293	302
PSM	LMPMQQIAN	77	sp|P55809-2|SCOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=13111	68.562	2	1188.6117	1188.6117	K	-	115	124
PSM	LSLAQLSAF	78	sp|Q96PV6|LENG8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=22380	109.79	2	1092.6301	1092.6301	R	-	792	801
PSM	LVQMEVLMN	79	sp|Q8N1F7-2|NUP93_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=19028	94.441	2	1219.6427	1219.6427	R	-	688	697
PSM	MLDQTLLDLNEM	80	sp|P06753-7|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,12-UNIMOD:35	ms_run[2]:scan=20767	102.15	2	1594.7704	1594.7704	R	-	147	159
PSM	QLLMLQSLE	81	sp|P53680-2|AP2S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,4-UNIMOD:35	ms_run[2]:scan=17875	89.309	2	1233.6761	1233.6761	K	-	96	105
PSM	QLLMLQSLE	82	sp|P53680-2|AP2S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214	ms_run[2]:scan=21161	104.09	2	1217.6811	1217.6811	K	-	96	105
PSM	SALPMCGPICPSAGSG	83	sp|Q86UX6-2|ST32C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,6-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=12844	67.459	2	1704.7755	1704.7755	R	-	354	370
PSM	VLTQMGSPLNPISSVS	84	sp|Q99717|SMAD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	17	1-UNIMOD:214,5-UNIMOD:35	ms_run[2]:scan=16123	81.678	2	1788.9413	1788.9413	K	-	450	466
PSM	DFEDDYTHSACR	85	sp|Q5BKZ1|ZN326_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,11-UNIMOD:4	ms_run[1]:scan=8579	48.565351666666665	2	1701.7022	1700.6852	M	N	2	14
PSM	SNTAGSQSQVETEA	86	sp|Q02790|FKBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	1-UNIMOD:214	ms_run[1]:scan=2379	16.543781666666668	2	1551.711811	1551.713444	K	-	446	460
PSM	ALEAELNDLM	87	sp|Q9Y5B0|CTDP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=21814	107.17	2	1261.6346	1261.6346	K	-	952	962
PSM	ALEEELEDLELGL	88	sp|Q9BRP8-2|PYM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=26969	135.76	2	1615.8314	1615.8314	R	-	191	204
PSM	DPGMGAMGGMGGGMGGGMF	89	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=20497	100.99	2	1817.7149	1817.7149	K	-	555	574
PSM	ELQGLLEFLS	90	sp|Q96R06|SPAG5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=27623	139.89	2	1291.7146	1291.7146	K	-	1184	1194
PSM	FQCGFGLTIG	91	sp|O96008|TOM40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=19217	95.272	2	1242.6189	1242.6189	K	-	352	362
PSM	GLFVQALPSS	92	sp|P22670|RFX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=16604	83.756	2	1161.6516	1161.6516	R	-	970	980
PSM	GSFGTFLF	93	sp|Q8NEM2|SHCBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=23541	115.71	2	1018.5246	1018.5246	K	-	665	673
PSM	IDNYIPIF	94	sp|P61421|VA0D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=23520	115.6	2	1137.6192	1137.6192	K	-	344	352
PSM	ILDATPACLP	95	sp|Q9Y5Y2|NUBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,8-UNIMOD:4	ms_run[2]:scan=16867	84.869	2	1213.6498	1213.6498	K	-	262	272
PSM	LACGVIGIAQ	96	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=25355	125.88	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	97	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=27532	139.31	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	98	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=28392	144.92	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	99	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=28699	147.02	2	1144.6396	1144.6396	R	-	145	155
PSM	LACGVIGIAQ	100	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=30521	160.4	2	1144.6396	1144.6396	R	-	145	155
PSM	LCATQFNNIFFLD	101	sp|P86791|CCZ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,2-UNIMOD:4	ms_run[2]:scan=26009	129.78	2	1745.8569	1745.8569	K	-	470	483
PSM	LPVVISQCGEM	102	sp|O43447-2|PPIH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,8-UNIMOD:4	ms_run[2]:scan=16789	84.52	2	1375.6961	1375.6961	K	-	124	135
PSM	LSALLTGICA	103	sp|O75385|ULK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=21875	107.45	2	1161.6549	1161.6549	R	-	1041	1051
PSM	LVNIVTENCS	104	sp|Q8N6M0-2|OTU6B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=12835	67.41	2	1291.6564	1291.6564	R	-	183	193
PSM	MEFSGGGLLL	105	sp|Q5J8M3|EMC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=22189	108.89	2	1166.6127	1166.6127	R	-	174	184
PSM	MLDQTLLDLNEM	106	sp|P06753-7|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,1-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=18022	89.969	2	1610.7653	1610.7653	R	-	147	159
PSM	SLSGPGQ	107	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=1763	13.004	2	788.41502	788.4150	K	-	172	179
PSM	SVGGACVLVA	108	sp|P46776|RL27A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=10449	56.91	2	1075.5818	1075.5818	K	-	139	149
PSM	VCNICFDVLTLGGVS	109	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214,2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=24662	121.91	2	1796.8923	1796.8923	R	-	1155	1170
PSM	VPITYLELLN	110	sp|Q9Y371-3|SHLB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	16	1-UNIMOD:214	ms_run[2]:scan=24276	119.69	2	1317.7666	1317.7666	K	-	256	266
PSM	LLMAVENAQGFEGVD	111	sp|Q96PU5|NED4L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=21143	104.01659333333333	3	1736.865401	1735.857272	K	-	961	976
PSM	VGQAGLQLLTSSD	112	sp|Q9Y2Z0|SGT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:214	ms_run[1]:scan=16372	82.77269	2	1431.7670	1431.7686	R	P	117	130
PSM	MEFSGGGLLL	113	sp|Q5J8M3|EMC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214,1-UNIMOD:35	ms_run[1]:scan=18596	92.60345333333333	2	1182.609245	1182.607646	R	-	174	184
PSM	MLDQTLLDLNEM	114	sp|P06753-2|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=24468	120.78852166666665	2	1578.772650	1578.775516	R	-	237	249
PSM	FNEFMSNILT	115	sp|P78356|PI42B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=23179	113.81585166666666	2	1358.664633	1358.666223	R	-	407	417
PSM	LELTTYLFGQDP	116	sp|Q99720|SGMR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214	ms_run[1]:scan=24506	120.99080166666666	2	1540.792779	1539.794261	R	-	212	224
PSM	LSYPACWEWTQ	117	sp|O75319|DUS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:214,6-UNIMOD:4	ms_run[1]:scan=20250	99.86633166666667	2	1583.718100	1583.720050	R	-	367	378
PSM	ALLELQEYFGSLAA	118	sp|Q9BY32-3|ITPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=28089	142.9	2	1667.8892	1667.8892	R	-	140	154
PSM	AMAPTSPQI	119	sp|Q9BYD2|RM09_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=8776	49.486	2	1058.5552	1058.5552	K	-	259	268
PSM	AVGLQPAGDVNLP	120	sp|O95229-2|ZWINT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=15003	76.789	2	1393.7687	1393.7687	K	-	218	231
PSM	GNLQLLQNCLAVLNGDT	121	sp|Q9UNH7-2|SNX6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=23649	116.26	2	1986.0326	1986.0326	K	-	274	291
PSM	IASNAGSIA	122	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=5933	35.719	2	946.52054	946.5205	R	-	132	141
PSM	IASNAGSIA	123	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=6103	36.726	2	946.52054	946.5205	R	-	132	141
PSM	IASNAGSIA	124	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=6270	37.757	2	946.52054	946.5205	R	-	132	141
PSM	IDEFEAL	125	sp|P15311|EZRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=16909	85.04	2	979.49841	979.4984	R	-	580	587
PSM	IGTVMTFL	126	sp|P30046|DOPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=23319	114.51	2	1024.5749	1024.5749	K	-	111	119
PSM	IGTVMTFL	127	sp|P30046|DOPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=23519	115.6	2	1024.5749	1024.5749	K	-	111	119
PSM	ILFEQQIF	128	sp|Q5W111-2|SPRY7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=23133	113.56	2	1180.6614	1180.6614	K	-	150	158
PSM	INSIEIAPCLL	129	sp|Q7Z2W9-2|RM21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,9-UNIMOD:4	ms_run[2]:scan=22529	110.52	2	1385.771	1385.7710	R	-	110	121
PSM	ITPLEIEVLEETVQTMDTS	130	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,16-UNIMOD:35	ms_run[2]:scan=24800	122.7	3	2307.1525	2307.1525	K	-	259	278
PSM	LEATINELV	131	sp|P10599-2|THIO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=20116	99.278	2	1144.6461	1144.6461	K	-	77	86
PSM	LLDISASSTEQIL	132	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=21832	107.25	2	1532.8419	1532.8419	R	-	440	453
PSM	LLEPALSQ	133	sp|Q05932-3|FOLC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=12665	66.653	2	1013.5879	1013.5879	K	-	530	538
PSM	LPVVISQCGEM	134	sp|O43447-2|PPIH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,8-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=13195	68.925	2	1391.6911	1391.6911	K	-	124	135
PSM	LQASAPNLTPI	135	sp|O75712|CXB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=14672	75.32	2	1267.7258	1267.7258	K	-	260	271
PSM	LVAASQAALGL	136	sp|P02768-3|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=18027	89.993	2	1156.6938	1156.6938	K	-	386	397
PSM	MLDQTLLDLNEM	137	sp|P06753-7|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,12-UNIMOD:35	ms_run[2]:scan=20976	103.2	2	1594.7704	1594.7704	R	-	147	159
PSM	MVPDFYVDSIADLLPALQG	138	sp|A6NDG6|PGP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,1-UNIMOD:35	ms_run[2]:scan=29328	151.57	2	2223.1255	2223.1255	K	-	303	322
PSM	NLLSLFEDTLDPT	139	sp|Q99640-4|PMYT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=29252	151.04	2	1620.8369	1620.8369	R	-	418	431
PSM	TQLAMLLFEQEQGNST	140	sp|Q8IZ52-2|CHSS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=21920	107.67	3	1952.9635	1952.9635	R	-	300	316
PSM	TWEGWEPWM	141	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214,9-UNIMOD:35	ms_run[2]:scan=20953	103.1	2	1380.5931	1380.5931	R	-	4089	4098
PSM	VGIDFLNY	142	sp|O43301|HS12A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=21224	104.41	2	1083.5722	1083.5722	K	-	668	676
PSM	VLAIAQNFV	143	sp|Q6P1L8|RM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=21916	107.65	2	1117.6617	1117.6617	K	-	137	146
PSM	VLPGVDALSNI	144	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=21162	104.1	2	1240.7149	1240.7149	K	-	379	390
PSM	VLTQMGSPLNPISSVS	145	sp|Q99717|SMAD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	15	1-UNIMOD:214	ms_run[2]:scan=19388	95.982	2	1772.9464	1772.9464	K	-	450	466
PSM	QNPFPPLSTVC	146	sp|Q5JVF3|PCID2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214,11-UNIMOD:4	ms_run[1]:scan=15395	78.47946833333333	2	1402.703407	1402.703672	K	-	389	400
PSM	LSSETGGMGSS	147	sp|Q15366|PCBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214,8-UNIMOD:35	ms_run[1]:scan=1723	12.776918333333333	2	1171.513059	1171.514868	R	-	355	366
PSM	IGWFPSTYVEEEGIQ	148	sp|P52735|VAV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=22824	112.05780333333334	2	1897.919505	1897.921980	R	-	864	879
PSM	SLSGPGQ	149	sp|O15145|ARPC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214	ms_run[1]:scan=1741	12.880636666666668	2	788.414313	788.415017	K	-	172	179
PSM	AAAGACTPPCT	150	sp|Q3KNT7-3|NSN5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	15	1-UNIMOD:214,6-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=2866	19.261403333333334	2	1219.540823	1219.544728	R	-	144	155
PSM	AALEAVGGTVVLE	151	sp|P52815|RM12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=16691	84.113	2	1371.7731	1371.7731	K	-	186	199
PSM	ADPWQGC	152	sp|P82921|RT21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,7-UNIMOD:4	ms_run[2]:scan=6664	39.62	2	976.41945	976.4195	R	-	81	88
PSM	AIGDAEW	153	sp|P52655|TF2AA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=11389	61.146	2	904.44123	904.4412	K	-	370	377
PSM	ALLLLCGEDD	154	sp|P08758|ANXA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=18608	92.65	2	1261.6346	1261.6346	K	-	311	321
PSM	CLENLVQLLNSS	155	sp|Q86VV8|RTTN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,1-UNIMOD:4	ms_run[2]:scan=25098	124.37	2	1532.799	1532.7990	K	-	2215	2227
PSM	EIVTNFLAGFEA	156	sp|P25705-2|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=25413	126.2	2	1453.7575	1453.7575	K	-	492	504
PSM	FAWAIDMADEDYEF	157	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=26301	131.58	2	1865.794	1865.7940	K	-	752	766
PSM	GPGSEAGP	158	sp|P21964-2|COMT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=1207	9.656	2	814.39428	814.3943	K	-	214	222
PSM	IFDPQNPDENE	159	sp|P46109|CRKL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=10084	55.366	2	1460.6541	1460.6541	K	-	293	304
PSM	ILVALCGGN	160	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=15102	77.196	2	1059.5868	1059.5869	K	-	338	347
PSM	LACGVIGIAQ	161	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=30639	161.44	2	1144.6396	1144.6396	R	-	145	155
PSM	LAELAAL	162	sp|Q86XL3-3|ANKL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=18276	91.079	2	843.51875	843.5188	R	-	287	294
PSM	LETIQAQLDSLT	163	sp|Q9Y6G5|COMDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=21393	105.21	2	1474.8001	1474.8001	K	-	191	203
PSM	LGLQCLPSDGVQNVNQ	164	sp|P41440-2|S19A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,5-UNIMOD:4	ms_run[2]:scan=14875	76.21	2	1884.9485	1884.9485	K	-	536	552
PSM	LGLQCLPSDGVQNVNQ	165	sp|P41440-2|S19A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,5-UNIMOD:4	ms_run[2]:scan=14892	76.287	3	1884.9485	1884.9485	K	-	536	552
PSM	LLEVAVP	166	sp|O43795-2|MYO1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=17877	89.317	2	883.55005	883.5501	R	-	1072	1079
PSM	LLQCDPSSASQF	167	sp|P84074|HPCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,4-UNIMOD:4	ms_run[2]:scan=13650	70.897	2	1495.7099	1495.7099	R	-	182	194
PSM	LLYAIEETEGFGQE	168	sp|O00308-3|WWP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=23201	113.94	2	1741.8532	1741.8532	K	-	418	432
PSM	LVQMEVLMN	169	sp|Q8N1F7-2|NUP93_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214,4-UNIMOD:35	ms_run[2]:scan=12575	66.293	2	1235.6376	1235.6376	R	-	688	697
PSM	MSALAAYFV	170	sp|O95985|TOP3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=23542	115.72	2	1115.5807	1115.5807	K	-	854	863
PSM	STNFFGFLS	171	sp|P23743|DGKA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=23729	116.67	2	1162.5781	1162.5781	R	-	727	736
PSM	TIAPLVASGAVQLI	172	sp|Q9BRT9|SLD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=23263	114.25	2	1495.9096	1495.9096	K	-	210	224
PSM	TLLEQLDDDQ	173	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=16579	83.65	2	1332.6531	1332.6531	R	-	921	931
PSM	TQLAMLLFEQEQGNST	174	sp|Q8IZ52-2|CHSS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=21944	107.77	2	1952.9635	1952.9635	R	-	300	316
PSM	TVLEQVLPI	175	sp|P25685-2|DNJB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=22670	111.22	2	1154.7033	1154.7033	R	-	232	241
PSM	VGAVAAATS	176	sp|Q13310-3|PABP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=3926	25.4	2	889.49908	889.4991	K	-	652	661
PSM	VGLGFELEA	177	sp|Q9Y277|VDAC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=18797	93.489	2	1077.5828	1077.5828	K	-	275	284
PSM	VSAIVEQSWNDS	178	sp|P63146|UBE2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	14	1-UNIMOD:214	ms_run[2]:scan=14893	76.291	2	1477.7171	1477.7171	R	-	141	153
PSM	LYQSAGGMPGGMPGGFPGGGAPPSGGASSGPTIEEVD	179	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,8-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=15398	78.49225	3	3521.573947	3521.583700	K	-	610	647
PSM	ITPLEIEVLEETVQTMDTS	180	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,16-UNIMOD:35	ms_run[1]:scan=28685	146.91796833333333	3	2308.180294	2307.152511	K	-	259	278
PSM	LGGSLIVAFEGCPV	181	sp|P60981|DEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,12-UNIMOD:4	ms_run[1]:scan=23838	117.30199833333334	2	1561.829080	1561.829601	K	-	152	166
PSM	QSSILNQLLL	182	sp|Q9NRM2|ZN277_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=23773	116.93037	2	1271.754935	1271.757087	K	-	441	451
PSM	IASNAGSIA	183	sp|P62829|RL23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=6565	39.162976666666665	2	946.519594	946.520545	R	-	132	141
PSM	LEATINELV	184	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=20096	99.18149166666666	2	1144.643658	1144.646140	K	-	97	106
PSM	LFMAQALQEYNN	185	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=19789	97.71002333333333	2	1584.770533	1584.772814	K	-	341	353
PSM	FLDQFAE	186	sp|Q8WZ82|OVCA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=16498	83.30608000000001	2	1012.497031	1012.498747	K	-	221	228
PSM	MIVGNGSLS	187	sp|Q53EU6|GPAT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=9747	53.900135	2	1020.538644	1020.539566	K	-	426	435
PSM	ILSTMDSPST	188	sp|Q13085|ACACA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=10884	58.84791666666666	2	1194.589964	1194.592390	R	-	2337	2347
PSM	ISAEGSGLSF	189	sp|Q8WV07|LTO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=14625	75.09129833333333	2	1110.546781	1110.567889	K	-	128	138
PSM	IEIEAVAIQGPLTTASL	190	sp|P52758|RIDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	14	1-UNIMOD:214	ms_run[1]:scan=24072	118.56333500000001	2	1869.0539	1869.0576	R	-	121	138
PSM	APAPVTYGSLLL	191	sp|Q9H0R1|AP5M1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214	ms_run[1]:scan=21287	104.69472833333333	2	1344.776092	1344.777488	K	-	479	491
PSM	ALLQTMASK	192	sp|Q7Z4Q2|HEAT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,9-UNIMOD:214	ms_run[1]:scan=5640	34.128965	3	1248.714237	1249.730779	R	N	521	530
PSM	KNSTAAEAFGNAK	193	sp|B2RTY4-5|MYO9A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	14	1-UNIMOD:214,13-UNIMOD:214	ms_run[1]:scan=27986	142.26390833333332	2	1742.929211	1739.953168	R	T	38	51
PSM	ALLQAQQA	194	sp|P04424-3|ARLY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=6396	38.356	2	985.56783	985.5678	R	-	431	439
PSM	ALLYLCGGDD	195	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214,6-UNIMOD:4	ms_run[2]:scan=16159	81.831	2	1239.5927	1239.5927	K	-	330	340
PSM	AVLWAQY	196	sp|Q676U5-4|A16L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=16666	83.999	2	993.54055	993.5406	K	-	422	429
PSM	DPGMGAMGGMGGGMGGGMF	197	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214,7-UNIMOD:35,10-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=9937	54.732	2	1865.6997	1865.6997	K	-	555	574
PSM	DVNFEFPEFQL	198	sp|P62081|RS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=25581	127.17	2	1527.7367	1527.7367	K	-	184	195
PSM	ESAFEFLSSA	199	sp|P40925-2|MDHC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=20452	100.8	2	1230.589	1230.5890	K	-	236	246
PSM	FQLQLFP	200	sp|Q96BZ9|TBC20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=23370	114.78	2	1035.5875	1035.5875	K	-	397	404
PSM	GIPNMLLSEEETES	201	sp|Q9UI30-2|TR112_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=18023	89.973	2	1691.8046	1691.8046	R	-	107	121
PSM	GVEAGPDLLQ	202	sp|O60506-5|HNRPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=11854	63.151	2	1141.6101	1141.6101	K	-	401	411
PSM	ICPNAPDP	203	sp|Q8WUZ0|BCL7C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214,2-UNIMOD:4	ms_run[2]:scan=6439	38.552	2	1026.4926	1026.4926	R	-	210	218
PSM	ILDTADENGLLSLPN	204	sp|Q96DZ1-2|ERLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=21085	103.73	2	1727.9063	1727.9063	K	-	415	430
PSM	INFNNYYQDA	205	sp|Q96RT7-2|GCP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=14938	76.5	2	1404.6432	1404.6432	R	-	1776	1786
PSM	ITPLEIEVLEETVQTMDTS	206	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214,16-UNIMOD:35	ms_run[2]:scan=24830	122.9	2	2307.1525	2307.1525	K	-	259	278
PSM	ITPLEIEVLEETVQTMDTS	207	sp|Q99436|PSB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=28643	146.64	2	2291.1576	2291.1576	K	-	259	278
PSM	IVLELPQ	208	sp|Q53FA7|QORX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=17546	87.84	2	954.58717	954.5872	K	-	326	333
PSM	IVSAQSLAEDDVE	209	sp|Q15388|TOM20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=13193	68.914	2	1518.7535	1518.7535	R	-	133	146
PSM	LAAFYGV	210	sp|Q92973-3|TNPO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=17562	87.904	2	883.49254	883.4925	R	-	842	849
PSM	LACGVIGIAQ	211	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214,3-UNIMOD:4	ms_run[2]:scan=26995	135.94	2	1144.6396	1144.6396	R	-	145	155
PSM	MLDQTLLDLNEM	212	sp|P06753-7|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214,1-UNIMOD:35	ms_run[2]:scan=22090	108.42	2	1594.7704	1594.7704	R	-	147	159
PSM	VAEEPPNLWW	213	sp|Q96ME1-4|FXL18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=22273	109.27	2	1383.6945	1383.6945	R	-	709	719
PSM	VGDPVYLLGQ	214	sp|Q5VT66-3|MARC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=17854	89.22	2	1203.6621	1203.6621	K	-	243	253
PSM	VLQTIGI	215	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214	ms_run[2]:scan=17056	85.676	2	886.56095	886.5610	R	-	1035	1042
PSM	YEDMLSLLEK	216	sp|Q9NYC9-2|DYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	13	1-UNIMOD:214,4-UNIMOD:35,10-UNIMOD:214	ms_run[2]:scan=26136	130.55	2	1543.8047	1543.8047	K	Y	648	658
PSM	LACGVIGIAQ	217	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,3-UNIMOD:4	ms_run[1]:scan=25929	129.31986	2	1145.635398	1144.639615	R	-	145	155
PSM	GPGFGVQAGL	218	sp|P19404|NDUV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=12948	67.8946	2	1045.563915	1045.567830	K	-	240	250
PSM	SEEGLSSGLGSGVGGK	219	sp|A8MTJ6|FOXI3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,16-UNIMOD:214	ms_run[1]:scan=19494	96.42125666666666	3	1707.864498	1707.888278	K	P	257	273
PSM	GLYSIEVLELF	220	sp|Q9H8H0|NOL11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=28757	147.4088	2	1425.786619	1425.787719	R	-	709	720
PSM	SGFILSVPGN	221	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=16285	82.42063666666667	2	1133.618968	1133.620259	R	-	997	1007
PSM	LPLVEDFMCS	222	sp|O00716|E2F3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,9-UNIMOD:4	ms_run[1]:scan=24784	122.61720833333332	2	1353.641368	1353.643045	K	-	456	466
PSM	DPFGNPFA	223	sp|P98082|DAB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=17837	89.15185	2	1007.484323	1007.483431	R	-	763	771
PSM	QMTLLF	224	sp|Q8WUH1|CHUR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=20482	100.93233166666667	2	895.494894	895.495910	R	-	134	140
PSM	ILGDFEDSCC	225	sp|Q05DH4|F16A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,9-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=15002	76.78377166666667	2	1358.560848	1358.560438	K	-	1031	1041
PSM	LSLQAV	226	sp|Q9HDC9|APMAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=12546	66.16796833333333	2	773.477203	773.476889	R	-	411	417
PSM	ECTIEATA	227	sp|P62633|CNBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,2-UNIMOD:4	ms_run[1]:scan=4349	27.449421666666666	2	1037.480730	1037.482111	R	-	170	178
PSM	LLTASL	228	sp|Q9NXF7|DCA16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=15060	77.02680333333333	2	760.479857	760.481640	K	-	211	217
PSM	VLLLDL	229	sp|P36957|ODO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=24323	119.95979666666666	2	828.543650	828.544241	R	-	448	454
PSM	LTWGGC	230	sp|Q9UBD5|ORC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,6-UNIMOD:4	ms_run[1]:scan=10520	57.219768333333334	2	836.396401	836.397259	R	-	706	712
PSM	VAFFEEL	231	sp|P35240|MERL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=22586	110.78286333333332	2	997.522597	997.524234	R	-	589	596
PSM	LASAFGD	232	sp|Q9UGT4|SUSD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	13	1-UNIMOD:214	ms_run[1]:scan=9851	54.342396666666666	2	823.4174	823.4192	R	P	446	453
PSM	HSELLQK	233	sp|Q9Y2Q9|RT28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,7-UNIMOD:214	ms_run[1]:scan=18524	92.21480666666666	2	1141.647639	1141.669893	R	V	59	66
PSM	MALHVPK	234	sp|P50990|TCPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,7-UNIMOD:214	ms_run[1]:scan=16523	83.41920666666667	2	1082.642342	1082.651406	-	A	1	8
PSM	ISDSTLK	235	sp|Q9ULM3|YETS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,7-UNIMOD:214	ms_run[1]:scan=9270	51.73085666666667	3	1050.635641	1050.616460	K	T	924	931
PSM	IGCGLDR	236	sp|Q9Y530|OARD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,3-UNIMOD:4	ms_run[1]:scan=6965	40.975275	2	935.483744	933.482386	R	L	120	127
PSM	VFSAYIK	237	sp|Q92747|ARC1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,7-UNIMOD:214	ms_run[1]:scan=25840	128.77773333333332	2	1113.639228	1114.663016	R	E	168	175
PSM	LACGVIGIAQ	238	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,3-UNIMOD:4	ms_run[1]:scan=26215	131.03422	2	1146.640482	1144.639615	R	-	145	155
PSM	LACGVIGIAQ	239	sp|P00441|SODC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214,3-UNIMOD:4	ms_run[1]:scan=16036	81.28644166666666	2	1146.641227	1144.639615	R	-	145	155
PSM	LTSPGALLFQ	240	sp|O60566|BUB1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=20544	101.2196	2	1191.689673	1189.682860	K	-	1041	1051
PSM	TTLAAR	241	sp|Q8WZ42|TITIN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	13	1-UNIMOD:214	ms_run[1]:scan=16374	82.78184333333334	1	774.453317	775.467387	K	I	33484	33490