MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	HL-LH_JPST000208
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082035917518^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\111222_LH20.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082035917518^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\111222_LH20.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[1]-setting	variableModifications=Acetyl (Protein N-term),Oxidation (M)
MTD	software[1]-setting	maxMissedCleavages=1
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Acetyl (Protein N-term)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=1
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C),Label:13C(6) (K),Label:13C(6)15N(4) (R)
MTD	software[3]-setting	VarMod=Acetyl (Protein N-term),Oxidation (M)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=1
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	fixed_mod[2]	[UNIMOD, UNIMOD:188, Label:13C(6),]
MTD	fixed_mod[2]-site	K
MTD	fixed_mod[2]-position	Anywhere
MTD	fixed_mod[3]	[UNIMOD, UNIMOD:267, Label:13C(6)15N(4),]
MTD	fixed_mod[3]-site	R
MTD	fixed_mod[3]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:1, Acetyl,]
MTD	variable_mod[1]-site	N-term
MTD	variable_mod[1]-position	Protein N-term
MTD	variable_mod[2]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[2]-site	M
MTD	variable_mod[2]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9UN37|VPS4A_HUMAN	Vacuolar protein sorting-associated protein 4A OS=Homo sapiens OX=9606 GN=VPS4A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null	324-UNIMOD:267	0.05	43.0	1	1	1
PRT	sp|P14618|KPYM_HUMAN	Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	422-UNIMOD:188,89-UNIMOD:188,2-UNIMOD:1,3-UNIMOD:188,31-UNIMOD:4,32-UNIMOD:267	0.14	42.0	4	3	2
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	632-UNIMOD:188,647-UNIMOD:267,314-UNIMOD:188	0.05	41.0	3	2	1
PRT	sp|P62266|RS23_HUMAN	40S ribosomal protein S23 OS=Homo sapiens OX=9606 GN=RPS23 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	37-UNIMOD:188,48-UNIMOD:188	0.14	39.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	121-UNIMOD:267	0.05	38.0	1	1	1
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38.0	null	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	0.04	38.0	2	1	0
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	133-UNIMOD:188	0.04	37.0	1	1	1
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	775-UNIMOD:188,792-UNIMOD:267	0.02	37.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	455-UNIMOD:188,469-UNIMOD:267,779-UNIMOD:188,791-UNIMOD:188	0.04	37.0	3	2	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	108-UNIMOD:188,117-UNIMOD:267,173-UNIMOD:267,174-UNIMOD:188	0.09	37.0	5	2	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	1636-UNIMOD:4,1652-UNIMOD:267	0.01	36.0	2	1	0
PRT	sp|P62826|RAN_HUMAN	GTP-binding nuclear protein Ran OS=Homo sapiens OX=9606 GN=RAN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	38-UNIMOD:188,56-UNIMOD:267	0.09	36.0	3	1	0
PRT	sp|Q96FX7|TRM61_HUMAN	tRNA (adenine(58)-N(1))-methyltransferase catalytic subunit TRMT61A OS=Homo sapiens OX=9606 GN=TRMT61A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	140-UNIMOD:267	0.06	36.0	2	1	0
PRT	sp|Q96HV5|TM41A_HUMAN	Transmembrane protein 41A OS=Homo sapiens OX=9606 GN=TMEM41A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	261-UNIMOD:267	0.06	35.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	624-UNIMOD:188,639-UNIMOD:267,306-UNIMOD:188	0.05	35.0	5	3	2
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	402-UNIMOD:35,407-UNIMOD:188	0.06	35.0	2	1	0
PRT	sp|P12268|IMDH2_HUMAN	Inosine-5'-monophosphate dehydrogenase 2 OS=Homo sapiens OX=9606 GN=IMPDH2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	356-UNIMOD:267,375-UNIMOD:188	0.04	35.0	2	1	0
PRT	sp|P54577|SYYC_HUMAN	Tyrosine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=YARS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	207-UNIMOD:267,222-UNIMOD:188	0.03	35.0	1	1	1
PRT	sp|Q8NC51-4|PAIRB_HUMAN	Isoform 4 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	308-UNIMOD:188,324-UNIMOD:267,319-UNIMOD:35	0.05	35.0	3	1	0
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	1523-UNIMOD:188,1538-UNIMOD:267,1241-UNIMOD:188,1255-UNIMOD:267,2242-UNIMOD:267,2263-UNIMOD:267,790-UNIMOD:267,802-UNIMOD:267	0.04	34.0	7	4	1
PRT	sp|O75643|U520_HUMAN	U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	718-UNIMOD:188,728-UNIMOD:267	0.01	34.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	571-UNIMOD:267	0.05	34.0	1	1	1
PRT	sp|P52948-6|NUP98_HUMAN	Isoform 6 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	1527-UNIMOD:188,1533-UNIMOD:4,1536-UNIMOD:188	0.01	33.0	1	1	1
PRT	sp|P15170|ERF3A_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3A OS=Homo sapiens OX=9606 GN=GSPT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	72-UNIMOD:188,87-UNIMOD:188	0.03	33.0	1	1	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	1956-UNIMOD:267,1969-UNIMOD:267	0.01	33.0	2	1	0
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	28-UNIMOD:4,33-UNIMOD:4,34-UNIMOD:188	0.17	33.0	1	1	1
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	263-UNIMOD:188,273-UNIMOD:4,278-UNIMOD:267	0.02	32.0	1	1	1
PRT	sp|P49773|HINT1_HUMAN	Histidine triad nucleotide-binding protein 1 OS=Homo sapiens OX=9606 GN=HINT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	119-UNIMOD:267,96-UNIMOD:35,38-UNIMOD:385,38-UNIMOD:4,57-UNIMOD:188	0.37	32.0	4	2	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	216-UNIMOD:188,227-UNIMOD:267	0.02	32.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	156-UNIMOD:188,163-UNIMOD:267	0.02	32.0	2	1	0
PRT	sp|P68104-2|EF1A1_HUMAN	Isoform 2 of Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	20-UNIMOD:188,30-UNIMOD:188	0.06	32.0	3	2	1
PRT	sp|Q8IWB7|WDFY1_HUMAN	WD repeat and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WDFY1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	244-UNIMOD:188,249-UNIMOD:4,255-UNIMOD:267	0.05	32.0	1	1	1
PRT	sp|P58546|MTPN_HUMAN	Myotrophin OS=Homo sapiens OX=9606 GN=MTPN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	66-UNIMOD:188,83-UNIMOD:4,85-UNIMOD:188	0.25	31.0	1	1	1
PRT	sp|Q8IW45-4|NNRD_HUMAN	Isoform 4 of ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Homo sapiens OX=9606 GN=NAXD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	46-UNIMOD:267,52-UNIMOD:267	0.08	31.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	224-UNIMOD:188,231-UNIMOD:267	0.02	31.0	1	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	162-UNIMOD:188,172-UNIMOD:267	0.09	30.0	1	1	1
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:267,91-UNIMOD:267	0.05	30.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	80-UNIMOD:188,83-UNIMOD:267,17-UNIMOD:267,29-UNIMOD:267	0.07	30.0	3	2	1
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	107-UNIMOD:4,118-UNIMOD:188,119-UNIMOD:188	0.08	30.0	2	1	0
PRT	sp|P68400-2|CSK21_HUMAN	Isoform 2 of Casein kinase II subunit alpha OS=Homo sapiens OX=9606 GN=CSNK2A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	93-UNIMOD:188,108-UNIMOD:267	0.07	30.0	2	1	0
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	673-UNIMOD:267	0.02	30.0	2	1	0
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	585-UNIMOD:4,593-UNIMOD:188,594-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	97-UNIMOD:267	0.03	30.0	1	1	1
PRT	sp|Q8IWA0|WDR75_HUMAN	WD repeat-containing protein 75 OS=Homo sapiens OX=9606 GN=WDR75 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	49-UNIMOD:4,57-UNIMOD:267	0.02	30.0	1	1	1
PRT	sp|P61254|RL26_HUMAN	60S ribosomal protein L26 OS=Homo sapiens OX=9606 GN=RPL26 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	103-UNIMOD:188,108-UNIMOD:267	0.14	29.0	1	1	1
PRT	sp|P53985-2|MOT1_HUMAN	Isoform 2 of Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	236-UNIMOD:267,239-UNIMOD:188	0.04	29.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	512-UNIMOD:267,537-UNIMOD:267	0.04	29.0	1	1	1
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	646-UNIMOD:188,656-UNIMOD:267,430-UNIMOD:267,442-UNIMOD:4,444-UNIMOD:4,450-UNIMOD:188	0.05	29.0	3	2	1
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	425-UNIMOD:267	0.02	29.0	2	1	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	68-UNIMOD:188,71-UNIMOD:4,83-UNIMOD:4,92-UNIMOD:188	0.13	29.0	1	1	1
PRT	sp|Q15366-4|PCBP2_HUMAN	Isoform 4 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	241-UNIMOD:188	0.10	29.0	1	1	1
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	106-UNIMOD:4,110-UNIMOD:267,112-UNIMOD:188	0.08	29.0	2	1	0
PRT	sp|Q13509-2|TBB3_HUMAN	Isoform 2 of Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	14-UNIMOD:267,31-UNIMOD:188	0.07	29.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	517-UNIMOD:4,534-UNIMOD:188	0.03	29.0	1	1	1
PRT	sp|P62937-2|PPIA_HUMAN	Isoform 2 of Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	65-UNIMOD:188,71-UNIMOD:188,22-UNIMOD:188,31-UNIMOD:188	0.29	29.0	2	2	2
PRT	sp|P57740-2|NU107_HUMAN	Isoform 2 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	592-UNIMOD:4,597-UNIMOD:188,608-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	199-UNIMOD:188,217-UNIMOD:267	0.05	28.0	2	1	0
PRT	sp|Q9Y2L1-2|RRP44_HUMAN	Isoform 2 of Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	647-UNIMOD:188,659-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|O43150-2|ASAP2_HUMAN	Isoform 2 of Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	665-UNIMOD:188,669-UNIMOD:4,680-UNIMOD:267	0.02	28.0	1	1	1
PRT	sp|O43169|CYB5B_HUMAN	Cytochrome b5 type B OS=Homo sapiens OX=9606 GN=CYB5B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	35-UNIMOD:188,44-UNIMOD:267	0.10	28.0	2	1	0
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	228-UNIMOD:267,260-UNIMOD:188	0.07	28.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	245-UNIMOD:188	0.02	28.0	1	1	1
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	463-UNIMOD:4,465-UNIMOD:267,483-UNIMOD:267	0.03	28.0	1	1	1
PRT	sp|Q14192-2|FHL2_HUMAN	Isoform 2 of Four and a half LIM domains protein 2 OS=Homo sapiens OX=9606 GN=FHL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	7-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:188,18-UNIMOD:188	0.10	27.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	223-UNIMOD:188,239-UNIMOD:188	0.03	27.0	1	1	1
PRT	sp|Q12769|NU160_HUMAN	Nuclear pore complex protein Nup160 OS=Homo sapiens OX=9606 GN=NUP160 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1029-UNIMOD:267,666-UNIMOD:267,677-UNIMOD:267	0.03	27.0	3	2	1
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	100-UNIMOD:267,103-UNIMOD:4,112-UNIMOD:188	0.08	27.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	825-UNIMOD:188,839-UNIMOD:267	0.01	27.0	2	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	65-UNIMOD:267,78-UNIMOD:267,940-UNIMOD:188,943-UNIMOD:188	0.03	27.0	2	2	2
PRT	sp|Q8IYS1|P20D2_HUMAN	Peptidase M20 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PM20D2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	60-UNIMOD:267	0.04	27.0	1	1	1
PRT	sp|P62701|RS4X_HUMAN	40S ribosomal protein S4, X isoform OS=Homo sapiens OX=9606 GN=RPS4X PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	200-UNIMOD:267,211-UNIMOD:188	0.05	26.0	3	1	0
PRT	sp|Q13418-2|ILK_HUMAN	Isoform 2 of Integrin-linked protein kinase OS=Homo sapiens OX=9606 GN=ILK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	80-UNIMOD:267	0.04	26.0	1	1	1
PRT	sp|Q13616|CUL1_HUMAN	Cullin-1 OS=Homo sapiens OX=9606 GN=CUL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	315-UNIMOD:188,321-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|O15391|TYY2_HUMAN	Transcription factor YY2 OS=Homo sapiens OX=9606 GN=YY2 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	309-UNIMOD:188,313-UNIMOD:4,318-UNIMOD:4,320-UNIMOD:188	0.06	26.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	385-UNIMOD:4,386-UNIMOD:188,387-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|P10599|THIO_HUMAN	Thioredoxin OS=Homo sapiens OX=9606 GN=TXN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:188,48-UNIMOD:188,37-UNIMOD:35	0.12	26.0	2	1	0
PRT	sp|O75569-3|PRKRA_HUMAN	Isoform 3 of Interferon-inducible double-stranded RNA-dependent protein kinase activator A OS=Homo sapiens OX=9606 GN=PRKRA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	116-UNIMOD:267	0.07	26.0	1	1	1
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	100-UNIMOD:4,107-UNIMOD:188	0.01	26.0	1	1	1
PRT	sp|O75674-2|TM1L1_HUMAN	Isoform 2 of TOM1-like protein 1 OS=Homo sapiens OX=9606 GN=TOM1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	8-UNIMOD:267,21-UNIMOD:188	0.05	26.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	175-UNIMOD:188,195-UNIMOD:4,198-UNIMOD:188	0.03	26.0	1	1	1
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	292-UNIMOD:188,306-UNIMOD:188	0.02	26.0	2	1	0
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	167-UNIMOD:188	0.04	26.0	1	1	1
PRT	sp|P30405|PPIF_HUMAN	Peptidyl-prolyl cis-trans isomerase F, mitochondrial OS=Homo sapiens OX=9606 GN=PPIF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	167-UNIMOD:188,175-UNIMOD:188	0.08	26.0	1	1	1
PRT	sp|Q8N543-2|OGFD1_HUMAN	Isoform 2 of Prolyl 3-hydroxylase OGFOD1 OS=Homo sapiens OX=9606 GN=OGFOD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	315-UNIMOD:188	0.03	26.0	2	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	127-UNIMOD:4,131-UNIMOD:188,139-UNIMOD:4,142-UNIMOD:4,147-UNIMOD:4,148-UNIMOD:267,258-UNIMOD:188,265-UNIMOD:267	0.05	26.0	2	2	2
PRT	sp|P26641|EF1G_HUMAN	Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	45-UNIMOD:267	0.04	26.0	3	1	0
PRT	sp|P49748|ACADV_HUMAN	Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	512-UNIMOD:267,531-UNIMOD:267	0.03	26.0	1	1	1
PRT	sp|Q32MZ4-4|LRRF1_HUMAN	Isoform 4 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	352-UNIMOD:188,366-UNIMOD:188	0.03	25.0	1	1	1
PRT	sp|Q9UGV2-2|NDRG3_HUMAN	Isoform 2 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	42-UNIMOD:267,56-UNIMOD:188	0.05	25.0	1	1	1
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	63-UNIMOD:267,49-UNIMOD:188	0.05	25.0	3	2	1
PRT	sp|P46783|RS10_HUMAN	40S ribosomal protein S10 OS=Homo sapiens OX=9606 GN=RPS10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	38-UNIMOD:188,47-UNIMOD:188	0.10	25.0	1	1	1
PRT	sp|Q99538-3|LGMN_HUMAN	Isoform 3 of Legumain OS=Homo sapiens OX=9606 GN=LGMN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	50-UNIMOD:4,58-UNIMOD:267	0.04	25.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	338-UNIMOD:4,341-UNIMOD:188,344-UNIMOD:188	0.01	25.0	1	1	1
PRT	sp|Q8N163-2|CCAR2_HUMAN	Isoform 2 of Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	839-UNIMOD:188,846-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|Q8WVV4-3|POF1B_HUMAN	Isoform 3 of Protein POF1B OS=Homo sapiens OX=9606 GN=POF1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	267-UNIMOD:188,274-UNIMOD:4,281-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	249-UNIMOD:35,250-UNIMOD:267,258-UNIMOD:267	0.03	25.0	2	1	0
PRT	sp|Q96IR7|HPDL_HUMAN	4-hydroxyphenylpyruvate dioxygenase-like protein OS=Homo sapiens OX=9606 GN=HPDL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	9-UNIMOD:4,23-UNIMOD:267	0.05	25.0	1	1	1
PRT	sp|Q86U86-5|PB1_HUMAN	Isoform 5 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	836-UNIMOD:267,850-UNIMOD:267	0.01	25.0	1	1	1
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	31-UNIMOD:188,41-UNIMOD:267	0.02	25.0	1	1	1
PRT	sp|P56270-4|MAZ_HUMAN	Isoform 4 of Myc-associated zinc finger protein OS=Homo sapiens OX=9606 GN=MAZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	116-UNIMOD:4,119-UNIMOD:4,121-UNIMOD:188	0.09	25.0	1	1	1
PRT	sp|P18031|PTN1_HUMAN	Tyrosine-protein phosphatase non-receptor type 1 OS=Homo sapiens OX=9606 GN=PTPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	199-UNIMOD:267,215-UNIMOD:4,221-UNIMOD:267	0.06	25.0	1	1	1
PRT	sp|P33993|MCM7_HUMAN	DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	545-UNIMOD:267	0.02	25.0	1	1	0
PRT	sp|P50914|RL14_HUMAN	60S ribosomal protein L14 OS=Homo sapiens OX=9606 GN=RPL14 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	54-UNIMOD:4,63-UNIMOD:188,71-UNIMOD:188	0.09	24.0	1	1	1
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	101-UNIMOD:267	0.10	24.0	1	1	1
PRT	sp|P15559-3|NQO1_HUMAN	Isoform 3 of NAD(P)H dehydrogenase [quinone] 1 OS=Homo sapiens OX=9606 GN=NQO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	224-UNIMOD:188	0.05	24.0	1	1	1
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1300-UNIMOD:267	0.01	24.0	2	1	0
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	257-UNIMOD:267	0.02	24.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	95-UNIMOD:267	0.03	24.0	2	1	0
PRT	sp|Q96EL2|RT24_HUMAN	28S ribosomal protein S24, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS24 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	66-UNIMOD:188,85-UNIMOD:267	0.13	24.0	1	1	1
PRT	sp|P22061|PIMT_HUMAN	Protein-L-isoaspartate(D-aspartate) O-methyltransferase OS=Homo sapiens OX=9606 GN=PCMT1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	18-UNIMOD:267,19-UNIMOD:188	0.07	24.0	1	1	1
PRT	sp|Q8IWS0-4|PHF6_HUMAN	Isoform 4 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	107-UNIMOD:4,112-UNIMOD:188	0.04	24.0	1	1	1
PRT	sp|Q03426|KIME_HUMAN	Mevalonate kinase OS=Homo sapiens OX=9606 GN=MVK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	26-UNIMOD:188	0.04	24.0	1	1	1
PRT	sp|Q9NWY4|HPF1_HUMAN	Histone PARylation factor 1 OS=Homo sapiens OX=9606 GN=HPF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	322-UNIMOD:267,336-UNIMOD:267	0.05	24.0	1	1	1
PRT	sp|Q8N684-2|CPSF7_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 7 OS=Homo sapiens OX=9606 GN=CPSF7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	438-UNIMOD:267,446-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	190-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	225-UNIMOD:267,231-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|P62745|RHOB_HUMAN	Rho-related GTP-binding protein RhoB OS=Homo sapiens OX=9606 GN=RHOB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	107-UNIMOD:4,118-UNIMOD:188,119-UNIMOD:188	0.08	23.0	2	1	0
PRT	sp|Q9BV20-2|MTNA_HUMAN	Isoform 2 of Methylthioribose-1-phosphate isomerase OS=Homo sapiens OX=9606 GN=MRI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	238-UNIMOD:4,241-UNIMOD:267	0.06	23.0	1	1	1
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	465-UNIMOD:267,477-UNIMOD:267	0.02	23.0	1	1	1
PRT	sp|P50213-2|IDH3A_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NAD] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=IDH3A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	248-UNIMOD:267	0.04	23.0	1	1	1
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	155-UNIMOD:4,163-UNIMOD:188	0.02	23.0	1	1	1
PRT	sp|P33993-3|MCM7_HUMAN	Isoform 3 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	369-UNIMOD:267	0.03	23.0	1	1	0
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	401-UNIMOD:35,404-UNIMOD:4,417-UNIMOD:267,418-UNIMOD:188	0.03	23.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	292-UNIMOD:267	0.03	23.0	4	1	0
PRT	sp|Q9Y2B0|CNPY2_HUMAN	Protein canopy homolog 2 OS=Homo sapiens OX=9606 GN=CNPY2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	167-UNIMOD:267,171-UNIMOD:4	0.09	23.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	216-UNIMOD:188	0.01	23.0	1	1	1
PRT	sp|P10155-3|RO60_HUMAN	Isoform 3 of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=TROVE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	239-UNIMOD:267,252-UNIMOD:267	0.03	23.0	2	1	0
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	262-UNIMOD:188,270-UNIMOD:4,272-UNIMOD:267	0.07	23.0	2	1	0
PRT	sp|P11177|ODPB_HUMAN	Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	233-UNIMOD:28,244-UNIMOD:267,249-UNIMOD:4,258-UNIMOD:188	0.08	23.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	284-UNIMOD:267	0.03	23.0	1	1	1
PRT	sp|Q96PK6-3|RBM14_HUMAN	Isoform 3 of RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	61-UNIMOD:267,64-UNIMOD:267	0.13	22.0	2	1	0
PRT	sp|P36578|RL4_HUMAN	60S ribosomal protein L4 OS=Homo sapiens OX=9606 GN=RPL4 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	33-UNIMOD:267,45-UNIMOD:267	0.04	22.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	230-UNIMOD:4,231-UNIMOD:267,245-UNIMOD:188	0.02	22.0	1	1	1
PRT	sp|Q08752|PPID_HUMAN	Peptidyl-prolyl cis-trans isomerase D OS=Homo sapiens OX=9606 GN=PPID PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	64-UNIMOD:188,69-UNIMOD:188	0.04	22.0	1	1	1
PRT	sp|Q9H0A0|NAT10_HUMAN	RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	34-UNIMOD:188,46-UNIMOD:188	0.01	22.0	1	1	1
PRT	sp|Q99447-4|PCY2_HUMAN	Isoform 4 of Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	34-UNIMOD:188,44-UNIMOD:267	0.04	22.0	2	1	0
PRT	sp|Q99878|H2A1J_HUMAN	Histone H2A type 1-J OS=Homo sapiens OX=9606 GN=HIST1H2AJ PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	89-UNIMOD:267,96-UNIMOD:188	0.12	22.0	1	1	1
PRT	sp|O00151|PDLI1_HUMAN	PDZ and LIM domain protein 1 OS=Homo sapiens OX=9606 GN=PDLIM1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	279-UNIMOD:267,283-UNIMOD:4,286-UNIMOD:4,289-UNIMOD:4,294-UNIMOD:188	0.05	22.0	1	1	1
PRT	sp|O75976-2|CBPD_HUMAN	Isoform 2 of Carboxypeptidase D OS=Homo sapiens OX=9606 GN=CPD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1091-UNIMOD:267,1102-UNIMOD:267	0.01	22.0	1	1	1
PRT	sp|Q15424|SAFB1_HUMAN	Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	463-UNIMOD:385,463-UNIMOD:4,469-UNIMOD:188,475-UNIMOD:188	0.02	22.0	1	1	1
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	724-UNIMOD:28,746-UNIMOD:188,747-UNIMOD:267	0.02	22.0	2	1	0
PRT	sp|Q15652|JHD2C_HUMAN	Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	955-UNIMOD:188,960-UNIMOD:267	0.01	22.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	591-UNIMOD:4,594-UNIMOD:188	0.02	21.0	1	1	1
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	172-UNIMOD:267,177-UNIMOD:188	0.03	21.0	1	1	1
PRT	sp|P25205|MCM3_HUMAN	DNA replication licensing factor MCM3 OS=Homo sapiens OX=9606 GN=MCM3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	556-UNIMOD:188,557-UNIMOD:188	0.01	21.0	1	1	1
PRT	sp|Q04912-7|RON_HUMAN	Isoform RON-5 of Macrophage-stimulating protein receptor OS=Homo sapiens OX=9606 GN=MST1R	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1198-UNIMOD:267	0.01	21.0	1	1	1
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	123-UNIMOD:267,130-UNIMOD:267	0.01	21.0	1	1	1
PRT	sp|Q7Z6K5|ARPIN_HUMAN	Arpin OS=Homo sapiens OX=9606 GN=ARPIN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	55-UNIMOD:267,56-UNIMOD:188	0.05	21.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1807-UNIMOD:188,1819-UNIMOD:267	0.00	21.0	1	1	1
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	142-UNIMOD:188,152-UNIMOD:267	0.03	21.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	276-UNIMOD:267,121-UNIMOD:267	0.08	21.0	2	2	2
PRT	sp|Q9UNE7-2|CHIP_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	82-UNIMOD:267,95-UNIMOD:267	0.06	21.0	1	1	1
PRT	sp|P09543-2|CN37_HUMAN	Isoform CNPI of 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	225-UNIMOD:267,232-UNIMOD:4,235-UNIMOD:188	0.03	21.0	1	1	1
PRT	sp|Q9BR76|COR1B_HUMAN	Coronin-1B OS=Homo sapiens OX=9606 GN=CORO1B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	134-UNIMOD:267,145-UNIMOD:267	0.03	21.0	2	1	0
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	231-UNIMOD:267,242-UNIMOD:267	0.04	21.0	1	1	1
PRT	sp|P43034|LIS1_HUMAN	Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens OX=9606 GN=PAFAH1B1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	390-UNIMOD:188	0.04	21.0	1	1	1
PRT	sp|P16422|EPCAM_HUMAN	Epithelial cell adhesion molecule OS=Homo sapiens OX=9606 GN=EPCAM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	218-UNIMOD:188	0.05	21.0	1	1	1
PRT	sp|Q9NWH9-3|SLTM_HUMAN	Isoform 2 of SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	430-UNIMOD:267,437-UNIMOD:267	0.02	21.0	1	1	1
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	704-UNIMOD:188,714-UNIMOD:267	0.03	21.0	1	1	0
PRT	sp|Q14643|ITPR1_HUMAN	Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	1308-UNIMOD:4,1314-UNIMOD:267	0.01	21.0	1	1	1
PRT	sp|Q99880|H2B1L_HUMAN	Histone H2B type 1-L OS=Homo sapiens OX=9606 GN=HIST1H2BL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	73-UNIMOD:267	0.13	20.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	213-UNIMOD:4,225-UNIMOD:267	0.02	20.0	1	1	1
PRT	sp|P51648|AL3A2_HUMAN	Fatty aldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	357-UNIMOD:188,369-UNIMOD:188	0.03	20.0	1	1	1
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	83-UNIMOD:188,93-UNIMOD:188	0.08	20.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	3746-UNIMOD:267,3753-UNIMOD:188	0.00	20.0	1	1	1
PRT	sp|Q8NFW8-2|NEUA_HUMAN	Isoform 2 of N-acylneuraminate cytidylyltransferase OS=Homo sapiens OX=9606 GN=CMAS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	41-UNIMOD:188,52-UNIMOD:267	0.06	20.0	1	1	1
PRT	sp|Q9HB21|PKHA1_HUMAN	Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	314-UNIMOD:267,329-UNIMOD:267	0.05	20.0	1	1	1
PRT	sp|P49821-2|NDUV1_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	128-UNIMOD:188,133-UNIMOD:4,138-UNIMOD:267,434-UNIMOD:267,440-UNIMOD:267	0.06	20.0	2	2	2
PRT	sp|P11171-6|41_HUMAN	Isoform 6 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	391-UNIMOD:188,392-UNIMOD:188	0.02	20.0	2	1	0
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	445-UNIMOD:188	0.04	20.0	1	1	1
PRT	sp|Q53H82|LACB2_HUMAN	Endoribonuclease LACTB2 OS=Homo sapiens OX=9606 GN=LACTB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	191-UNIMOD:188,209-UNIMOD:188	0.07	20.0	1	1	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	237-UNIMOD:35,246-UNIMOD:188,247-UNIMOD:267	0.02	20.0	2	1	0
PRT	sp|Q9NZB2-2|F120A_HUMAN	Isoform B of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	557-UNIMOD:267	0.03	20.0	1	1	1
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	6-UNIMOD:188,14-UNIMOD:188	0.02	20.0	1	1	1
PRT	sp|P38159-2|RBMX_HUMAN	Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	81-UNIMOD:267,88-UNIMOD:267	0.02	20.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	264-UNIMOD:188,225-UNIMOD:267	0.05	20.0	2	2	2
PRT	sp|Q969G9|NKD1_HUMAN	Protein naked cuticle homolog 1 OS=Homo sapiens OX=9606 GN=NKD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	20.0	null	308-UNIMOD:267	0.03	20.0	2	1	0
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	167-UNIMOD:188	0.08	19.0	1	1	1
PRT	sp|P62140|PP1B_HUMAN	Serine/threonine-protein phosphatase PP1-beta catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	237-UNIMOD:267,244-UNIMOD:4,245-UNIMOD:267	0.04	19.0	2	1	0
PRT	sp|P61619-3|S61A1_HUMAN	Isoform 3 of Protein transport protein Sec61 subunit alpha isoform 1 OS=Homo sapiens OX=9606 GN=SEC61A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	285-UNIMOD:267,295-UNIMOD:267	0.04	19.0	1	1	1
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	805-UNIMOD:267	0.02	19.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	333-UNIMOD:188,341-UNIMOD:267	0.02	19.0	1	1	0
PRT	sp|Q16531|DDB1_HUMAN	DNA damage-binding protein 1 OS=Homo sapiens OX=9606 GN=DDB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	570-UNIMOD:188,579-UNIMOD:188	0.01	19.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	73-UNIMOD:188,84-UNIMOD:267	0.03	19.0	2	1	0
PRT	sp|P53618|COPB_HUMAN	Coatomer subunit beta OS=Homo sapiens OX=9606 GN=COPB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	309-UNIMOD:188,316-UNIMOD:267	0.01	19.0	1	1	1
PRT	sp|O00629|IMA3_HUMAN	Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	174-UNIMOD:4,191-UNIMOD:4,192-UNIMOD:267	0.06	19.0	1	1	1
PRT	sp|Q12768|WASC5_HUMAN	WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	1141-UNIMOD:267,1156-UNIMOD:267	0.01	19.0	1	1	1
PRT	sp|Q08495-3|DEMA_HUMAN	Isoform 3 of Dematin OS=Homo sapiens OX=9606 GN=DMTN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	248-UNIMOD:267,261-UNIMOD:188	0.05	19.0	1	1	1
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	160-UNIMOD:267,172-UNIMOD:188	0.02	19.0	2	1	0
PRT	sp|Q8TEX9|IPO4_HUMAN	Importin-4 OS=Homo sapiens OX=9606 GN=IPO4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19.0	null	457-UNIMOD:188	0.01	19.0	1	1	1
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	63-UNIMOD:188	0.03	19.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	517-UNIMOD:188,520-UNIMOD:188	0.01	19.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	20-UNIMOD:267,27-UNIMOD:267	0.08	19.0	1	1	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	25-UNIMOD:188	0.08	19.0	1	1	1
PRT	sp|Q9UIG0|BAZ1B_HUMAN	Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	1451-UNIMOD:267	0.01	19.0	1	1	1
PRT	sp|Q9Y4R8|TELO2_HUMAN	Telomere length regulation protein TEL2 homolog OS=Homo sapiens OX=9606 GN=TELO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	683-UNIMOD:28,691-UNIMOD:267,706-UNIMOD:267	0.03	19.0	1	1	1
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	180-UNIMOD:188,186-UNIMOD:267	0.02	19.0	1	1	1
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	31-UNIMOD:188	0.09	19.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	193-UNIMOD:188	0.09	18.0	1	1	1
PRT	sp|P16278-3|BGAL_HUMAN	Isoform 3 of Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	195-UNIMOD:188	0.03	18.0	1	1	1
PRT	sp|P14550|AK1A1_HUMAN	Alcohol dehydrogenase [NADP(+)] OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	96-UNIMOD:267,97-UNIMOD:188	0.04	18.0	1	1	1
PRT	sp|Q14451-2|GRB7_HUMAN	Isoform 2 of Growth factor receptor-bound protein 7 OS=Homo sapiens OX=9606 GN=GRB7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	358-UNIMOD:4,365-UNIMOD:267	0.03	18.0	1	1	1
PRT	sp|P84098|RL19_HUMAN	60S ribosomal protein L19 OS=Homo sapiens OX=9606 GN=RPL19 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	80-UNIMOD:188,81-UNIMOD:267	0.04	18.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	704-UNIMOD:188,714-UNIMOD:267	0.03	18.0	1	1	0
PRT	sp|Q9H1Y0-2|ATG5_HUMAN	Isoform Short of Autophagy protein 5 OS=Homo sapiens OX=9606 GN=ATG5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	126-UNIMOD:267,142-UNIMOD:188	0.10	18.0	1	1	1
PRT	sp|O43684-2|BUB3_HUMAN	Isoform 2 of Mitotic checkpoint protein BUB3 OS=Homo sapiens OX=9606 GN=BUB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	52-UNIMOD:188,62-UNIMOD:4,80-UNIMOD:188	0.10	18.0	1	1	1
PRT	sp|Q13123|RED_HUMAN	Protein Red OS=Homo sapiens OX=9606 GN=IK PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	4-UNIMOD:267,30-UNIMOD:188	0.05	18.0	1	1	1
PRT	sp|Q96GD0|PLPP_HUMAN	Pyridoxal phosphate phosphatase OS=Homo sapiens OX=9606 GN=PDXP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	99-UNIMOD:267,119-UNIMOD:267	0.08	18.0	1	1	1
PRT	sp|Q92688-2|AN32B_HUMAN	Isoform 2 of Acidic leucine-rich nuclear phosphoprotein 32 family member B OS=Homo sapiens OX=9606 GN=ANP32B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	6-UNIMOD:267,12-UNIMOD:267	0.04	18.0	1	1	1
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	132-UNIMOD:267,143-UNIMOD:267	0.03	18.0	1	1	1
PRT	sp|P99999|CYC_HUMAN	Cytochrome c OS=Homo sapiens OX=9606 GN=CYCS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	39-UNIMOD:267,40-UNIMOD:188	0.12	18.0	1	1	1
PRT	sp|P49915-2|GUAA_HUMAN	Isoform 2 of GMP synthase [glutamine-hydrolyzing] OS=Homo sapiens OX=9606 GN=GMPS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	300-UNIMOD:267,301-UNIMOD:188	0.02	18.0	1	1	1
PRT	sp|P34897-3|GLYM_HUMAN	Isoform 3 of Serine hydroxymethyltransferase, mitochondrial OS=Homo sapiens OX=9606 GN=SHMT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	248-UNIMOD:188,259-UNIMOD:188	0.04	18.0	1	1	1
PRT	sp|P19784|CSK22_HUMAN	Casein kinase II subunit alpha' OS=Homo sapiens OX=9606 GN=CSNK2A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18.0	null	279-UNIMOD:267	0.05	18.0	2	1	0
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	352-UNIMOD:188,360-UNIMOD:267	0.02	18.0	1	1	0
PRT	sp|P61764|STXB1_HUMAN	Syntaxin-binding protein 1 OS=Homo sapiens OX=9606 GN=STXBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	294-UNIMOD:188,305-UNIMOD:267	0.02	18.0	1	1	1
PRT	sp|Q6P1X6|CH082_HUMAN	UPF0598 protein C8orf82 OS=Homo sapiens OX=9606 GN=C8orf82 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18.0	null	107-UNIMOD:385,107-UNIMOD:4,110-UNIMOD:267,126-UNIMOD:267	0.10	18.0	1	1	1
PRT	sp|O15354|GPR37_HUMAN	Prosaposin receptor GPR37 OS=Homo sapiens OX=9606 GN=GPR37 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	154-UNIMOD:188	0.03	18.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	LHLGSTPHNLTDANIHELAR	1	sp|Q9UN37|VPS4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	20-UNIMOD:267	ms_run[2]:scan=5638	38.066	2	2218.1482	2218.1482	R	K	305	325
PSM	LAPITSDPTEATAVGAVEASFK	2	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	22-UNIMOD:188	ms_run[2]:scan=9945	67.975	2	2180.1308	2180.1308	R	C	401	423
PSM	KHLEINPDHSIIETLR	3	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=5687	38.365	2	1930.0607	1930.0607	K	Q	632	648
PSM	AHLGTALKANPFGGASHAK	4	sp|P62266|RS23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	8-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=3816	26.412	2	1859.0205	1859.0205	K	G	30	49
PSM	LVQDVANNTNEEAGDGTTTATVLAR	5	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	25-UNIMOD:267	ms_run[2]:scan=5746	38.758	2	2569.2495	2569.2495	K	S	97	122
PSM	MREIVHIQAGQCGNQIGAK	6	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3611	25.109795000000002	2	2141.085484	2141.080475	-	F	1	20
PSM	AISHEHSPSDLEAHFVPLVK	7	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	20-UNIMOD:188	ms_run[2]:scan=6434	43.289	2	2218.1478	2218.1478	R	R	114	134
PSM	IKSDFFELLSNHHLDSQSR	8	sp|O14776-2|TCRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	2-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=8167	55.249	2	2288.152	2288.1520	K	W	774	793
PSM	KHEAFESDLAAHQDR	9	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=2476	17.956	2	1768.8464	1768.8464	R	V	455	470
PSM	LFVGGIKEDTEEHHLR	10	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	7-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=4178	28.728	2	1894.9872	1894.9872	K	D	102	118
PSM	ASFNHFDKDHGGALGPEEFK	11	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5061	34.36	2	2214.0533	2214.0533	R	A	772	792
PSM	GLPVTCEVAPHHLFLSHDDLER	12	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=6706	45.071	2	2551.2517	2551.2517	R	L	1631	1653
PSM	KYVATLGVEVHPLVFHTNR	13	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=6580	44.216	2	2195.2186	2195.2186	K	G	38	57
PSM	TIAPTGHLHTVEFHQQR	14	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	36	17-UNIMOD:267	ms_run[1]:scan=3647	25.33612833333333	2	1982.028432	1981.015761	R	A	124	141
PSM	HLQLNETSTANHIHSR	15	sp|Q96HV5|TM41A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	16-UNIMOD:267	ms_run[2]:scan=2451	17.799	3	1866.9324	1866.9324	K	K	246	262
PSM	KHLEINPDHPIVETLR	16	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=4883	33.189	2	1926.0658	1926.0658	K	Q	624	640
PSM	LFVGGIKEDTEEHHLR	17	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=4355	29.858	2	1894.9872	1894.9872	K	D	102	118
PSM	LLEDGEDFNLGDALDSSNSMQTIQK	18	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	20-UNIMOD:35,25-UNIMOD:188	ms_run[2]:scan=9085	61.682	2	2761.2696	2761.2696	R	T	383	408
PSM	RFGVPVIADGGIQNVGHIAK	19	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=7237	48.619	3	2063.1611	2063.1611	R	A	356	376
PSM	RVHLMNPMVPGLTGSK	20	sp|P54577|SYYC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:267,16-UNIMOD:188	ms_run[2]:scan=6102	41.107	2	1751.951	1751.9510	K	M	207	223
PSM	SKSEEAHAEDSVMDHHFR	21	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=3046	21.487	2	2126.9411	2126.9411	K	K	307	325
PSM	HFLLEEDKPEEPTAHAFVSTLTR	22	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:188,23-UNIMOD:267	ms_run[2]:scan=7762	52.505	2	2682.3624	2682.3624	R	G	1516	1539
PSM	HLQLNETSTANHIHSR	23	sp|Q96HV5|TM41A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	16-UNIMOD:267	ms_run[2]:scan=2453	17.811	2	1866.9324	1866.9324	K	K	246	262
PSM	IMEHAGKNQVLVFVHSR	24	sp|O75643|U520_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=4762	32.439	2	1980.0698	1980.0698	K	K	712	729
PSM	SVTVVEDDEDEDGDDLLHHHHVSGSR	25	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	26-UNIMOD:267	ms_run[2]:scan=4515	30.879	2	2908.2735	2908.2735	R	R	546	572
PSM	LNFSHGTHEYHAETIK	26	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	16-UNIMOD:188	ms_run[1]:scan=3075	21.66719666666667	2	1888.922388	1888.916340	R	N	74	90
PSM	AHMESDKHLEALCLFK	27	sp|P52948-6|NUP98_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:188,13-UNIMOD:4,16-UNIMOD:188	ms_run[2]:scan=6233	41.935	2	1939.9687	1939.9687	R	A	1521	1537
PSM	KEHVNVVFIGHVDAGK	28	sp|P15170|ERF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4401	30.151	2	1759.9772	1759.9772	K	S	72	88
PSM	MKVVEVLAGHGHLYSR	29	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=5293	35.869	2	1810.9847	1810.9847	K	I	1240	1256
PSM	RLPNNHIGISFIPR	30	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6211	41.796	2	1652.9378	1652.9378	K	E	1956	1970
PSM	TYADYESVNECMEGVCK	31	sp|P84090|ERH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:4,16-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=6304	42.406	2	2059.8269	2059.8269	R	M	18	35
PSM	FSVVSDKNHMHFGAITCAMGIR	32	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:188,17-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=7803	52.796	2	2493.205	2493.2050	K	F	257	279
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	33	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	24-UNIMOD:267	ms_run[2]:scan=6004	40.488	2	2556.2531	2556.2531	R	Q	96	120
PSM	SEHKLSTDHIPILYR	34	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=5151	34.936	2	1823.9865	1823.9865	R	T	213	228
PSM	TFHHVYSGKDLIAQAR	35	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=3971	27.366	2	1857.9821	1857.9821	K	T	148	164
PSM	THINIVVIGHVDSGK	36	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:188	ms_run[2]:scan=5173	35.083	2	1593.8934	1593.8934	K	S	6	21
PSM	TLLLQGHHDKVQSLCYLQLTR	37	sp|Q8IWB7|WDFY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:188,15-UNIMOD:4,21-UNIMOD:267	ms_run[2]:scan=7068	47.499	2	2538.3712	2538.3712	R	Q	235	256
PSM	GADINAPDKHHITPLLSAVYEGHVSCVK	38	sp|P58546|MTPN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:188,26-UNIMOD:4,28-UNIMOD:188	ms_run[2]:scan=6682	44.918	3	3039.5639	3039.5639	K	L	58	86
PSM	LHALVVGPGLGRDDALLR	39	sp|Q8IW45-4|NNRD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:267,18-UNIMOD:267	ms_run[2]:scan=7249	48.692	2	1891.0907	1891.0907	R	N	35	53
PSM	LNFSHGTHEYHAETIK	40	sp|P14618|KPYM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	16-UNIMOD:188	ms_run[2]:scan=3229	22.682	2	1888.9163	1888.9163	R	N	74	90
PSM	TFHHVYSGKDLIAQAR	41	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	9-UNIMOD:188,16-UNIMOD:267	ms_run[1]:scan=3963	27.321223333333332	3	1858.001973	1857.982064	K	T	216	232
PSM	AYSEAHEISKEHMQPTHPIR	42	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=2790	19.89	2	2376.1616	2376.1616	K	L	153	173
PSM	FRHENIIGINDIIR	43	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=7174	48.207	2	1728.9538	1728.9538	R	A	78	92
PSM	GLPVTCEVAPHHLFLSHDDLER	44	sp|P27708|PYR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4,22-UNIMOD:267	ms_run[2]:scan=6700	45.033	3	2551.2517	2551.2517	R	L	1631	1653
PSM	HAEMVHTGLKLER	45	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=3022	21.347	2	1535.8213	1535.8213	K	A	71	84
PSM	HFCPNVPIILVGNKK	46	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6554	44.055	2	1747.0006	1747.0006	K	D	105	120
PSM	KEPFFHGHDNYDQLVR	47	sp|P68400-2|CSK21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=4937	33.532	2	2016.9777	2016.9777	R	I	93	109
PSM	KHLEINPDHPIVETLR	48	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=4875	33.142	3	1926.0658	1926.0658	K	Q	624	640
PSM	KYVATLGVEVHPLVFHTNR	49	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=6582	44.228	3	2195.2186	2195.2186	K	G	38	57
PSM	NPDDITQEEYGEFYK	50	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:188	ms_run[2]:scan=6895	46.343	2	1852.8099	1852.8099	R	S	292	307
PSM	SFFHQHYLGGQEPTPSNIR	51	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	19-UNIMOD:267	ms_run[2]:scan=5574	37.657	2	2224.0689	2224.0689	R	M	655	674
PSM	SNDLFPVHHLDNNEFCPGDFVVDKR	52	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	16-UNIMOD:4,24-UNIMOD:188,25-UNIMOD:267	ms_run[2]:scan=8516	57.676	3	2986.4003	2986.4003	R	V	570	595
PSM	THINIVVIGHVDSGKSTTTGHLIYK	53	sp|P68104-2|EF1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:188,25-UNIMOD:188	ms_run[2]:scan=5744	38.742	3	2701.4954	2701.4954	K	C	6	31
PSM	VDATEESDLAQQYGVR	54	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	16-UNIMOD:267	ms_run[2]:scan=6218	41.842	2	1789.8358	1789.8358	K	G	82	98
PSM	VYSTVTEECVHILHGHR	55	sp|Q8IWA0|WDR75_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=4616	31.516	2	2045.9981	2045.9981	K	N	41	58
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	56	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	9-UNIMOD:267,30-UNIMOD:267	ms_run[1]:scan=9334	63.54810666666666	3	3327.759761	3327.747863	R	L	2234	2264
PSM	LNSVQSSERPLFLVHPIEGSTTVFHSLASR	57	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	9-UNIMOD:267,30-UNIMOD:267	ms_run[1]:scan=9293	63.17288833333333	4	3327.760339	3327.747863	R	L	2234	2264
PSM	ANGTTVHVGIHPSKVVITR	58	sp|P61254|RL26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=3881	26.807	2	2001.1454	2001.1454	K	L	90	109
PSM	DLHDANTDLIGRHPK	59	sp|P53985-2|MOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:267,15-UNIMOD:188	ms_run[2]:scan=3154	22.155	2	1716.8878	1716.8878	K	Q	225	240
PSM	FRAPDEPQQAQVPHVWGWEVAGAPALR	60	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:267,27-UNIMOD:267	ms_run[2]:scan=9158	62.19	3	3031.532	3031.5320	R	L	511	538
PSM	HGVSHKVDDSSGSIGR	61	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=968	8.6025	3	1652.8201	1652.8201	R	R	641	657
PSM	HLDHVAALFPGDVDR	62	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:267	ms_run[2]:scan=6110	41.157	2	1670.8404	1670.8404	R	L	411	426
PSM	KLNCQVIGASVDSHFCHLAWVNTPK	63	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:188,4-UNIMOD:4,16-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=7919	53.566	2	2892.4566	2892.4566	K	K	68	93
PSM	LHQLAMQQSHFPMTHGNTGFSGIESSSPEVK	64	sp|Q15366-4|PCBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	31-UNIMOD:188	ms_run[2]:scan=6440	43.328	3	3387.6072	3387.6072	K	G	211	242
PSM	NPDDITNEEYGEFYK	65	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:188	ms_run[2]:scan=6703	45.049	2	1838.7942	1838.7942	R	S	300	315
PSM	PPSAFFLFCSEHRPK	66	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:4,13-UNIMOD:267,15-UNIMOD:188	ms_run[2]:scan=7385	49.542	2	1834.916	1834.9160	R	I	98	113
PSM	SGAFGHLFRPDNFIFGQSGAGNNWAK	67	sp|Q13509-2|TBB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:267,26-UNIMOD:188	ms_run[2]:scan=10045	68.713	3	2810.3648	2810.3648	R	G	6	32
PSM	SLCEQVSHHPPAAAHHAESK	68	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=1499	11.831	2	2198.0383	2198.0383	R	N	515	535
PSM	TEWLDGKHVVFGK	69	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5959	40.199	2	1526.8284	1526.8284	K	V	59	72
PSM	FRQHMENEMAHYACDCWDAESK	70	sp|P41250|GARS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:267,14-UNIMOD:4,16-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=6111	41.162	3	2830.1327	2830.1327	R	T	429	451
PSM	HHCLELAKEADLDVATITK	71	sp|P57740-2|NU107_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4,8-UNIMOD:188,19-UNIMOD:188	ms_run[2]:scan=6342	42.676	2	2175.1397	2175.1397	R	T	590	609
PSM	IGKVTSEELHYFVQNHFTSAR	72	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=7201	48.385	3	2478.2627	2478.2627	R	M	197	218
PSM	KIHEEFSEHALLR	73	sp|Q9Y2L1-2|RRP44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=4136	28.464	2	1623.8704	1623.8704	K	K	647	660
PSM	LKHEHCEELLTQALSGR	74	sp|O43150-2|ASAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:188,6-UNIMOD:4,17-UNIMOD:267	ms_run[2]:scan=5425	36.706	2	2036.0444	2036.0444	R	F	664	681
PSM	NSLKELWLVIHGR	75	sp|O43169|CYB5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=9082	61.665	2	1579.9169	1579.9169	R	V	32	45
PSM	RPHDYQPLPGMSENPSVYVPGVVSTVVPDSAHK	76	sp|P26368-2|U2AF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:267,33-UNIMOD:188	ms_run[2]:scan=9007	61.162	3	3574.7849	3574.7850	R	L	228	261
PSM	TFHHVYSGKDLIAQAR	77	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=3966	27.337	4	1857.9821	1857.9821	K	T	148	164
PSM	VDATAETDLAK	78	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:188	ms_run[2]:scan=3081	21.701	2	1138.5813	1138.5813	K	R	235	246
PSM	VPWVCPRPLVLPSPLVTPGSNSQER	79	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4,7-UNIMOD:267,25-UNIMOD:267	ms_run[2]:scan=10023	68.55	3	2804.491	2804.4910	K	Y	459	484
PSM	FDCHHCNESLFGKK	80	sp|Q14192-2|FHL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=2982	21.094	2	1789.8067	1789.8067	R	Y	5	19
PSM	FLEHKGPVFAPPYEPLPENVK	81	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:188,21-UNIMOD:188	ms_run[2]:scan=7413	49.727	2	2419.2979	2419.2979	K	F	219	240
PSM	FRHENIIGINDIIR	82	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=7178	48.235	3	1728.9538	1728.9538	R	A	78	92
PSM	HHLDLGHNSQAYEALTQIPDSSR	83	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	23-UNIMOD:267	ms_run[2]:scan=6367	42.85	2	2598.245	2598.2450	K	Q	1007	1030
PSM	HLLIGVSSDRGLCGAIHSSIAK	84	sp|P36542-2|ATPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:267,13-UNIMOD:4,22-UNIMOD:188	ms_run[2]:scan=6340	42.664	2	2306.25	2306.2500	K	Q	91	113
PSM	KHLEINPDHSIIETLR	85	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=5686	38.36	3	1930.0607	1930.0607	K	Q	632	648
PSM	KHQALQAEIAGHEPR	86	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=2684	19.235	2	1699.9089	1699.9089	K	I	825	840
PSM	LLEDGEDFNLGDALDSSNSMQTIQK	87	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	25-UNIMOD:188	ms_run[2]:scan=9784	66.822	2	2745.2746	2745.2746	R	T	383	408
PSM	VGHSIRHPDVEVDGFSELR	88	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=5592	37.773	3	2168.0878	2168.0878	K	W	60	79
PSM	AIWSQPELAYEEHHAHR	89	sp|Q8IYS1|P20D2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	17-UNIMOD:267	ms_run[1]:scan=5335	36.138803333333335	2	2083.987129	2082.989941	R	V	44	61
PSM	ERHPGSFDVVHVK	90	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:267,13-UNIMOD:188	ms_run[2]:scan=2958	20.957	2	1521.8023	1521.8023	R	D	199	212
PSM	GDDTPLHLAASHGHR	91	sp|Q13418-2|ILK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:267	ms_run[2]:scan=2709	19.395	2	1592.7683	1592.7683	R	D	66	81
PSM	HLEIFHTEFQNLLDADKNEDLGR	92	sp|Q13616|CUL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	17-UNIMOD:188,23-UNIMOD:267	ms_run[2]:scan=9490	64.743	3	2769.3693	2769.3693	K	M	299	322
PSM	HQLVHTGEKPFQCTFEGCGK	93	sp|O15391|TYY2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:188,13-UNIMOD:4,18-UNIMOD:4,20-UNIMOD:188	ms_run[2]:scan=4233	29.079	2	2371.124	2371.1240	R	R	301	321
PSM	LQFHDVAGDIFHQQCKR	94	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:4,16-UNIMOD:188,17-UNIMOD:267	ms_run[2]:scan=6536	43.94	3	2114.0451	2114.0451	R	N	371	388
PSM	MIKPFFHSLSEK	95	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=5605	37.858	2	1474.8045	1474.8045	K	Y	37	49
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	96	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35,24-UNIMOD:267	ms_run[2]:scan=5507	37.239	2	2572.248	2572.2480	R	Q	96	120
PSM	NQLNPIGSLQELAIHHGWR	97	sp|O75569-3|PRKRA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	19-UNIMOD:267	ms_run[2]:scan=10165	69.67	2	2192.1478	2192.1478	K	L	98	117
PSM	NVTLCGHLHHGK	98	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4,12-UNIMOD:188	ms_run[2]:scan=1640	12.71	2	1377.7031	1377.7031	R	T	96	108
PSM	PPSAFFLFCSEHRPK	99	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:4,13-UNIMOD:267,15-UNIMOD:188	ms_run[2]:scan=7378	49.504	3	1834.916	1834.9160	R	I	98	113
PSM	SHRDPYATSVGHLIEK	100	sp|O75674-2|TM1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:267,16-UNIMOD:188	ms_run[2]:scan=4009	27.608	2	1824.9453	1824.9453	K	A	6	22
PSM	SKIVGAPMHDLLLWNNATVTTCHSK	101	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:188,22-UNIMOD:4,25-UNIMOD:188	ms_run[2]:scan=7905	53.468	3	2804.4504	2804.4504	R	T	174	199
PSM	SKSEEAHAEDSVMDHHFR	102	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:188,18-UNIMOD:267	ms_run[2]:scan=3043	21.471	3	2126.9411	2126.9411	K	K	307	325
PSM	SPVKVTLSEGPHHVALFK	103	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5475	37.03	2	1957.1188	1957.1188	R	D	289	307
PSM	STGEAFVQFASQEIAEK	104	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	17-UNIMOD:188	ms_run[2]:scan=9617	65.627	2	1846.9044	1846.9044	R	A	151	168
PSM	TDWLDGKHVVFGHVK	105	sp|P30405|PPIF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6080	40.969	2	1748.9401	1748.9401	K	E	161	176
PSM	TGHYTLIHDHSK	106	sp|Q8N543-2|OGFD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:188	ms_run[2]:scan=1529	12.012	2	1413.7096	1413.7096	K	A	304	316
PSM	TVYCNVHKHEPLVLFCESCDTLTCR	107	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4,8-UNIMOD:188,16-UNIMOD:4,19-UNIMOD:4,24-UNIMOD:4,25-UNIMOD:267	ms_run[2]:scan=6815	45.773	3	3153.4475	3153.4475	R	D	124	149
PSM	VLSAPPHFHFGQTNR	108	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:267	ms_run[2]:scan=5083	34.495	2	1716.8724	1716.8724	R	T	31	46
PSM	RAGLGSGLSLSGLVHPELSR	109	sp|P49748|ACADV_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:267,20-UNIMOD:267	ms_run[1]:scan=8170	55.267965000000004	3	2026.133420	2025.123410	R	S	512	532
PSM	EKHAHSILQFQFAEVK	110	sp|Q32MZ4-4|LRRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=6544	43.991	2	1923.0405	1923.0405	R	E	351	367
PSM	GNRPVILTYHDIGLNHK	111	sp|Q9UGV2-2|NDRG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:267,17-UNIMOD:188	ms_run[2]:scan=5314	36.007	2	1962.077	1962.0770	K	S	40	57
PSM	GVDEVTIVNILTNR	112	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:267	ms_run[2]:scan=10702	74.047	2	1551.8496	1551.8496	K	S	50	64
PSM	HFLLEEDKPEEPTAHAFVSTLTR	113	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:188,23-UNIMOD:267	ms_run[2]:scan=7757	52.471	4	2682.3624	2682.3624	R	G	1516	1539
PSM	HLEINPDHPIVETLR	114	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:267	ms_run[2]:scan=6024	40.615	2	1791.9507	1791.9507	K	Q	625	640
PSM	HPELADKNVPNLHVMK	115	sp|P46783|RS10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=4428	30.313	2	1853.002	1853.0020	K	A	32	48
PSM	HQADACHAYQIIHR	116	sp|Q99538-3|LGMN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4,14-UNIMOD:267	ms_run[2]:scan=2916	20.687	3	1728.8142	1728.8142	R	N	45	59
PSM	HYGEHVCTAKLPK	117	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:4,10-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2161	15.975	2	1550.8066	1550.8066	R	Q	332	345
PSM	IHTLELKLEESHNR	118	sp|Q8N163-2|CCAR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:188,14-UNIMOD:267	ms_run[2]:scan=3973	27.375	3	1733.9395	1733.9395	K	F	833	847
PSM	KNTDLYHCLLEHLQR	119	sp|Q8WVV4-3|POF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:188,8-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=8495	57.528	2	1955.0018	1955.0018	R	I	267	282
PSM	LAQALHEMREQHDAQVR	120	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:35,9-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=1662	12.842	2	2067.0183	2067.0183	K	L	242	259
PSM	LAQALHEMREQHDAQVR	121	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=2821	20.092	3	2051.0234	2051.0234	K	L	242	259
PSM	LCHIAFHVPAGQPLAR	122	sp|Q96IR7|HPDL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4,16-UNIMOD:267	ms_run[2]:scan=6078	40.956	2	1795.9543	1795.9543	R	N	8	24
PSM	LFVGGIKEDTEEHHLR	123	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=4351	29.839	3	1894.9872	1894.9872	K	D	102	118
PSM	RLDLFQEHMFEVLER	124	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=10030	68.598	3	1980.9995	1980.9995	R	A	836	851
PSM	TKAEHLDHVMFR	125	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:188,12-UNIMOD:267	ms_run[2]:scan=3097	21.801	2	1498.7686	1498.7686	R	M	30	42
PSM	VHSQGPHHVCELCNK	126	sp|P56270-4|MAZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:4,13-UNIMOD:4,15-UNIMOD:188	ms_run[2]:scan=1157	9.7404	2	1806.8349	1806.8349	K	G	107	122
PSM	VRESGSLSPEHGPVVVHCSAGIGR	127	sp|P18031|PTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:267,18-UNIMOD:4,24-UNIMOD:267	ms_run[2]:scan=3846	26.594	3	2506.2614	2506.2614	K	S	198	222
PSM	YHTINGHNAEVRK	128	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:267,13-UNIMOD:188	ms_run[2]:scan=999	8.7927	2	1553.8034	1553.8034	K	A	162	175
PSM	LAQHITYVHQHSR	129	sp|P33993|MCM7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	13-UNIMOD:267	ms_run[1]:scan=1528	12.006746666666666	2	1598.838691	1598.830527	R	Q	533	546
PSM	ASFNHFDKDHGGALGPEEFK	130	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=5052	34.303	3	2214.0533	2214.0533	R	A	772	792
PSM	CMQLTDFILKFPHSAHQK	131	sp|P50914|RL14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:4,10-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=9112	61.864	2	2212.1324	2212.1324	K	Y	54	72
PSM	DQQEAALVDMVNDGVEDLR	132	sp|P09211|GSTP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	19-UNIMOD:267	ms_run[2]:scan=11035	77.012	2	2125.9825	2125.9825	K	C	83	102
PSM	ERHPGSFDVVHVK	133	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:267,13-UNIMOD:188	ms_run[2]:scan=2967	21.008	3	1521.8023	1521.8023	R	D	199	212
PSM	FGLSVGHHLGK	134	sp|P15559-3|NQO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:188	ms_run[2]:scan=3861	26.688	2	1156.6449	1156.6449	K	S	214	225
PSM	HLAVMPHPER	135	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:267	ms_run[2]:scan=2499	18.089	3	1195.616	1195.6160	R	A	1291	1301
PSM	IHQHILPQGQGMLSGIGR	136	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	18-UNIMOD:267	ms_run[2]:scan=6060	40.841	2	1951.045	1951.0450	K	K	240	258
PSM	IWHHTFYNELR	137	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:267	ms_run[2]:scan=4795	32.645	2	1524.7502	1524.7502	K	V	85	96
PSM	KEPFFHGHDNYDQLVR	138	sp|P68400-2|CSK21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=4943	33.572	3	2016.9777	2016.9777	R	I	93	109
PSM	KGWLSLHTGNLDGEDHAAER	139	sp|Q96EL2|RT24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:188,20-UNIMOD:267	ms_run[2]:scan=5315	36.013	3	2221.0847	2221.0847	R	T	66	86
PSM	MKVVEVLAGHGHLYSR	140	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=5283	35.805	3	1810.9847	1810.9847	K	I	1240	1256
PSM	SGGASHSELIHNLRK	141	sp|P22061|PIMT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:267,15-UNIMOD:188	ms_run[2]:scan=2205	16.25	2	1620.8667	1620.8667	K	N	5	20
PSM	SIYGEKFEDENFILK	142	sp|P62937-2|PPIA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=8128	54.982	2	1842.9442	1842.9442	K	H	17	32
PSM	TYHYHCALHDK	143	sp|Q8IWS0-4|PHF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=1408	11.27	2	1449.6555	1449.6555	R	A	102	113
PSM	VILHGEHAVVHGK	144	sp|Q03426|KIME_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	13-UNIMOD:188	ms_run[1]:scan=1569	12.264735	2	1401.807518	1400.798397	K	V	14	27
PSM	RNLFAEIIEEHLANR	145	sp|Q9NWY4|HPF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:267,15-UNIMOD:267	ms_run[1]:scan=10199	69.92375666666666	3	1843.978966	1843.980769	K	S	322	337
PSM	DLLHNEDRHDDYFQER	146	sp|Q8N684-2|CPSF7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=4998	33.959	2	2120.9415	2120.9415	R	N	431	447
PSM	ELAQQVQQVADDYGK	147	sp|Q92841-1|DDX17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:188	ms_run[2]:scan=7104	47.736	2	1696.8364	1696.8364	R	C	176	191
PSM	EMVELPLRHPALFK	148	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:267,14-UNIMOD:188	ms_run[2]:scan=7360	49.4	2	1694.9513	1694.9513	K	A	218	232
PSM	HFCPNVPIILVANKK	149	sp|P62745|RHOB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6686	44.945	3	1761.0162	1761.0162	K	D	105	120
PSM	HFCPNVPIILVGNKK	150	sp|P61586|RHOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6561	44.1	3	1747.0006	1747.0006	K	D	105	120
PSM	HGVSHKVDDSSGSIGR	151	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=974	8.6399	2	1652.8201	1652.8201	R	R	641	657
PSM	HHGIPFYVAAPSSSCDLR	152	sp|Q9BV20-2|MTNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:4,18-UNIMOD:267	ms_run[2]:scan=6022	40.602	2	2022.9609	2022.9609	K	L	224	242
PSM	HLTSRHPEAEMAQNSVR	153	sp|P14923|PLAK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:267,17-UNIMOD:267	ms_run[2]:scan=2049	15.277	2	1981.9655	1981.9655	R	L	461	478
PSM	HMGLFDHAAR	154	sp|P50213-2|IDH3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:267	ms_run[2]:scan=3370	23.599	3	1163.5534	1163.5534	R	I	239	249
PSM	IHFVPGWDCHGLPIEIK	155	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=9065	61.556	2	2023.0445	2023.0445	K	V	147	164
PSM	LAQHITYVHQHSR	156	sp|P33993-3|MCM7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:267	ms_run[2]:scan=1530	12.018	3	1598.8305	1598.8305	R	Q	357	370
PSM	LFVGGIKEDTEEHHLR	157	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=4185	28.773	3	1894.9872	1894.9872	K	D	102	118
PSM	MIPCDFLIPVQTQHPIRK	158	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35,4-UNIMOD:4,17-UNIMOD:267,18-UNIMOD:188	ms_run[2]:scan=7217	48.487	2	2224.1831	2224.1831	K	G	401	419
PSM	NLPLPPPPPPR	159	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:267	ms_run[2]:scan=5522	37.33	2	1203.7003	1203.7003	R	G	282	293
PSM	RTDLCDHALHISHDEL	160	sp|Q9Y2B0|CNPY2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:267,5-UNIMOD:4	ms_run[2]:scan=5036	34.2	2	1940.9038	1940.9038	K	-	167	183
PSM	THVDSHGHNVFK	161	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:188	ms_run[2]:scan=1226	10.164	2	1382.6787	1382.6787	R	E	205	217
PSM	TRDELEVIHLIEEHR	162	sp|P10155-3|RO60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=7776	52.602	3	1907.9968	1907.9968	R	L	238	253
PSM	YDYNSGEELESYKGHFGPIHCVR	163	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:188,21-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=6217	41.835	2	2772.2573	2772.2573	K	F	250	273
PSM	DHRDNLEFFLAGIGR	164	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:267,15-UNIMOD:267	ms_run[1]:scan=9896	67.62514833333333	3	1778.896853	1778.896705	K	L	788	803
PSM	QGTHITVVSHSRPVGHCLEAAAVLSK	165	sp|P11177|ODPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,12-UNIMOD:267,17-UNIMOD:4,26-UNIMOD:188	ms_run[1]:scan=5440	36.80341333333334	3	2752.4469	2752.4408	R	E	233	259
PSM	STNGDTFLGGEDFDQALLR	166	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	19-UNIMOD:267	ms_run[1]:scan=10294	70.67802666666667	2	2065.945092	2064.962782	K	H	266	285
PSM	AIEALHGHELRPGR	167	sp|Q96PK6-3|RBM14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=2749	19.635	2	1574.8544	1574.8544	R	A	51	65
PSM	APIRPDIVNFVHTNLR	168	sp|P36578|RL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=7855	53.139	3	1881.0488	1881.0488	K	K	30	46
PSM	CRDDSFFGETSHNYHK	169	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,2-UNIMOD:267,16-UNIMOD:188	ms_run[2]:scan=3477	24.276	2	2014.8563	2014.8563	R	F	230	246
PSM	GIGHTTGKPLHFK	170	sp|Q08752|PPID_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=2137	15.829	2	1403.8076	1403.8076	K	G	57	70
PSM	GKDQVVILHHMLSK	171	sp|Q9H0A0|NAT10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=4510	30.846	2	1615.9271	1615.9271	R	A	33	47
PSM	HASHISKLPK	172	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=926	8.355	2	1128.6806	1128.6806	K	G	934	944
PSM	HKGPPVFTQEER	173	sp|Q99447-4|PCY2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:188,12-UNIMOD:267	ms_run[2]:scan=2313	16.93	2	1439.7492	1439.7492	K	Y	33	45
PSM	HLDHVAALFPGDVDR	174	sp|P11216|PYGB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:267	ms_run[2]:scan=6120	41.22	3	1670.8404	1670.8404	R	L	411	426
PSM	HLQLAIRNDEELNK	175	sp|Q99878|H2A1J_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:267,14-UNIMOD:188	ms_run[2]:scan=4358	29.873	2	1707.9239	1707.9239	R	L	83	97
PSM	HRHPECYVCTDCGTNLK	176	sp|O00151|PDLI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:267,6-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4,17-UNIMOD:188	ms_run[2]:scan=2652	19.031	3	2161.9427	2161.9427	R	Q	278	295
PSM	IQKHQEHILR	177	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:188,10-UNIMOD:267	ms_run[2]:scan=1026	8.9516	2	1316.7648	1316.7648	K	F	256	266
PSM	KHQALQAEIAGHEPR	178	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=2691	19.281	3	1699.9089	1699.9089	K	I	825	840
PSM	LRQHHDEYEDEIR	179	sp|O75976-2|CBPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=2050	15.283	3	1758.8188	1758.8188	R	M	1090	1103
PSM	MIKPFFHSLSEK	180	sp|P10599|THIO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=4886	33.204	2	1490.7994	1490.7994	K	Y	37	49
PSM	NLPLPPPPPPR	181	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:267	ms_run[2]:scan=5683	38.346	2	1203.7003	1203.7003	R	G	282	293
PSM	SFFHQHYLGGQEPTPSNIR	182	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	19-UNIMOD:267	ms_run[2]:scan=5573	37.652	3	2224.0689	2224.0689	R	M	655	674
PSM	TIAPTGHLHTVEFHQQR	183	sp|Q96FX7|TRM61_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:267	ms_run[2]:scan=3649	25.348	3	1981.0158	1981.0158	R	A	124	141
PSM	TRDELEVIHLIEEHR	184	sp|P10155-3|RO60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:267,15-UNIMOD:267	ms_run[2]:scan=7758	52.478	2	1907.9968	1907.9968	R	L	238	253
PSM	SKPHSEAGTAFIQTQQLHAAMADTFLEHMCR	185	sp|P14618|KPYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,2-UNIMOD:188,30-UNIMOD:4,31-UNIMOD:267	ms_run[1]:scan=9887	67.56507833333333	3	3570.6718	3570.6772	M	L	2	33
PSM	CINHLHKTELHGK	186	sp|Q15424|SAFB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:188,13-UNIMOD:188	ms_run[1]:scan=2554	18.423241666666666	2	1580.8336	1580.8279	K	M	463	476
PSM	QLLHNFPPDQLTSSGAPFWSGPKR	187	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,23-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=10162	69.65166166666667	3	2678.3569	2678.3571	R	C	724	748
PSM	TLVDHHKEELER	188	sp|Q15652|JHD2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:188,12-UNIMOD:267	ms_run[1]:scan=1752	13.405703333333333	2	1520.787920	1520.791804	K	K	949	961
PSM	MREIVHIQAGQCGNQIGAK	189	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35,2-UNIMOD:267,12-UNIMOD:4,19-UNIMOD:188	ms_run[1]:scan=3609	25.09918	3	2141.086386	2141.080475	-	F	1	20
PSM	AIEALHGHELRPGR	190	sp|Q96PK6-3|RBM14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=2736	19.559	3	1574.8544	1574.8544	R	A	51	65
PSM	ERHPGSFDVVHVK	191	sp|P62701|RS4X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:267,13-UNIMOD:188	ms_run[2]:scan=2976	21.061	4	1521.8023	1521.8023	R	D	199	212
PSM	ETVSEESNVLCLSK	192	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:4,14-UNIMOD:188	ms_run[2]:scan=6070	40.905	2	1599.7757	1599.7757	R	S	581	595
PSM	GLVLDHGARHPDMK	193	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:267,14-UNIMOD:188	ms_run[2]:scan=2539	18.332	2	1560.8166	1560.8166	R	K	164	178
PSM	HDNLLHGTKK	194	sp|P25205|MCM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=867	8.0059	2	1173.6657	1173.6657	K	K	548	558
PSM	HFCPNVPIILVANKK	195	sp|P62745|RHOB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:4,14-UNIMOD:188,15-UNIMOD:188	ms_run[2]:scan=6687	44.95	2	1761.0162	1761.0162	K	D	105	120
PSM	HIDPFDLTHFLAQGR	196	sp|Q04912-7|RON_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:267	ms_run[2]:scan=10170	69.706	3	1775.8983	1775.8983	R	R	1184	1199
PSM	HRPQLLVER	197	sp|P47897-2|SYQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:267,9-UNIMOD:267	ms_run[2]:scan=2504	18.121	3	1166.6787	1166.6787	R	Y	122	131
PSM	HSILDTHGRK	198	sp|Q7Z6K5|ARPIN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:267,10-UNIMOD:188	ms_run[2]:scan=1139	9.6312	2	1178.6491	1178.6491	R	E	47	57
PSM	IWHHTFYNELR	199	sp|P63261|ACTG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:267	ms_run[2]:scan=4797	32.654	3	1524.7502	1524.7502	K	V	85	96
PSM	KLEHLITELVHQR	200	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=6131	41.287	3	1630.949	1630.9490	R	D	1807	1820
PSM	KPHIIIATPGR	201	sp|Q9H0S4|DDX47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:188,11-UNIMOD:267	ms_run[2]:scan=2963	20.982	2	1217.7579	1217.7579	K	L	142	153
PSM	LHFFMPGFAPLTSR	202	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:267	ms_run[2]:scan=10451	71.959	2	1629.8365	1629.8365	R	G	263	277
PSM	MVVNEGSDGGQSVYHVHLHVLGGR	203	sp|P49773|HINT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	24-UNIMOD:267	ms_run[2]:scan=6013	40.544	4	2556.2531	2556.2531	R	Q	96	120
PSM	RFGVPVIADGGIQNVGHIAK	204	sp|P12268|IMDH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:267,20-UNIMOD:188	ms_run[2]:scan=7239	48.63	2	2063.1611	2063.1611	R	A	356	376
PSM	RIHQESELHSYLSR	205	sp|Q9UNE7-2|CHIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=3411	23.858	2	1773.9025	1773.9025	R	L	82	96
PSM	RPPGVLHCTTK	206	sp|P09543-2|CN37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:267,8-UNIMOD:4,11-UNIMOD:188	ms_run[2]:scan=1314	10.697	2	1280.6994	1280.6994	K	F	225	236
PSM	RVGIIAWHPTAR	207	sp|Q9BR76|COR1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=4720	32.177	3	1395.8002	1395.8002	K	N	134	146
PSM	SLRDLTPEHLPLLR	208	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=7864	53.196	2	1678.9633	1678.9633	R	N	229	243
PSM	SPVKVTLSEGPHHVALFK	209	sp|O60313-13|OPA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=5485	37.095	3	1957.1188	1957.1188	R	D	289	307
PSM	THINIVVIGHVDSGK	210	sp|P68104-2|EF1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:188	ms_run[2]:scan=5179	35.124	3	1593.8934	1593.8934	K	S	6	21
PSM	TLNAHEHFVTSLDFHK	211	sp|P43034|LIS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	16-UNIMOD:188	ms_run[2]:scan=5355	36.263	2	1900.9527	1900.9527	K	T	375	391
PSM	TQNDVDIADVAYYFEK	212	sp|P16422|EPCAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	16-UNIMOD:188	ms_run[2]:scan=10647	73.634	2	1895.8885	1895.8885	K	D	203	219
PSM	TVIIHDRPDITHPR	213	sp|Q9NWH9-3|SLTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=3069	21.629	2	1688.9225	1688.9225	R	H	424	438
PSM	YDYNSGEELESYKGHFGPIHCVR	214	sp|Q9Y3F4|STRAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:188,21-UNIMOD:4,23-UNIMOD:267	ms_run[2]:scan=6202	41.741	3	2772.2573	2772.2573	K	F	250	273
PSM	IDQLEGDHQLIQEALIFDNKHTNYTMEHIR	215	sp|P12814|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	20-UNIMOD:188,30-UNIMOD:267	ms_run[1]:scan=9320	63.391130000000004	4	3636.810252	3636.796578	K	V	685	715
PSM	VVQHFVHCIETHGR	216	sp|Q14643|ITPR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4,14-UNIMOD:267	ms_run[1]:scan=3297	23.13480666666667	3	1728.863723	1727.855362	R	N	1301	1315
PSM	AMGIMNSFVNDIFER	217	sp|Q99880|H2B1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	15-UNIMOD:267	ms_run[2]:scan=11728	85.266	2	1752.8203	1752.8203	K	I	59	74
PSM	CTAGTLHNLSHHR	218	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=1431	11.41	2	1512.7243	1512.7243	R	E	213	226
PSM	EKPLALYVFSHNHK	219	sp|P51648|AL3A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:188,14-UNIMOD:188	ms_run[2]:scan=5213	35.347	2	1693.9343	1693.9343	R	L	356	370
PSM	GATYGKPVHHGVNQLK	220	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:188,16-UNIMOD:188	ms_run[2]:scan=1454	11.554	2	1716.9462	1716.9462	K	F	78	94
PSM	GHDEREHPFLVK	221	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:267,12-UNIMOD:188	ms_run[2]:scan=2482	17.989	2	1478.7601	1478.7601	R	G	3742	3754
PSM	GVEKPPHLAALILAR	222	sp|Q8NFW8-2|NEUA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:188,15-UNIMOD:267	ms_run[2]:scan=6835	45.924	3	1599.9795	1599.9795	R	G	38	53
PSM	HAFRPTNAATATSHSTASR	223	sp|Q9HB21|PKHA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:267,19-UNIMOD:267	ms_run[2]:scan=1400	11.221	3	2002.9836	2002.9836	K	S	311	330
PSM	HDPHKLLEGCLVGGR	224	sp|P49821-2|NDUV1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:188,10-UNIMOD:4,15-UNIMOD:267	ms_run[2]:scan=4371	29.956	3	1702.8908	1702.8908	R	A	124	139
PSM	HFRPELEER	225	sp|P49821-2|NDUV1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:267,9-UNIMOD:267	ms_run[2]:scan=2525	18.249	3	1231.6213	1231.6213	R	M	432	441
PSM	HHASISELKK	226	sp|P11171-6|41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=1054	9.1135	2	1160.6705	1160.6705	K	N	383	393
PSM	HHASISELKK	227	sp|P11171-6|41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:188,10-UNIMOD:188	ms_run[2]:scan=1058	9.1352	3	1160.6705	1160.6705	K	N	383	393
PSM	HKGPPVFTQEER	228	sp|Q99447-4|PCY2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:188,12-UNIMOD:267	ms_run[2]:scan=2322	16.986	3	1439.7492	1439.7492	K	Y	33	45
PSM	HLQTYGEHYPLDHFDK	229	sp|P12694|ODBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	16-UNIMOD:188	ms_run[2]:scan=4742	32.315	2	2004.9426	2004.9426	R	-	430	446
PSM	IKADIIYPGHGPVIHNAEAK	230	sp|Q53H82|LACB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:188,20-UNIMOD:188	ms_run[2]:scan=4653	31.756	3	2154.1988	2154.1988	K	I	190	210
PSM	MVNHFIAEFKR	231	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35,10-UNIMOD:188,11-UNIMOD:267	ms_run[2]:scan=4550	31.098	3	1422.7413	1422.7413	R	K	237	248
PSM	NHMDITTPPLPPVAPEVLR	232	sp|Q9NZB2-2|F120A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	19-UNIMOD:267	ms_run[2]:scan=8927	60.572	2	2106.1171	2106.1171	R	V	539	558
PSM	NSLKELWLVIHGR	233	sp|O43169|CYB5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=9075	61.62	3	1579.9169	1579.9169	R	V	32	45
PSM	PHAFKPGDLVFAK	234	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:188,13-UNIMOD:188	ms_run[2]:scan=5714	38.539	2	1437.8171	1437.8171	M	M	2	15
PSM	RGPPPPPR	235	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:267,8-UNIMOD:267	ms_run[2]:scan=773	7.4636	2	892.51461	892.5146	R	S	81	89
PSM	RVGIIAWHPTAR	236	sp|Q9BR76|COR1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=4721	32.182	2	1395.8002	1395.8002	K	N	134	146
PSM	TGHYTLIHDHSK	237	sp|Q8N543-2|OGFD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:188	ms_run[2]:scan=1535	12.051	3	1413.7096	1413.7096	K	A	304	316
PSM	TKGVDEVTIVNILTNR	238	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=9563	65.255	3	1787.0124	1787.0124	K	S	48	64
PSM	VLSAPPHFHFGQTNR	239	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	15-UNIMOD:267	ms_run[2]:scan=5076	34.452	3	1716.8724	1716.8724	R	T	31	46
PSM	SLDMDSIIAEVK	240	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:188	ms_run[1]:scan=9788	66.85161833333333	2	1325.689159	1325.684397	R	A	253	265
PSM	SHEPEAIHIPHR	241	sp|Q969G9|NKD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	12-UNIMOD:267	ms_run[1]:scan=2729	19.516505	3	1431.730986	1431.724665	R	K	297	309
PSM	AEEYEFLTPVEEAPK	242	sp|P52565|GDIR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	15-UNIMOD:188	ms_run[2]:scan=8207	55.511	2	1756.8503	1756.8503	R	G	153	168
PSM	AVGRLEAVSHTSDMHR	243	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=2588	18.637	2	1784.8855	1784.8855	R	G	14	30
PSM	FLNRHDLDLICR	244	sp|P62140|PP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	4-UNIMOD:267,11-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6247	42.016	3	1590.8204	1590.8204	K	A	234	246
PSM	GHRETSMVHELNR	245	sp|P61619-3|S61A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:267,13-UNIMOD:267	ms_run[2]:scan=1964	14.742	3	1584.7694	1584.7694	R	Y	283	296
PSM	GHYTEGAELVDSVLDVVR	246	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	18-UNIMOD:267	ms_run[2]:scan=11043	77.071	2	1967.9828	1967.9828	K	K	104	122
PSM	GVDEVTIVNILTNR	247	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	14-UNIMOD:267	ms_run[2]:scan=10713	74.124	3	1551.8496	1551.8496	K	S	50	64
PSM	HHGPQTLYLPVTLSSIPVFQR	248	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	21-UNIMOD:267	ms_run[2]:scan=10517	72.508	3	2399.2989	2399.2989	K	G	785	806
PSM	HHLDLGHNSQAYEALTQIPDSSR	249	sp|Q12769|NU160_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	23-UNIMOD:267	ms_run[2]:scan=6382	42.946	3	2598.245	2598.2450	K	Q	1007	1030
PSM	HLAVMPHPER	250	sp|O15067|PUR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	10-UNIMOD:267	ms_run[2]:scan=2500	18.094	2	1195.616	1195.6160	R	A	1291	1301
PSM	HLYTKDIDIHEVR	251	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=3835	26.525	3	1653.881	1653.8810	R	I	329	342
PSM	IGKVTSEELHYFVQNHFTSAR	252	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:188,21-UNIMOD:267	ms_run[2]:scan=7199	48.375	4	2478.2627	2478.2627	R	M	197	218
PSM	ILKLPSFELLHK	253	sp|Q16531|DDB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	3-UNIMOD:188,12-UNIMOD:188	ms_run[2]:scan=8626	58.441	3	1448.9158	1448.9158	R	E	568	580
PSM	KIHPQTIIAGWR	254	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:188,12-UNIMOD:267	ms_run[2]:scan=5324	36.071	2	1434.8431	1434.8431	K	E	73	85
PSM	LIELKEHPAHER	255	sp|P53618|COPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:188,12-UNIMOD:267	ms_run[2]:scan=2029	15.147	2	1486.8227	1486.8227	R	V	305	317
PSM	LLHSPHQNVCEQAVWALGNIIGDGPQCR	256	sp|O00629|IMA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	10-UNIMOD:4,27-UNIMOD:4,28-UNIMOD:267	ms_run[2]:scan=10419	71.729	3	3178.5428	3178.5428	R	D	165	193
PSM	LQEIRNPIHAIGLLIR	257	sp|Q12769|NU160_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9247	62.852	3	1875.1321	1875.1321	K	E	662	678
PSM	NLPLPPPPPPR	258	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	11-UNIMOD:267	ms_run[2]:scan=5828	39.351	2	1203.7003	1203.7003	R	G	282	293
PSM	NLPLPPPPPPR	259	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	11-UNIMOD:267	ms_run[2]:scan=5988	40.386	2	1203.7003	1203.7003	R	G	282	293
PSM	RLPNNHIGISFIPR	260	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:267,14-UNIMOD:267	ms_run[2]:scan=6204	41.753	3	1652.9378	1652.9378	K	E	1956	1970
PSM	RVAEAHVPNFIFDEFR	261	sp|Q12768|WASC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	1-UNIMOD:267,16-UNIMOD:267	ms_run[2]:scan=9055	61.487	3	1965.9964	1965.9964	R	T	1141	1157
PSM	SHEPEAIHIPHR	262	sp|Q969G9|NKD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	12-UNIMOD:267	ms_run[2]:scan=2719	19.456	3	1431.7247	1431.7247	R	K	297	309
PSM	SKSEEAHAEDSVMDHHFR	263	sp|Q8NC51-4|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:188,13-UNIMOD:35,18-UNIMOD:267	ms_run[2]:scan=2291	16.795	3	2142.936	2142.9360	K	K	307	325
PSM	SLPDRTPFHTSLHQGTSK	264	sp|Q08495-3|DEMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	5-UNIMOD:267,18-UNIMOD:188	ms_run[2]:scan=3592	24.991	2	2024.041	2024.0410	R	S	244	262
PSM	SRPEFMLPVHFYGK	265	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	2-UNIMOD:267,14-UNIMOD:188	ms_run[2]:scan=8019	54.259	2	1722.8887	1722.8887	K	V	159	173
PSM	SVPLGHTHHLAK	266	sp|Q8TEX9|IPO4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	12-UNIMOD:188	ms_run[2]:scan=1211	10.07	2	1301.73	1301.7300	K	A	446	458
PSM	VLSAPPHFHFGQTNR	267	sp|P26641|EF1G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	19	15-UNIMOD:267	ms_run[2]:scan=5244	35.556	2	1716.8724	1716.8724	R	T	31	46
PSM	DSYVGDEAQSK	268	sp|P62736|ACTA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	11-UNIMOD:188	ms_run[1]:scan=1760	13.456353333333333	2	1203.533460	1203.535090	K	R	53	64
PSM	CLAFHDISPQAPTHFLVIPK	269	sp|P49773|HINT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4,20-UNIMOD:188	ms_run[1]:scan=10669	73.79770333333333	2	2279.1839	2279.1863	R	K	38	58
PSM	HHSVEIKIEK	270	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:188,10-UNIMOD:188	ms_run[1]:scan=1909	14.397096666666668	2	1230.712998	1230.712329	R	T	511	521
PSM	LEGLTDEINFLR	271	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	12-UNIMOD:267	ms_run[1]:scan=10036	68.64484	2	1428.749859	1428.748814	R	Q	214	226
PSM	QLLHNFPPDQLTSSGAPFWSGPKR	272	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28,23-UNIMOD:188,24-UNIMOD:267	ms_run[1]:scan=10625	73.46914833333332	3	2678.3566	2678.3571	R	C	724	748
PSM	GPSWDPFRDWYPHSR	273	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	8-UNIMOD:267,15-UNIMOD:267	ms_run[1]:scan=9244	62.834076666666675	3	1921.884098	1921.876304	R	L	13	28
PSM	GDVTAEEAAGASPAK	274	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	15-UNIMOD:188	ms_run[1]:scan=2509	18.14845	2	1379.668364	1378.667167	R	A	11	26
PSM	HLPGHPYVR	275	sp|Q9UIG0|BAZ1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	9-UNIMOD:267	ms_run[1]:scan=1824	13.859931666666668	3	1084.579280	1084.580567	K	R	1443	1452
PSM	QGPAGSPSRFNSVAGHFFFPLLQR	276	sp|Q9Y4R8|TELO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28,9-UNIMOD:267,24-UNIMOD:267	ms_run[1]:scan=11447	81.36491166666667	3	2619.3234	2619.3244	R	F	683	707
PSM	KLHVIPR	277	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	1-UNIMOD:188,7-UNIMOD:267	ms_run[1]:scan=1731	13.272793333333333	2	877.582192	877.583255	R	A	180	187
PSM	QYTSPEEIDAQLQAEK	278	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	16-UNIMOD:188	ms_run[1]:scan=6550	44.02653333333333	2	1855.898793	1854.894267	R	Q	16	32
PSM	AAFDDAIAELDTLSEESYK	279	sp|P62258-2|1433E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	19-UNIMOD:188	ms_run[2]:scan=11430	81.179	2	2092.9784	2092.9784	K	D	175	194
PSM	FLNRHDLDLICR	280	sp|P62140|PP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	4-UNIMOD:267,11-UNIMOD:4,12-UNIMOD:267	ms_run[2]:scan=6250	42.037	2	1590.8204	1590.8204	K	A	234	246
PSM	HAEMVHTGLKLER	281	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	10-UNIMOD:188,13-UNIMOD:267	ms_run[2]:scan=3032	21.407	3	1535.8213	1535.8213	K	A	71	84
PSM	HHLGDDVVLFTTDGAHK	282	sp|P16278-3|BGAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	17-UNIMOD:188	ms_run[2]:scan=5568	37.623	2	1866.932	1866.9320	R	T	179	196
PSM	HHPEDVEPALRK	283	sp|P14550|AK1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	11-UNIMOD:267,12-UNIMOD:188	ms_run[2]:scan=1673	12.91	3	1442.7601	1442.7601	K	T	86	98
PSM	HLHPSCLGSPPLR	284	sp|Q14451-2|GRB7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	6-UNIMOD:4,13-UNIMOD:267	ms_run[2]:scan=3462	24.181	3	1479.7644	1479.7644	R	S	353	366
PSM	HMGIGKR	285	sp|P84098|RL19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	6-UNIMOD:188,7-UNIMOD:267	ms_run[2]:scan=837	7.8362	2	813.46142	813.4614	R	K	75	82
PSM	IDQLEGDHQLIQEALIFDNKHTNYTMEHIR	286	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	20-UNIMOD:188,30-UNIMOD:267	ms_run[2]:scan=9294	63.178	3	3636.7966	3636.7966	K	V	685	715
PSM	KHLEINPDHPIVETLR	287	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:188,16-UNIMOD:267	ms_run[2]:scan=4881	33.174	4	1926.0658	1926.0658	K	Q	624	640
PSM	KIHPQTIIAGWR	288	sp|P78371-2|TCPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:188,12-UNIMOD:267	ms_run[2]:scan=5331	36.116	3	1434.8431	1434.8431	K	E	73	85
PSM	KYVATLGVEVHPLVFHTNR	289	sp|P62826|RAN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:188,19-UNIMOD:267	ms_run[2]:scan=6589	44.273	4	2195.2186	2195.2186	K	G	38	57
PSM	LFRPVAADGQLHTLGDLLK	290	sp|Q9H1Y0-2|ATG5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:267,19-UNIMOD:188	ms_run[2]:scan=9138	62.055	3	2079.1812	2079.1812	K	E	124	143
PSM	LKYQHTGAVLDCAFYDPTHAWSGGLDHQLK	291	sp|O43684-2|BUB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:188,12-UNIMOD:4,30-UNIMOD:188	ms_run[2]:scan=8231	55.677	3	3439.6811	3439.6811	R	M	51	81
PSM	MVNHFIAEFKR	292	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:35,10-UNIMOD:188,11-UNIMOD:267	ms_run[2]:scan=4560	31.159	2	1422.7413	1422.7413	R	K	237	248
PSM	PERDSEPFSNPLAPDGHDVDDPHSFHQSK	293	sp|Q13123|RED_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	3-UNIMOD:267,29-UNIMOD:188	ms_run[2]:scan=5434	36.763	3	3272.473	3272.4730	M	L	2	31
PSM	QRLPGPPDAPGAVFVLGGEGLR	294	sp|Q96GD0|PLPP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:267,22-UNIMOD:267	ms_run[2]:scan=9357	63.736	3	2222.2075	2222.2075	R	A	98	120
PSM	RIHLELR	295	sp|Q92688-2|AN32B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:267,7-UNIMOD:267	ms_run[2]:scan=3120	21.938	2	955.58302	955.5830	R	N	6	13
PSM	RVGIVAWHPTAR	296	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	1-UNIMOD:267,12-UNIMOD:267	ms_run[2]:scan=4159	28.611	2	1381.7846	1381.7846	K	N	132	144
PSM	SRPEFMLPVHFYGK	297	sp|P06737-2|PYGL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	2-UNIMOD:267,14-UNIMOD:188	ms_run[2]:scan=8010	54.197	3	1722.8887	1722.8887	K	V	159	173
PSM	TGPNLHGLFGRK	298	sp|P99999|CYC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	11-UNIMOD:267,12-UNIMOD:188	ms_run[2]:scan=4856	33.024	2	1311.7383	1311.7383	K	T	29	41
PSM	THHNDTELIRK	299	sp|P49915-2|GUAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	10-UNIMOD:267,11-UNIMOD:188	ms_run[2]:scan=1069	9.2014	2	1378.7288	1378.7288	K	L	291	302
PSM	VIPSPFKHADIVTTTTHK	300	sp|P34897-3|GLYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	7-UNIMOD:188,18-UNIMOD:188	ms_run[2]:scan=4849	32.978	2	2003.1243	2003.1243	K	T	242	260
PSM	YHIDLDPHFNDILGQHSR	301	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	18-UNIMOD:267	ms_run[2]:scan=8158	55.187	3	2186.0533	2186.0533	K	K	262	280
PSM	YHIDLDPHFNDILGQHSR	302	sp|P19784|CSK22_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	18	18-UNIMOD:267	ms_run[2]:scan=8179	55.325	2	2186.0533	2186.0533	K	K	262	280
PSM	HLYTKDIDIHEVR	303	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=3821	26.441940000000002	3	1653.882985	1653.880953	R	I	348	361
PSM	HKHIAEVSQEVTR	304	sp|P61764|STXB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	2-UNIMOD:188,13-UNIMOD:267	ms_run[1]:scan=1520	11.958425	3	1548.841930	1548.834337	R	S	293	306
PSM	CEDRPVVFTHLLTADHGPPR	305	sp|Q6P1X6|CH082_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:267,20-UNIMOD:267	ms_run[1]:scan=7878	53.29284499999999	4	2319.1408	2319.1328	R	L	107	127
PSM	GNPTALQLFLQISEEEEK	306	sp|O15354|GPR37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	18-UNIMOD:188	ms_run[1]:scan=4545	31.069315000000003	2	2051.020789	2051.051830	R	G	137	155