MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_NT_JPST000210
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\121026_CRC_N_Fr07.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\121026_CRC_N_Fr07.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	47.0	null	129-UNIMOD:21	0.29	47.0	7	2	1
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	47.0	null	384-UNIMOD:21,395-UNIMOD:4,220-UNIMOD:21	0.03	47.0	2	2	2
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	45.0	null	145-UNIMOD:28,160-UNIMOD:21,164-UNIMOD:21,155-UNIMOD:21	0.07	45.0	10	2	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44.0	null	1384-UNIMOD:21,1389-UNIMOD:4,632-UNIMOD:21	0.02	44.0	3	2	1
PRT	sp|Q9UHV7|MED13_HUMAN	Mediator of RNA polymerase II transcription subunit 13 OS=Homo sapiens OX=9606 GN=MED13 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44.0	null	395-UNIMOD:21,402-UNIMOD:4	0.01	44.0	2	1	0
PRT	sp|Q96HP0|DOCK6_HUMAN	Dedicator of cytokinesis protein 6 OS=Homo sapiens OX=9606 GN=DOCK6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44.0	null	878-UNIMOD:21	0.01	44.0	1	1	1
PRT	sp|Q9H841-2|NPAL2_HUMAN	Isoform 2 of NIPA-like protein 2 OS=Homo sapiens OX=9606 GN=NIPAL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null	362-UNIMOD:21,360-UNIMOD:21	0.06	43.0	2	1	0
PRT	sp|Q8TF01-2|PNISR_HUMAN	Isoform 2 of Arginine/serine-rich protein PNISR OS=Homo sapiens OX=9606 GN=PNISR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null	290-UNIMOD:21	0.06	43.0	2	1	0
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null	393-UNIMOD:21	0.03	42.0	1	1	1
PRT	sp|Q9BZ95-3|NSD3_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null	561-UNIMOD:21,457-UNIMOD:21	0.06	42.0	4	2	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	42.0	null	942-UNIMOD:21	0.03	42.0	3	1	0
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	109-UNIMOD:35	0.28	41.0	10	2	0
PRT	sp|Q7Z4S6-2|KI21A_HUMAN	Isoform 2 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	840-UNIMOD:21,849-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|Q15042-4|RB3GP_HUMAN	Isoform 3 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	493-UNIMOD:21	0.02	41.0	2	1	0
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	615-UNIMOD:21	0.01	41.0	3	1	0
PRT	sp|P01834|IGKC_HUMAN	Immunoglobulin kappa constant OS=Homo sapiens OX=9606 GN=IGKC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.20	41.0	1	1	1
PRT	sp|O75363|BCAS1_HUMAN	Breast carcinoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=BCAS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	41.0	null	314-UNIMOD:21	0.03	41.0	2	1	0
PRT	sp|Q8IY17-5|PLPL6_HUMAN	Isoform 5 of Neuropathy target esterase OS=Homo sapiens OX=9606 GN=PNPLA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	68-UNIMOD:21,73-UNIMOD:21	0.02	40.0	2	1	0
PRT	sp|Q86U38-2|NOP9_HUMAN	Isoform 2 of Nucleolar protein 9 OS=Homo sapiens OX=9606 GN=NOP9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.03	40.0	1	1	1
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	417-UNIMOD:21,416-UNIMOD:21,419-UNIMOD:21	0.05	40.0	4	1	0
PRT	sp|Q5JTC6-2|AMER1_HUMAN	Isoform 2 of APC membrane recruitment protein 1 OS=Homo sapiens OX=9606 GN=AMER1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	286-UNIMOD:21	0.02	40.0	1	1	1
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	4	1	0
PRT	sp|Q9C0C2-2|TB182_HUMAN	Isoform 2 of 182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	344-UNIMOD:21,348-UNIMOD:21,699-UNIMOD:21	0.05	40.0	3	2	1
PRT	sp|Q9UBY9-3|HSPB7_HUMAN	Isoform 3 of Heat shock protein beta-7 OS=Homo sapiens OX=9606 GN=HSPB7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	14-UNIMOD:21	0.29	40.0	2	1	0
PRT	sp|P78545-2|ELF3_HUMAN	Isoform 2 of ETS-related transcription factor Elf-3 OS=Homo sapiens OX=9606 GN=ELF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	192-UNIMOD:21	0.06	40.0	1	1	1
PRT	sp|Q9Y5P4|C43BP_HUMAN	Collagen type IV alpha-3-binding protein OS=Homo sapiens OX=9606 GN=COL4A3BP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	377-UNIMOD:21,378-UNIMOD:35,375-UNIMOD:21	0.03	40.0	2	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	5739-UNIMOD:21,135-UNIMOD:21,5737-UNIMOD:21,295-UNIMOD:21,4486-UNIMOD:21,1096-UNIMOD:35,3902-UNIMOD:35,5731-UNIMOD:21	0.07	39.0	36	17	13
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	592-UNIMOD:21	0.03	39.0	2	1	0
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	872-UNIMOD:21,870-UNIMOD:21,461-UNIMOD:21,388-UNIMOD:21,390-UNIMOD:21,392-UNIMOD:21,234-UNIMOD:21,736-UNIMOD:21,738-UNIMOD:21	0.08	39.0	13	5	2
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	1202-UNIMOD:21,1211-UNIMOD:4,1205-UNIMOD:21	0.01	39.0	2	1	0
PRT	sp|Q9BQ70|TCF25_HUMAN	Transcription factor 25 OS=Homo sapiens OX=9606 GN=TCF25 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	138-UNIMOD:21	0.03	39.0	1	1	1
PRT	sp|Q9H4X1-2|RGCC_HUMAN	Isoform 2 of Regulator of cell cycle RGCC OS=Homo sapiens OX=9606 GN=RGCC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	45-UNIMOD:21	0.21	39.0	1	1	1
PRT	sp|O60716-32|CTND1_HUMAN	Isoform 4 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	530-UNIMOD:21,535-UNIMOD:21,26-UNIMOD:21,29-UNIMOD:21,576-UNIMOD:35,536-UNIMOD:21	0.07	39.0	7	3	2
PRT	sp|Q16623-3|STX1A_HUMAN	Isoform 3 of Syntaxin-1A OS=Homo sapiens OX=9606 GN=STX1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	14-UNIMOD:21	0.07	39.0	1	1	1
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	447-UNIMOD:4	0.03	38.0	1	1	1
PRT	sp|Q8IYL3|CA174_HUMAN	UPF0688 protein C1orf174 OS=Homo sapiens OX=9606 GN=C1orf174 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	145-UNIMOD:21	0.08	38.0	1	1	1
PRT	sp|Q8TC07-2|TBC15_HUMAN	Isoform 2 of TBC1 domain family member 15 OS=Homo sapiens OX=9606 GN=TBC1D15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	70-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|O95613|PCNT_HUMAN	Pericentrin OS=Homo sapiens OX=9606 GN=PCNT PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	44-UNIMOD:21	0.01	38.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	107-UNIMOD:21,133-UNIMOD:35,135-UNIMOD:21,113-UNIMOD:21,137-UNIMOD:21,106-UNIMOD:28	0.03	38.0	6	3	0
PRT	sp|P50552|VASP_HUMAN	Vasodilator-stimulated phosphoprotein OS=Homo sapiens OX=9606 GN=VASP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	320-UNIMOD:35,324-UNIMOD:21,334-UNIMOD:4,329-UNIMOD:21,322-UNIMOD:21	0.07	38.0	5	1	0
PRT	sp|O60268-2|K0513_HUMAN	Isoform 2 of Uncharacterized protein KIAA0513 OS=Homo sapiens OX=9606 GN=KIAA0513	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	72-UNIMOD:21,279-UNIMOD:21	0.13	38.0	2	2	2
PRT	sp|O15056-3|SYNJ2_HUMAN	Isoform 2A of Synaptojanin-2 OS=Homo sapiens OX=9606 GN=SYNJ2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	1122-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	479-UNIMOD:21,517-UNIMOD:21	0.04	38.0	7	2	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	2362-UNIMOD:21,2370-UNIMOD:4	0.06	38.0	13	10	7
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	38.0	null	246-UNIMOD:35	0.05	38.0	4	2	1
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	260-UNIMOD:21	0.06	37.0	2	1	0
PRT	sp|P17661|DESM_HUMAN	Desmin OS=Homo sapiens OX=9606 GN=DES PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null		0.08	37.0	4	3	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	1379-UNIMOD:35,1270-UNIMOD:4	0.03	37.0	4	3	2
PRT	sp|Q9Y3M8-5|STA13_HUMAN	Isoform 5 of StAR-related lipid transfer protein 13 OS=Homo sapiens OX=9606 GN=STARD13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	125-UNIMOD:21,131-UNIMOD:4,326-UNIMOD:21,339-UNIMOD:4,328-UNIMOD:21	0.06	37.0	3	2	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	676-UNIMOD:21,642-UNIMOD:21,713-UNIMOD:21	0.07	37.0	7	3	0
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	196-UNIMOD:35	0.12	37.0	8	5	4
PRT	sp|P31323|KAP3_HUMAN	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	114-UNIMOD:21,116-UNIMOD:4	0.05	37.0	8	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=HIST1H1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null	18-UNIMOD:21,2-UNIMOD:1	0.09	37.0	2	1	0
PRT	sp|P31749-2|AKT1_HUMAN	Isoform 2 of RAC-alpha serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=AKT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	64-UNIMOD:21,72-UNIMOD:35	0.05	37.0	1	1	1
PRT	sp|O43426|SYNJ1_HUMAN	Synaptojanin-1 OS=Homo sapiens OX=9606 GN=SYNJ1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	1295-UNIMOD:21	0.01	37.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	1915-UNIMOD:21,1932-UNIMOD:21,1949-UNIMOD:21,1919-UNIMOD:21	0.02	37.0	8	3	0
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37.0	null	99-UNIMOD:21,101-UNIMOD:4	0.05	37.0	1	1	1
PRT	sp|Q92766|RREB1_HUMAN	Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37.0	null	1304-UNIMOD:28,1320-UNIMOD:21	0.01	37.0	1	1	0
PRT	sp|Q9NY61|AATF_HUMAN	Protein AATF OS=Homo sapiens OX=9606 GN=AATF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	203-UNIMOD:21,210-UNIMOD:35	0.04	36.0	3	1	0
PRT	sp|P49407-2|ARRB1_HUMAN	Isoform 1B of Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	404-UNIMOD:21	0.05	36.0	4	1	0
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	3	1	0
PRT	sp|Q15124|PGM5_HUMAN	Phosphoglucomutase-like protein 5 OS=Homo sapiens OX=9606 GN=PGM5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	165-UNIMOD:4	0.10	36.0	7	4	3
PRT	sp|Q8NFZ8|CADM4_HUMAN	Cell adhesion molecule 4 OS=Homo sapiens OX=9606 GN=CADM4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	361-UNIMOD:21,351-UNIMOD:28,354-UNIMOD:21	0.05	36.0	2	2	2
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	221-UNIMOD:35	0.06	36.0	2	1	0
PRT	sp|Q9Y4C8|RBM19_HUMAN	Probable RNA-binding protein 19 OS=Homo sapiens OX=9606 GN=RBM19 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q15052-2|ARHG6_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=ARHGEF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	530-UNIMOD:21,495-UNIMOD:21	0.05	36.0	5	2	1
PRT	sp|Q01484|ANK2_HUMAN	Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	2661-UNIMOD:21,3845-UNIMOD:21,3859-UNIMOD:4,3844-UNIMOD:21,2440-UNIMOD:21,3823-UNIMOD:21,2115-UNIMOD:35,2122-UNIMOD:35,2127-UNIMOD:21,2133-UNIMOD:21	0.03	36.0	11	6	4
PRT	sp|Q05D32-2|CTSL2_HUMAN	Isoform 2 of CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	28-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q9NR09|BIRC6_HUMAN	Baculoviral IAP repeat-containing protein 6 OS=Homo sapiens OX=9606 GN=BIRC6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	480-UNIMOD:21	0.00	36.0	2	1	0
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q8WVC0-2|LEO1_HUMAN	Isoform 2 of RNA polymerase-associated protein LEO1 OS=Homo sapiens OX=9606 GN=LEO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	185-UNIMOD:35,197-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q9Y6R1-4|S4A4_HUMAN	Isoform 4 of Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	254-UNIMOD:21,255-UNIMOD:21,257-UNIMOD:21	0.02	36.0	6	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	61-UNIMOD:35,87-UNIMOD:35,226-UNIMOD:21	0.11	36.0	7	5	3
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	446-UNIMOD:21	0.04	36.0	2	1	0
PRT	sp|Q01831-2|XPC_HUMAN	Isoform 2 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	846-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	2	1	0
PRT	sp|O43164-2|PJA2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens OX=9606 GN=PJA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	253-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|Q09472|EP300_HUMAN	Histone acetyltransferase p300 OS=Homo sapiens OX=9606 GN=EP300 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	1038-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|Q9Y2H5|PKHA6_HUMAN	Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	775-UNIMOD:21,777-UNIMOD:21	0.02	36.0	4	1	0
PRT	sp|Q9UI47|CTNA3_HUMAN	Catenin alpha-3 OS=Homo sapiens OX=9606 GN=CTNNA3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	637-UNIMOD:21	0.02	36.0	1	1	1
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	461-UNIMOD:21,295-UNIMOD:21	0.06	36.0	3	2	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	117-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|Q9UDY2-3|ZO2_HUMAN	Isoform C1 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	438-UNIMOD:21,930-UNIMOD:21	0.04	36.0	6	3	0
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	36.0	null	923-UNIMOD:28,941-UNIMOD:21,940-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|Q8TE77-4|SSH3_HUMAN	Isoform 4 of Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	70-UNIMOD:21,87-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	2638-UNIMOD:21	0.00	35.0	2	1	0
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	17-UNIMOD:21,9-UNIMOD:21	0.16	35.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	263-UNIMOD:21,231-UNIMOD:21	0.08	35.0	4	4	4
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	939-UNIMOD:21,444-UNIMOD:21	0.03	35.0	2	2	2
PRT	sp|Q9UBB9|TFP11_HUMAN	Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	98-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	917-UNIMOD:21,1093-UNIMOD:21	0.03	35.0	2	2	2
PRT	sp|Q9Y5Q9-2|TF3C3_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 3 OS=Homo sapiens OX=9606 GN=GTF3C3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	43-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|Q6ZSR9|YJ005_HUMAN	Uncharacterized protein FLJ45252 OS=Homo sapiens OX=9606 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	294-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|P17655-2|CAN2_HUMAN	Isoform 2 of Calpain-2 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	502-UNIMOD:35,505-UNIMOD:35	0.02	35.0	4	1	0
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|Q09160|1A80_HUMAN	HLA class I histocompatibility antigen, A-80 alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	343-UNIMOD:21,363-UNIMOD:4,356-UNIMOD:21,359-UNIMOD:21	0.07	35.0	3	1	0
PRT	sp|Q5VZ89-7|DEN4C_HUMAN	Isoform 2 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	1110-UNIMOD:21,1118-UNIMOD:35,1121-UNIMOD:35,1122-UNIMOD:35,953-UNIMOD:21,1326-UNIMOD:21	0.03	35.0	5	3	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q8WVM7-2|STAG1_HUMAN	Isoform 2 of Cohesin subunit SA-1 OS=Homo sapiens OX=9606 GN=STAG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	1061-UNIMOD:35,1062-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|Q9UPV7|PHF24_HUMAN	PHD finger protein 24 OS=Homo sapiens OX=9606 GN=PHF24 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	47-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	99-UNIMOD:21,101-UNIMOD:4,78-UNIMOD:21	0.12	35.0	6	2	1
PRT	sp|P43007-2|SATT_HUMAN	Isoform 2 of Neutral amino acid transporter A OS=Homo sapiens OX=9606 GN=SLC1A4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	223-UNIMOD:21,209-UNIMOD:21	0.12	35.0	2	1	0
PRT	sp|Q15811-6|ITSN1_HUMAN	Isoform 6 of Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	974-UNIMOD:35,984-UNIMOD:21	0.02	35.0	1	1	1
PRT	sp|O75396|SC22B_HUMAN	Vesicle-trafficking protein SEC22b OS=Homo sapiens OX=9606 GN=SEC22B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	20-UNIMOD:35	0.09	35.0	1	1	1
PRT	sp|Q00839|HNRPU_HUMAN	Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	53-UNIMOD:35,59-UNIMOD:21,534-UNIMOD:35	0.06	35.0	3	2	0
PRT	sp|Q3ZCM7|TBB8_HUMAN	Tubulin beta-8 chain OS=Homo sapiens OX=9606 GN=TUBB8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	73-UNIMOD:35	0.04	34.0	1	1	1
PRT	sp|Q9BUH6-2|PAXX_HUMAN	Isoform 2 of Protein PAXX OS=Homo sapiens OX=9606 GN=PAXX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	22-UNIMOD:4,24-UNIMOD:4	0.15	34.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	970-UNIMOD:21,1021-UNIMOD:21	0.03	34.0	2	2	2
PRT	sp|Q9UGU0-2|TCF20_HUMAN	Isoform 2 of Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	966-UNIMOD:21,1522-UNIMOD:21	0.02	34.0	2	2	2
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.11	34.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.03	34.0	79	2	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	3	3	3
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1676-UNIMOD:21	0.01	34.0	3	1	0
PRT	sp|P30512|1A29_HUMAN	HLA class I histocompatibility antigen, A-29 alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	343-UNIMOD:21,358-UNIMOD:35,363-UNIMOD:4	0.07	34.0	2	1	0
PRT	sp|Q12982|BNIP2_HUMAN	BCL2/adenovirus E1B 19 kDa protein-interacting protein 2 OS=Homo sapiens OX=9606 GN=BNIP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	114-UNIMOD:21	0.04	34.0	5	1	0
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	43-UNIMOD:21	0.14	34.0	1	1	1
PRT	sp|P51608-2|MECP2_HUMAN	Isoform B of Methyl-CpG-binding protein 2 OS=Homo sapiens OX=9606 GN=MECP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	25-UNIMOD:21	0.03	34.0	6	1	0
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	299-UNIMOD:4	0.03	34.0	1	1	1
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	568-UNIMOD:21	0.03	34.0	2	1	0
PRT	sp|Q9H2K8|TAOK3_HUMAN	Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	324-UNIMOD:21	0.03	34.0	1	1	1
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1049-UNIMOD:21,1053-UNIMOD:4,1058-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q7L4E1-3|MIGA2_HUMAN	Isoform 3 of Mitoguardin 2 OS=Homo sapiens OX=9606 GN=MIGA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	228-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P49685|GPR15_HUMAN	G-protein coupled receptor 15 OS=Homo sapiens OX=9606 GN=GPR15 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	333-UNIMOD:21,335-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	339-UNIMOD:21,351-UNIMOD:4	0.03	34.0	2	1	0
PRT	sp|O00763-2|ACACB_HUMAN	Isoform 2 of Acetyl-CoA carboxylase 2 OS=Homo sapiens OX=9606 GN=ACACB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	35-UNIMOD:21,1342-UNIMOD:4,1344-UNIMOD:21	0.02	34.0	2	2	2
PRT	sp|P55196|AFAD_HUMAN	Afadin OS=Homo sapiens OX=9606 GN=AFDN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	1772-UNIMOD:21,557-UNIMOD:21,1698-UNIMOD:21,1774-UNIMOD:21	0.03	34.0	5	3	2
PRT	sp|Q8TDY2-2|RBCC1_HUMAN	Isoform 2 of RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	266-UNIMOD:21	0.01	34.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	433-UNIMOD:21,1307-UNIMOD:21,1314-UNIMOD:21,1316-UNIMOD:4	0.02	34.0	3	2	1
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1173-UNIMOD:21,1218-UNIMOD:21	0.02	34.0	3	2	1
PRT	sp|Q15653-2|IKBB_HUMAN	Isoform 2 of NF-kappa-B inhibitor beta OS=Homo sapiens OX=9606 GN=NFKBIB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	175-UNIMOD:21	0.06	34.0	1	1	1
PRT	sp|Q8TD06|AGR3_HUMAN	Anterior gradient protein 3 OS=Homo sapiens OX=9606 GN=AGR3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	90-UNIMOD:35	0.10	34.0	3	1	0
PRT	sp|P29762|RABP1_HUMAN	Cellular retinoic acid-binding protein 1 OS=Homo sapiens OX=9606 GN=CRABP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	122-UNIMOD:21,982-UNIMOD:21	0.03	34.0	2	2	2
PRT	sp|P52948-4|NUP98_HUMAN	Isoform 4 of Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	871-UNIMOD:21	0.02	34.0	8	1	0
PRT	sp|O75170|PP6R2_HUMAN	Serine/threonine-protein phosphatase 6 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP6R2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	769-UNIMOD:385,769-UNIMOD:4,771-UNIMOD:21,777-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|Q96A00|PP14A_HUMAN	Protein phosphatase 1 regulatory subunit 14A OS=Homo sapiens OX=9606 GN=PPP1R14A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	126-UNIMOD:28,128-UNIMOD:21	0.12	34.0	1	1	1
PRT	sp|Q9BUT9|MCRI2_HUMAN	MAPK regulated corepressor interacting protein 2 OS=Homo sapiens OX=9606 GN=MCRIP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	82-UNIMOD:21	0.16	33.0	1	1	1
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	1263-UNIMOD:4,1265-UNIMOD:4,1270-UNIMOD:35,1275-UNIMOD:35,967-UNIMOD:4,1055-UNIMOD:4,2397-UNIMOD:35,2406-UNIMOD:4,1111-UNIMOD:4,1112-UNIMOD:35,1117-UNIMOD:4,1470-UNIMOD:385,1470-UNIMOD:4,1472-UNIMOD:4,1055-UNIMOD:385,570-UNIMOD:4,573-UNIMOD:35,576-UNIMOD:4,1097-UNIMOD:4,1106-UNIMOD:35,1107-UNIMOD:35,1108-UNIMOD:35,1633-UNIMOD:4	0.04	33.0	12	9	7
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	670-UNIMOD:4,679-UNIMOD:21,686-UNIMOD:4,677-UNIMOD:21,244-UNIMOD:21,400-UNIMOD:4,401-UNIMOD:35,415-UNIMOD:21	0.11	33.0	5	4	3
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	1441-UNIMOD:21,1448-UNIMOD:21,1445-UNIMOD:21,1442-UNIMOD:21	0.01	33.0	4	1	0
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.06	33.0	3	3	3
PRT	sp|Q96NA2-2|RILP_HUMAN	Isoform 2 of Rab-interacting lysosomal protein OS=Homo sapiens OX=9606 GN=RILP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	144-UNIMOD:21	0.09	33.0	1	1	1
PRT	sp|Q5VZK9-2|CARL1_HUMAN	Isoform 2 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	1128-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	649-UNIMOD:21	0.03	33.0	6	1	0
PRT	sp|Q15032-2|R3HD1_HUMAN	Isoform 2 of R3H domain-containing protein 1 OS=Homo sapiens OX=9606 GN=R3HDM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	845-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|O60861-1|GAS7_HUMAN	Isoform 1 of Growth arrest-specific protein 7 OS=Homo sapiens OX=9606 GN=GAS7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	88-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q9Y6C2|EMIL1_HUMAN	EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	703-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9BZ71-3|PITM3_HUMAN	Isoform 3 of Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens OX=9606 GN=PITPNM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	285-UNIMOD:21,266-UNIMOD:21,274-UNIMOD:4,283-UNIMOD:21	0.05	33.0	3	2	1
PRT	sp|P05165-3|PCCA_HUMAN	Isoform 3 of Propionyl-CoA carboxylase alpha chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q8WUY3-4|PRUN2_HUMAN	Isoform 4 of Protein prune homolog 2 OS=Homo sapiens OX=9606 GN=PRUNE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	2331-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q96H79|ZCCHL_HUMAN	Zinc finger CCCH-type antiviral protein 1-like OS=Homo sapiens OX=9606 GN=ZC3HAV1L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	249-UNIMOD:35,257-UNIMOD:21	0.07	33.0	1	1	1
PRT	sp|Q9BW71|HIRP3_HUMAN	HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	125-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	1356-UNIMOD:35,1917-UNIMOD:35,1597-UNIMOD:28,1954-UNIMOD:21,8-UNIMOD:21	0.07	33.0	13	10	8
PRT	sp|P67809|YBOX1_HUMAN	Nuclease-sensitive element-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	174-UNIMOD:21,162-UNIMOD:21	0.09	33.0	2	1	0
PRT	sp|Q9H4G0|E41L1_HUMAN	Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	441-UNIMOD:21,475-UNIMOD:21	0.04	33.0	3	2	1
PRT	sp|Q92766-4|RREB1_HUMAN	Isoform 4 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	111-UNIMOD:21	0.05	33.0	1	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q8NAA4-2|A16L2_HUMAN	Isoform 2 of Autophagy-related protein 16-2 OS=Homo sapiens OX=9606 GN=ATG16L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	172-UNIMOD:21,181-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|P12931|SRC_HUMAN	Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	17-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	954-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|Q8N9M5|TM102_HUMAN	Transmembrane protein 102 OS=Homo sapiens OX=9606 GN=TMEM102 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	218-UNIMOD:21	0.05	33.0	1	1	1
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	662-UNIMOD:21,659-UNIMOD:21,807-UNIMOD:21	0.03	33.0	4	2	1
PRT	sp|Q15751|HERC1_HUMAN	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	1512-UNIMOD:21	0.00	33.0	1	1	1
PRT	sp|Q9NRA8-2|4ET_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4E transporter OS=Homo sapiens OX=9606 GN=EIF4ENIF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	190-UNIMOD:21,194-UNIMOD:21,188-UNIMOD:21	0.02	33.0	3	1	0
PRT	sp|Q66K14-2|TBC9B_HUMAN	Isoform 2 of TBC1 domain family member 9B OS=Homo sapiens OX=9606 GN=TBC1D9B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	547-UNIMOD:21,411-UNIMOD:21	0.04	33.0	4	2	0
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	128-UNIMOD:21	0.11	33.0	3	3	3
PRT	sp|Q8IV36-3|HID1_HUMAN	Isoform 3 of Protein HID1 OS=Homo sapiens OX=9606 GN=HID1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	363-UNIMOD:21,371-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	1	1	1
PRT	sp|Q6UUV7-3|CRTC3_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	162-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P30044-2|PRDX5_HUMAN	Isoform Cytoplasmic+peroxisomal of Peroxiredoxin-5, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.12	33.0	1	1	1
PRT	sp|P61604|CH10_HUMAN	10 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPE1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.15	33.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	357-UNIMOD:4	0.04	33.0	1	1	1
PRT	sp|Q9Y6Y8|S23IP_HUMAN	SEC23-interacting protein OS=Homo sapiens OX=9606 GN=SEC23IP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	926-UNIMOD:21,894-UNIMOD:21	0.03	33.0	2	2	2
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	188-UNIMOD:21	0.05	33.0	5	1	0
PRT	sp|Q8IXS6|PALM2_HUMAN	Paralemmin-2 OS=Homo sapiens OX=9606 GN=PALM2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	318-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q13506|NAB1_HUMAN	NGFI-A-binding protein 1 OS=Homo sapiens OX=9606 GN=NAB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	356-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	32.0	null	2340-UNIMOD:21,257-UNIMOD:21,2159-UNIMOD:21,781-UNIMOD:21	0.05	32.0	12	7	5
PRT	sp|Q96FV2-2|SCRN2_HUMAN	Isoform 2 of Secernin-2 OS=Homo sapiens OX=9606 GN=SCRN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	52-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|P05023-4|AT1A1_HUMAN	Isoform 4 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	16-UNIMOD:21	0.03	32.0	3	3	3
PRT	sp|O15504-2|NUPL2_HUMAN	Isoform 2 of Nucleoporin-like protein 2 OS=Homo sapiens OX=9606 GN=NUPL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	82-UNIMOD:21	0.08	32.0	1	1	1
PRT	sp|P50443|S26A2_HUMAN	Sulfate transporter OS=Homo sapiens OX=9606 GN=SLC26A2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	25-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|Q53EL6-2|PDCD4_HUMAN	Isoform 2 of Programmed cell death protein 4 OS=Homo sapiens OX=9606 GN=PDCD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	67-UNIMOD:21,60-UNIMOD:21,65-UNIMOD:21	0.04	32.0	4	1	0
PRT	sp|P61224-3|RAP1B_HUMAN	Isoform 3 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	92-UNIMOD:35	0.08	32.0	3	1	0
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	133-UNIMOD:21,125-UNIMOD:21	0.10	32.0	2	1	0
PRT	sp|Q9NRL2-2|BAZ1A_HUMAN	Isoform 2 of Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens OX=9606 GN=BAZ1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	697-UNIMOD:35,699-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q86VI3|IQGA3_HUMAN	Ras GTPase-activating-like protein IQGAP3 OS=Homo sapiens OX=9606 GN=IQGAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P02747|C1QC_HUMAN	Complement C1q subcomponent subunit C OS=Homo sapiens OX=9606 GN=C1QC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.08	32.0	1	1	1
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P02790|HEMO_HUMAN	Hemopexin OS=Homo sapiens OX=9606 GN=HPX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	154-UNIMOD:4	0.03	32.0	1	1	1
PRT	sp|O95208-3|EPN2_HUMAN	Isoform 3 of Epsin-2 OS=Homo sapiens OX=9606 GN=EPN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	133-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P20645|MPRD_HUMAN	Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q15700-5|DLG2_HUMAN	Isoform 5 of Disks large homolog 2 OS=Homo sapiens OX=9606 GN=DLG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q8N5D0-5|WDTC1_HUMAN	Isoform 5 of WD and tetratricopeptide repeats protein 1 OS=Homo sapiens OX=9606 GN=WDTC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	510-UNIMOD:21,516-UNIMOD:35	0.02	32.0	3	1	0
PRT	sp|Q14155-1|ARHG7_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	560-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q15057|ACAP2_HUMAN	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ACAP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	379-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	1543-UNIMOD:21	0.01	32.0	5	2	1
PRT	sp|Q86W56-3|PARG_HUMAN	Isoform 3 of Poly(ADP-ribose) glycohydrolase OS=Homo sapiens OX=9606 GN=PARG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	31-UNIMOD:21,29-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q96SU4-5|OSBL9_HUMAN	Isoform 5 of Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	148-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q9NS73-3|MBIP1_HUMAN	Isoform 3 of MAP3K12-binding inhibitory protein 1 OS=Homo sapiens OX=9606 GN=MBIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	91-UNIMOD:21	0.07	32.0	2	1	0
PRT	sp|Q3T8J9-2|GON4L_HUMAN	Isoform 2 of GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1425-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9NRY4|RHG35_HUMAN	Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1106-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	339-UNIMOD:21	0.08	32.0	1	1	1
PRT	sp|O95171-3|SCEL_HUMAN	Isoform 3 of Sciellin OS=Homo sapiens OX=9606 GN=SCEL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	325-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	714-UNIMOD:21,718-UNIMOD:21,719-UNIMOD:21	0.02	32.0	3	1	0
PRT	sp|Q96JG6-3|VPS50_HUMAN	Isoform 3 of Syndetin OS=Homo sapiens OX=9606 GN=VPS50	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	529-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q2LD37-2|K1109_HUMAN	Isoform 2 of Transmembrane protein KIAA1109 OS=Homo sapiens OX=9606 GN=KIAA1109	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1225-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	624-UNIMOD:21,633-UNIMOD:4,641-UNIMOD:35,622-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	185-UNIMOD:21,189-UNIMOD:21	0.09	32.0	1	1	1
PRT	sp|Q9NRF2-2|SH2B1_HUMAN	Isoform 2 of SH2B adapter protein 1 OS=Homo sapiens OX=9606 GN=SH2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	125-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	238-UNIMOD:21,244-UNIMOD:21	0.03	32.0	4	1	0
PRT	sp|P04049|RAF1_HUMAN	RAF proto-oncogene serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=RAF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	257-UNIMOD:21,265-UNIMOD:35	0.03	32.0	1	1	1
PRT	sp|Q14680-3|MELK_HUMAN	Isoform 3 of Maternal embryonic leucine zipper kinase OS=Homo sapiens OX=9606 GN=MELK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	311-UNIMOD:21,321-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q9Y6N5|SQOR_HUMAN	Sulfide:quinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=SQOR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.12	32.0	5	4	3
PRT	sp|Q8IVL1-5|NAV2_HUMAN	Isoform 5 of Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	632-UNIMOD:21,630-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|Q9C0E8-2|LNP_HUMAN	Isoform 2 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	9-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q9P2R6-2|RERE_HUMAN	Isoform 2 of Arginine-glutamic acid dipeptide repeats protein OS=Homo sapiens OX=9606 GN=RERE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	125-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q15054-3|DPOD3_HUMAN	Isoform 3 of DNA polymerase delta subunit 3 OS=Homo sapiens OX=9606 GN=POLD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	201-UNIMOD:21,211-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q9H2P0|ADNP_HUMAN	Activity-dependent neuroprotector homeobox protein OS=Homo sapiens OX=9606 GN=ADNP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	921-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	221-UNIMOD:21,164-UNIMOD:21	0.13	32.0	2	2	2
PRT	sp|Q8NEY1-5|NAV1_HUMAN	Isoform 5 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	417-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|Q7RTP6|MICA3_HUMAN	[F-actin]-monooxygenase MICAL3 OS=Homo sapiens OX=9606 GN=MICAL3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	1143-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|Q9UDY2|ZO2_HUMAN	Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	961-UNIMOD:21	0.03	32.0	3	2	0
PRT	sp|Q9Y4B6|DCAF1_HUMAN	DDB1- and CUL4-associated factor 1 OS=Homo sapiens OX=9606 GN=DCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	977-UNIMOD:28,979-UNIMOD:21	0.01	32.0	3	1	0
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	138-UNIMOD:28,140-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|Q9NWQ8|PHAG1_HUMAN	Phosphoprotein associated with glycosphingolipid-enriched microdomains 1 OS=Homo sapiens OX=9606 GN=PAG1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	48-UNIMOD:28,50-UNIMOD:21,57-UNIMOD:35	0.04	32.0	1	1	1
PRT	sp|Q96A73|P33MX_HUMAN	Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	168-UNIMOD:28,183-UNIMOD:21	0.06	32.0	1	1	0
PRT	sp|P09132|SRP19_HUMAN	Signal recognition particle 19 kDa protein OS=Homo sapiens OX=9606 GN=SRP19 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	135-UNIMOD:21	0.12	32.0	2	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	256-UNIMOD:35	0.13	31.0	6	5	4
PRT	sp|Q96SB3|NEB2_HUMAN	Neurabin-2 OS=Homo sapiens OX=9606 GN=PPP1R9B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	99-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q14CZ8|HECAM_HUMAN	Hepatocyte cell adhesion molecule OS=Homo sapiens OX=9606 GN=HEPACAM PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	318-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	228-UNIMOD:21	0.09	31.0	2	2	2
PRT	sp|P01112-2|RASH_HUMAN	Isoform 2 of GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	111-UNIMOD:35	0.08	31.0	1	1	1
PRT	sp|Q6KC79-2|NIPBL_HUMAN	Isoform 2 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	318-UNIMOD:21	0.01	31.0	5	1	0
PRT	sp|Q71F56|MD13L_HUMAN	Mediator of RNA polymerase II transcription subunit 13-like OS=Homo sapiens OX=9606 GN=MED13L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	762-UNIMOD:21,915-UNIMOD:35,923-UNIMOD:21	0.01	31.0	3	2	1
PRT	sp|Q2T9K0-2|TMM44_HUMAN	Isoform 2 of Transmembrane protein 44 OS=Homo sapiens OX=9606 GN=TMEM44	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	286-UNIMOD:21,295-UNIMOD:4	0.04	31.0	2	1	0
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1283-UNIMOD:21,1179-UNIMOD:35,1182-UNIMOD:21,1189-UNIMOD:35,1176-UNIMOD:21	0.04	31.0	6	3	2
PRT	sp|P33241-2|LSP1_HUMAN	Isoform 2 of Lymphocyte-specific protein 1 OS=Homo sapiens OX=9606 GN=LSP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	79-UNIMOD:21	0.06	31.0	1	1	1
PRT	sp|Q96C86|DCPS_HUMAN	m7GpppX diphosphatase OS=Homo sapiens OX=9606 GN=DCPS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	24-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q13555-10|KCC2G_HUMAN	Isoform 10 of Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	334-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	436-UNIMOD:21,430-UNIMOD:21,425-UNIMOD:27,438-UNIMOD:21,372-UNIMOD:35	0.10	31.0	15	4	2
PRT	sp|P04004|VTNC_HUMAN	Vitronectin OS=Homo sapiens OX=9606 GN=VTN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	3	1	0
PRT	sp|O00192-2|ARVC_HUMAN	Isoform Short of Armadillo repeat protein deleted in velo-cardio-facial syndrome OS=Homo sapiens OX=9606 GN=ARVCF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	852-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P27216-2|ANX13_HUMAN	Isoform B of Annexin A13 OS=Homo sapiens OX=9606 GN=ANXA13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	36-UNIMOD:21	0.08	31.0	2	2	2
PRT	sp|Q13228-2|SBP1_HUMAN	Isoform 2 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	3	2	1
PRT	sp|P08473|NEP_HUMAN	Neprilysin OS=Homo sapiens OX=9606 GN=MME PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	4-UNIMOD:21,8-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	650-UNIMOD:21,653-UNIMOD:4,2366-UNIMOD:35,2369-UNIMOD:4,2377-UNIMOD:4,2378-UNIMOD:21	0.01	31.0	2	2	2
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	126-UNIMOD:21,158-UNIMOD:21	0.14	31.0	4	2	0
PRT	sp|Q9UI30-2|TR112_HUMAN	Isoform 2 of Multifunctional methyltransferase subunit TRM112-like protein OS=Homo sapiens OX=9606 GN=TRMT112	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.13	31.0	1	1	1
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	770-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	154-UNIMOD:4	0.15	31.0	4	3	2
PRT	sp|O95831-6|AIFM1_HUMAN	Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	29-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|P27816-6|MAP4_HUMAN	Isoform 6 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	635-UNIMOD:4,636-UNIMOD:21,278-UNIMOD:35,280-UNIMOD:21	0.03	31.0	13	3	1
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	923-UNIMOD:21,878-UNIMOD:21,1503-UNIMOD:21	0.02	31.0	4	3	2
PRT	sp|P37108|SRP14_HUMAN	Signal recognition particle 14 kDa protein OS=Homo sapiens OX=9606 GN=SRP14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	45-UNIMOD:21	0.10	31.0	1	1	1
PRT	sp|Q9UGJ0-3|AAKG2_HUMAN	Isoform C of 5'-AMP-activated protein kinase subunit gamma-2 OS=Homo sapiens OX=9606 GN=PRKAG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	113-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q12797-7|ASPH_HUMAN	Isoform 7 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.09	31.0	1	1	1
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1228-UNIMOD:4,1231-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q7L4I2|RSRC2_HUMAN	Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	372-UNIMOD:35,376-UNIMOD:21,382-UNIMOD:4,2-UNIMOD:1,17-UNIMOD:21	0.10	31.0	4	3	2
PRT	sp|Q13905-2|RPGF1_HUMAN	Isoform Short of Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	321-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	12-UNIMOD:21,18-UNIMOD:21,117-UNIMOD:21,118-UNIMOD:35	0.17	31.0	8	5	3
PRT	sp|Q9P270|SLAI2_HUMAN	SLAIN motif-containing protein 2 OS=Homo sapiens OX=9606 GN=SLAIN2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	391-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q63HK5|TSH3_HUMAN	Teashirt homolog 3 OS=Homo sapiens OX=9606 GN=TSHZ3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	85-UNIMOD:35,92-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	883-UNIMOD:35	0.04	31.0	2	2	2
PRT	sp|Q05707-2|COEA1_HUMAN	Isoform 2 of Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1002-UNIMOD:35	0.02	31.0	2	2	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	114-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q96FS4|SIPA1_HUMAN	Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	884-UNIMOD:21	0.03	31.0	2	1	0
PRT	sp|Q9ULH1|ASAP1_HUMAN	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	717-UNIMOD:21,711-UNIMOD:28,839-UNIMOD:21,843-UNIMOD:21	0.03	31.0	3	2	1
PRT	sp|Q8N3V7-2|SYNPO_HUMAN	Isoform 2 of Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	854-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q8IWC1-2|MA7D3_HUMAN	Isoform 2 of MAP7 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=MAP7D3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	186-UNIMOD:21,185-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1541-UNIMOD:21,1552-UNIMOD:21,1378-UNIMOD:21,1539-UNIMOD:21	0.01	31.0	5	2	1
PRT	sp|Q9UBF8-2|PI4KB_HUMAN	Isoform 2 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	275-UNIMOD:21,294-UNIMOD:21	0.04	31.0	3	2	1
PRT	sp|Q9Y2J2-2|E41L3_HUMAN	Isoform 2 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	443-UNIMOD:21,457-UNIMOD:35,651-UNIMOD:21,76-UNIMOD:28,88-UNIMOD:21,478-UNIMOD:21	0.09	31.0	9	4	2
PRT	sp|O95292|VAPB_HUMAN	Vesicle-associated membrane protein-associated protein B/C OS=Homo sapiens OX=9606 GN=VAPB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	158-UNIMOD:21,160-UNIMOD:21	0.06	31.0	4	1	0
PRT	sp|P51159-2|RB27A_HUMAN	Isoform Short of Ras-related protein Rab-27A OS=Homo sapiens OX=9606 GN=RAB27A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	198-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|Q02410-2|APBA1_HUMAN	Isoform 2 of Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	555-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	64-UNIMOD:4,71-UNIMOD:21	0.11	31.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	77-UNIMOD:4,86-UNIMOD:4,289-UNIMOD:4,416-UNIMOD:4,414-UNIMOD:28,572-UNIMOD:35,550-UNIMOD:28	0.12	31.0	11	6	4
PRT	sp|Q6NUK4|REEP3_HUMAN	Receptor expression-enhancing protein 3 OS=Homo sapiens OX=9606 GN=REEP3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	210-UNIMOD:21,214-UNIMOD:35	0.07	31.0	1	1	1
PRT	sp|Q8WVV9-3|HNRLL_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein L-like OS=Homo sapiens OX=9606 GN=HNRNPLL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	30-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|Q9UDT6-2|CLIP2_HUMAN	Isoform 2 of CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	211-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q9BUE6|ISCA1_HUMAN	Iron-sulfur cluster assembly 1 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=ISCA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	73-UNIMOD:21	0.12	31.0	1	1	1
PRT	sp|P36957|ODO2_HUMAN	Dihydrolipoyllysine-residue succinyltransferase component of 2-oxoglutarate dehydrogenase complex, mitochondrial OS=Homo sapiens OX=9606 GN=DLST PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	1315-UNIMOD:21,1324-UNIMOD:35,1028-UNIMOD:21	0.02	31.0	2	2	2
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	72-UNIMOD:21,101-UNIMOD:21,74-UNIMOD:21	0.03	31.0	6	3	2
PRT	sp|P78549-3|NTH_HUMAN	Isoform 3 of Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	56-UNIMOD:21	0.06	31.0	1	1	0
PRT	sp|Q8NF50-4|DOCK8_HUMAN	Isoform 4 of Dedicator of cytokinesis protein 8 OS=Homo sapiens OX=9606 GN=DOCK8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	833-UNIMOD:35,836-UNIMOD:21	0.02	31.0	2	2	2
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.10	31.0	31	1	0
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	51-UNIMOD:35	0.10	31.0	4	4	4
PRT	sp|Q07866-6|KLC1_HUMAN	Isoform N of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	546-UNIMOD:21,622-UNIMOD:21	0.05	31.0	3	2	1
PRT	sp|P02679-2|FIBG_HUMAN	Isoform Gamma-A of Fibrinogen gamma chain OS=Homo sapiens OX=9606 GN=FGG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q58FG1|HS904_HUMAN	Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens OX=9606 GN=HSP90AA4P PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	38-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|Q8N556|AFAP1_HUMAN	Actin filament-associated protein 1 OS=Homo sapiens OX=9606 GN=AFAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	282-UNIMOD:21,296-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q5JU85|IQEC2_HUMAN	IQ motif and SEC7 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=IQSEC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	618-UNIMOD:28,626-UNIMOD:4,627-UNIMOD:21,212-UNIMOD:21	0.03	31.0	2	2	2
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	75-UNIMOD:21,66-UNIMOD:27	0.01	31.0	9	1	0
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	385-UNIMOD:21,389-UNIMOD:21	0.04	31.0	3	1	0
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	810-UNIMOD:21,300-UNIMOD:21,294-UNIMOD:21,809-UNIMOD:21	0.02	30.0	5	2	0
PRT	sp|Q52LW3-2|RHG29_HUMAN	Isoform 2 of Rho GTPase-activating protein 29 OS=Homo sapiens OX=9606 GN=ARHGAP29	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	357-UNIMOD:21,356-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|Q96IX5|USMG5_HUMAN	Up-regulated during skeletal muscle growth protein 5 OS=Homo sapiens OX=9606 GN=ATP5MD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.28	30.0	1	1	1
PRT	sp|Q16568|CART_HUMAN	Cocaine- and amphetamine-regulated transcript protein OS=Homo sapiens OX=9606 GN=CARTPT PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	48-UNIMOD:21	0.14	30.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	199-UNIMOD:21	0.09	30.0	1	1	1
PRT	sp|Q9UKI8-5|TLK1_HUMAN	Isoform 5 of Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	46-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P29590-2|PML_HUMAN	Isoform PML-5 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	518-UNIMOD:21,527-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|Q8NEF9|SRFB1_HUMAN	Serum response factor-binding protein 1 OS=Homo sapiens OX=9606 GN=SRFBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	203-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P18583-2|SON_HUMAN	Isoform A of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	92-UNIMOD:4,94-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|Q6UB98-2|ANR12_HUMAN	Isoform 2 of Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1349-UNIMOD:21,1118-UNIMOD:21	0.02	30.0	2	2	2
PRT	sp|Q7Z3J3|RGPD4_HUMAN	RanBP2-like and GRIP domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RGPD4 PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1275-UNIMOD:21,1276-UNIMOD:21,1271-UNIMOD:21	0.01	30.0	3	1	0
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	342-UNIMOD:21,214-UNIMOD:21	0.08	30.0	3	3	3
PRT	sp|O76070|SYUG_HUMAN	Gamma-synuclein OS=Homo sapiens OX=9606 GN=SNCG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	1	1	1
PRT	sp|Q9UHB6-3|LIMA1_HUMAN	Isoform 3 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	188-UNIMOD:21,185-UNIMOD:21	0.06	30.0	7	2	1
PRT	sp|Q9H3U1-3|UN45A_HUMAN	Isoform 3 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P35998|PRS7_HUMAN	26S proteasome regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|P27635|RL10_HUMAN	60S ribosomal protein L10 OS=Homo sapiens OX=9606 GN=RPL10 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	184-UNIMOD:35	0.07	30.0	1	1	1
PRT	sp|Q9BVG4|PBDC1_HUMAN	Protein PBDC1 OS=Homo sapiens OX=9606 GN=PBDC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	197-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	130-UNIMOD:21	0.07	30.0	3	1	0
PRT	sp|Q68DA7-3|FMN1_HUMAN	Isoform 3 of Formin-1 OS=Homo sapiens OX=9606 GN=FMN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	288-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	176-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	236-UNIMOD:35,242-UNIMOD:21	0.07	30.0	2	1	0
PRT	sp|P04075|ALDOA_HUMAN	Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	4	3	2
PRT	sp|P14550|AK1A1_HUMAN	Alcohol dehydrogenase [NADP(+)] OS=Homo sapiens OX=9606 GN=AKR1A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q15311|RBP1_HUMAN	RalA-binding protein 1 OS=Homo sapiens OX=9606 GN=RALBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	463-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9Y2W6-3|TDRKH_HUMAN	Isoform 2 of Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1576-UNIMOD:21,1653-UNIMOD:21	0.02	30.0	3	3	3
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	3	3	3
PRT	sp|Q13510|ASAH1_HUMAN	Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	301-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q5T1M5-2|FKB15_HUMAN	Isoform 2 of FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1002-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|Q15788-2|NCOA1_HUMAN	Isoform 2 of Nuclear receptor coactivator 1 OS=Homo sapiens OX=9606 GN=NCOA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	22-UNIMOD:21,24-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|O00559|RCAS1_HUMAN	Receptor-binding cancer antigen expressed on SiSo cells OS=Homo sapiens OX=9606 GN=EBAG9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	36-UNIMOD:21	0.10	30.0	1	1	1
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1029-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	2526-UNIMOD:21,2528-UNIMOD:21	0.01	30.0	4	2	0
PRT	sp|Q9HAN9|NMNA1_HUMAN	Nicotinamide/nicotinic acid mononucleotide adenylyltransferase 1 OS=Homo sapiens OX=9606 GN=NMNAT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	111-UNIMOD:4,117-UNIMOD:21	0.06	30.0	2	1	0
PRT	sp|P34910|EVI2B_HUMAN	Protein EVI2B OS=Homo sapiens OX=9606 GN=EVI2B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q8IXK0-3|PHC2_HUMAN	Isoform 3 of Polyhomeotic-like protein 2 OS=Homo sapiens OX=9606 GN=PHC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	34-UNIMOD:21,38-UNIMOD:35	0.09	30.0	1	1	1
PRT	sp|P35442|TSP2_HUMAN	Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	1	0
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	712-UNIMOD:4,2413-UNIMOD:21,2421-UNIMOD:4	0.01	30.0	2	2	2
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1956-UNIMOD:35,864-UNIMOD:4,866-UNIMOD:21	0.01	30.0	2	2	2
PRT	sp|Q9Y5A7-2|NUB1_HUMAN	Isoform 2 of NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	312-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|P54198|HIRA_HUMAN	Protein HIRA OS=Homo sapiens OX=9606 GN=HIRA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	538-UNIMOD:21,539-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1054-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|P42694|HELZ_HUMAN	Probable helicase with zinc finger domain OS=Homo sapiens OX=9606 GN=HELZ PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1763-UNIMOD:21,1770-UNIMOD:4,1784-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|A8TX70-2|CO6A5_HUMAN	Isoform 2 of Collagen alpha-5(VI) chain OS=Homo sapiens OX=9606 GN=COL6A5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	2255-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q6PID6|TTC33_HUMAN	Tetratricopeptide repeat protein 33 OS=Homo sapiens OX=9606 GN=TTC33 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	197-UNIMOD:21	0.05	30.0	2	1	0
PRT	sp|P10645|CMGA_HUMAN	Chromogranin-A OS=Homo sapiens OX=9606 GN=CHGA PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	333-UNIMOD:21,322-UNIMOD:21,309-UNIMOD:35,142-UNIMOD:21,158-UNIMOD:35	0.19	30.0	7	6	5
PRT	sp|Q9UMS6|SYNP2_HUMAN	Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	152-UNIMOD:4,155-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|Q641Q2-2|WAC2A_HUMAN	Isoform 2 of WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1274-UNIMOD:35,314-UNIMOD:21	0.03	30.0	2	2	2
PRT	sp|Q96L93-5|KI16B_HUMAN	Isoform 4 of Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1016-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q8IY57-3|YAF2_HUMAN	Isoform 3 of YY1-associated factor 2 OS=Homo sapiens OX=9606 GN=YAF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	107-UNIMOD:21	0.19	30.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1089-UNIMOD:21	0.01	30.0	3	1	0
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	247-UNIMOD:21,249-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|Q3LXA3-2|TKFC_HUMAN	Isoform 2 of Triokinase/FMN cyclase OS=Homo sapiens OX=9606 GN=TKFC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	350-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P01857|IGHG1_HUMAN	Immunoglobulin heavy constant gamma 1 OS=Homo sapiens OX=9606 GN=IGHG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	27-UNIMOD:4	0.05	30.0	1	1	1
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	24-UNIMOD:21	0.07	30.0	1	1	1
PRT	sp|P35612|ADDB_HUMAN	Beta-adducin OS=Homo sapiens OX=9606 GN=ADD2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	692-UNIMOD:35,701-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1120-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	47-UNIMOD:21,51-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|P13994|CC130_HUMAN	Coiled-coil domain-containing protein 130 OS=Homo sapiens OX=9606 GN=CCDC130 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	331-UNIMOD:35,332-UNIMOD:21,336-UNIMOD:4,362-UNIMOD:21,357-UNIMOD:28,306-UNIMOD:21	0.16	30.0	4	3	2
PRT	sp|Q9HB58-5|SP110_HUMAN	Isoform 5 of Sp110 nuclear body protein OS=Homo sapiens OX=9606 GN=SP110	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	378-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P12111-4|CO6A3_HUMAN	Isoform 4 of Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	5	5	5
PRT	sp|Q96EU7|C1GLC_HUMAN	C1GALT1-specific chaperone 1 OS=Homo sapiens OX=9606 GN=C1GALT1C1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	1103-UNIMOD:28,1106-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|Q32MZ4|LRRF1_HUMAN	Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	726-UNIMOD:385,726-UNIMOD:4,735-UNIMOD:21,742-UNIMOD:4	0.03	30.0	1	1	0
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	490-UNIMOD:21,486-UNIMOD:27,487-UNIMOD:21	0.02	30.0	6	1	0
PRT	sp|Q9ULC3|RAB23_HUMAN	Ras-related protein Rab-23 OS=Homo sapiens OX=9606 GN=RAB23 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	175-UNIMOD:28,186-UNIMOD:21,187-UNIMOD:21	0.07	30.0	4	1	0
PRT	sp|Q14738|2A5D_HUMAN	Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	573-UNIMOD:21	0.02	30.0	1	1	0
PRT	sp|Q7Z3E2|CC186_HUMAN	Coiled-coil domain-containing protein 186 OS=Homo sapiens OX=9606 GN=CCDC186 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	740-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P35232|PHB_HUMAN	Prohibitin OS=Homo sapiens OX=9606 GN=PHB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	3	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	150-UNIMOD:21,252-UNIMOD:21,145-UNIMOD:21	0.11	29.0	3	2	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	485-UNIMOD:21,494-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|Q86VM9-2|ZCH18_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	179-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q53F19-2|NCBP3_HUMAN	Isoform 2 of Nuclear cap-binding protein subunit 3 OS=Homo sapiens OX=9606 GN=NCBP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|Q9HD26-2|GOPC_HUMAN	Isoform 2 of Golgi-associated PDZ and coiled-coil motif-containing protein OS=Homo sapiens OX=9606 GN=GOPC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	433-UNIMOD:21	0.08	29.0	2	2	2
PRT	sp|Q8TF40-3|FNIP1_HUMAN	Isoform 3 of Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	87-UNIMOD:4,88-UNIMOD:4,96-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	2	1	0
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	1	1	0
PRT	sp|O00533|NCHL1_HUMAN	Neural cell adhesion molecule L1-like protein OS=Homo sapiens OX=9606 GN=CHL1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	1137-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q9H7S9|ZN703_HUMAN	Zinc finger protein 703 OS=Homo sapiens OX=9606 GN=ZNF703 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	252-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	86-UNIMOD:35	0.11	29.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	226-UNIMOD:21,255-UNIMOD:21	0.04	29.0	2	2	2
PRT	sp|Q86U86-5|PB1_HUMAN	Isoform 5 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	634-UNIMOD:35,1099-UNIMOD:21	0.02	29.0	2	2	2
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	38-UNIMOD:4	0.06	29.0	2	2	2
PRT	sp|P14209-3|CD99_HUMAN	Isoform 3 of CD99 antigen OS=Homo sapiens OX=9606 GN=CD99	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	150-UNIMOD:35,152-UNIMOD:21	0.09	29.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	3	1	0
PRT	sp|P24928-2|RPB1_HUMAN	Isoform 2 of DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	176-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q9ULL5-3|PRR12_HUMAN	Isoform 3 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	738-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q6NXT4-4|ZNT6_HUMAN	Isoform 4 of Zinc transporter 6 OS=Homo sapiens OX=9606 GN=SLC30A6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	352-UNIMOD:21	0.07	29.0	1	1	1
PRT	sp|Q9UQ88-8|CD11A_HUMAN	Isoform SV12 of Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	123-UNIMOD:21,124-UNIMOD:21	0.14	29.0	3	1	0
PRT	sp|Q9P227-2|RHG23_HUMAN	Isoform 2 of Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	677-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	218-UNIMOD:4,67-UNIMOD:4	0.15	29.0	3	3	3
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	591-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|O95163|ELP1_HUMAN	Elongator complex protein 1 OS=Homo sapiens OX=9606 GN=ELP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	2	1	0
PRT	sp|Q9NW68-9|BSDC1_HUMAN	Isoform 9 of BSD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BSDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	292-UNIMOD:21	0.04	29.0	1	1	0
PRT	sp|Q96RK0|CIC_HUMAN	Protein capicua homolog OS=Homo sapiens OX=9606 GN=CIC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	1397-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	36-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|P55085|PAR2_HUMAN	Proteinase-activated receptor 2 OS=Homo sapiens OX=9606 GN=F2RL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	384-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q9Y2K1-2|ZBTB1_HUMAN	Isoform 2 of Zinc finger and BTB domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZBTB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	305-UNIMOD:21	0.02	29.0	2	1	0
PRT	sp|Q14108-2|SCRB2_HUMAN	Isoform 2 of Lysosome membrane protein 2 OS=Homo sapiens OX=9606 GN=SCARB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	1671-UNIMOD:21	0.00	29.0	1	1	1
PRT	sp|Q9H2U2-6|IPYR2_HUMAN	Isoform 5 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	178-UNIMOD:35,187-UNIMOD:35	0.04	29.0	2	1	0
PRT	sp|Q9ULK0-2|GRID1_HUMAN	Isoform 2 of Glutamate receptor ionotropic, delta-1 OS=Homo sapiens OX=9606 GN=GRID1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	451-UNIMOD:35,453-UNIMOD:21,455-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	53-UNIMOD:21	0.02	29.0	2	1	0
PRT	sp|O14908-2|GIPC1_HUMAN	Isoform 2 of PDZ domain-containing protein GIPC1 OS=Homo sapiens OX=9606 GN=GIPC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	2	2	2
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	2954-UNIMOD:21,659-UNIMOD:21,664-UNIMOD:35	0.01	29.0	2	2	2
PRT	sp|Q9NX47|MARH5_HUMAN	E3 ubiquitin-protein ligase MARCH5 OS=Homo sapiens OX=9606 GN=MARCH5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	14-UNIMOD:4,17-UNIMOD:4	0.05	29.0	2	1	0
PRT	sp|Q8N488|RYBP_HUMAN	RING1 and YY1-binding protein OS=Homo sapiens OX=9606 GN=RYBP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	123-UNIMOD:21	0.10	29.0	1	1	1
PRT	sp|O75179-6|ANR17_HUMAN	Isoform 6 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	1388-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q92539|LPIN2_HUMAN	Phosphatidate phosphatase LPIN2 OS=Homo sapiens OX=9606 GN=LPIN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	243-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q14191|WRN_HUMAN	Werner syndrome ATP-dependent helicase OS=Homo sapiens OX=9606 GN=WRN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	478-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q9UI08-4|EVL_HUMAN	Isoform 4 of Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	331-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	426-UNIMOD:21,143-UNIMOD:21	0.06	29.0	2	2	2
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	242-UNIMOD:21,776-UNIMOD:21	0.03	29.0	2	2	2
PRT	sp|P01591|IGJ_HUMAN	Immunoglobulin J chain OS=Homo sapiens OX=9606 GN=JCHAIN PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	770-UNIMOD:4,782-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q96RT1-7|ERBIN_HUMAN	Isoform 7 of Erbin OS=Homo sapiens OX=9606 GN=ERBIN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	841-UNIMOD:21,843-UNIMOD:4	0.01	29.0	2	1	0
PRT	sp|P18858-2|DNLI1_HUMAN	Isoform 2 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	2	1	0
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	92-UNIMOD:35	0.10	29.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	243-UNIMOD:21,246-UNIMOD:4,340-UNIMOD:35	0.04	29.0	2	2	2
PRT	sp|P26358-3|DNMT1_HUMAN	Isoform 3 of DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P00558-2|PGK1_HUMAN	Isoform 2 of Phosphoglycerate kinase 1 OS=Homo sapiens OX=9606 GN=PGK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	223-UNIMOD:35	0.08	29.0	2	2	2
PRT	sp|P69892|HBG2_HUMAN	Hemoglobin subunit gamma-2 OS=Homo sapiens OX=9606 GN=HBG2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.10	29.0	1	1	1
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|P02730-2|B3AT_HUMAN	Isoform 2 of Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	291-UNIMOD:21,820-UNIMOD:4,292-UNIMOD:21	0.03	29.0	4	2	1
PRT	sp|P48960-2|CD97_HUMAN	Isoform 2 of CD97 antigen OS=Homo sapiens OX=9606 GN=CD97	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	732-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q05707|COEA1_HUMAN	Collagen alpha-1(XIV) chain OS=Homo sapiens OX=9606 GN=COL14A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	0
PRT	sp|P21291|CSRP1_HUMAN	Cysteine and glycine-rich protein 1 OS=Homo sapiens OX=9606 GN=CSRP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	79-UNIMOD:21	0.18	29.0	3	3	3
PRT	sp|Q9ULV3|CIZ1_HUMAN	Cip1-interacting zinc finger protein OS=Homo sapiens OX=9606 GN=CIZ1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	344-UNIMOD:28,350-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	220-UNIMOD:21,243-UNIMOD:4,468-UNIMOD:21	0.04	29.0	3	2	1
PRT	sp|O14618|CCS_HUMAN	Copper chaperone for superoxide dismutase OS=Homo sapiens OX=9606 GN=CCS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	29.0	null	132-UNIMOD:4,138-UNIMOD:21,132-UNIMOD:385	0.04	29.0	9	1	0
PRT	sp|Q14318|FKBP8_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP8 OS=Homo sapiens OX=9606 GN=FKBP8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	295-UNIMOD:4,296-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	874-UNIMOD:21	0.02	29.0	1	1	0
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	642-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|P05141|ADT2_HUMAN	ADP/ATP translocase 2 OS=Homo sapiens OX=9606 GN=SLC25A5 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	3	2	1
PRT	sp|P23786|CPT2_HUMAN	Carnitine O-palmitoyltransferase 2, mitochondrial OS=Homo sapiens OX=9606 GN=CPT2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	647-UNIMOD:35	0.02	28.0	2	1	0
PRT	sp|Q9H0E3|SP130_HUMAN	Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	300-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q68DQ2-1|CRBG3_HUMAN	Isoform 1 of Very large A-kinase anchor protein OS=Homo sapiens OX=9606 GN=CRYBG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	945-UNIMOD:4,954-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|O94804|STK10_HUMAN	Serine/threonine-protein kinase 10 OS=Homo sapiens OX=9606 GN=STK10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	454-UNIMOD:21,448-UNIMOD:21	0.02	28.0	5	1	0
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	403-UNIMOD:21,540-UNIMOD:35,390-UNIMOD:21,392-UNIMOD:21	0.16	28.0	7	7	5
PRT	sp|Q8NFH5-3|NUP35_HUMAN	Isoform 3 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	173-UNIMOD:21	0.09	28.0	1	1	1
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	666-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|O96019-2|ACL6A_HUMAN	Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	12-UNIMOD:35	0.04	28.0	1	1	1
PRT	sp|Q9H9C1-2|SPE39_HUMAN	Isoform 2 of Spermatogenesis-defective protein 39 homolog OS=Homo sapiens OX=9606 GN=VIPAS39	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	358-UNIMOD:35,488-UNIMOD:35	0.09	28.0	8	4	2
PRT	sp|Q9BRK5-4|CAB45_HUMAN	Isoform 4 of 45 kDa calcium-binding protein OS=Homo sapiens OX=9606 GN=SDF4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P61160|ARP2_HUMAN	Actin-related protein 2 OS=Homo sapiens OX=9606 GN=ACTR2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	56-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|Q12864|CAD17_HUMAN	Cadherin-17 OS=Homo sapiens OX=9606 GN=CDH17 PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	832-UNIMOD:21,821-UNIMOD:21,825-UNIMOD:21	0.02	28.0	3	2	1
PRT	sp|Q9Y287-2|ITM2B_HUMAN	Isoform 2 of Integral membrane protein 2B OS=Homo sapiens OX=9606 GN=ITM2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	559-UNIMOD:21	0.06	28.0	4	3	2
PRT	sp|P38159-2|RBMX_HUMAN	Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	319-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	92-UNIMOD:35,93-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q2M1Z3|RHG31_HUMAN	Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1080-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q08J23-3|NSUN2_HUMAN	Isoform 3 of tRNA (cytosine(34)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	216-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|O43561-4|LAT_HUMAN	Isoform 4 of Linker for activation of T-cells family member 1 OS=Homo sapiens OX=9606 GN=LAT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	194-UNIMOD:21	0.07	28.0	1	1	1
PRT	sp|P06744|G6PI_HUMAN	Glucose-6-phosphate isomerase OS=Homo sapiens OX=9606 GN=GPI PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	357-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|O43149|ZZEF1_HUMAN	Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZZEF1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	2444-UNIMOD:21	0.01	28.0	2	2	2
PRT	sp|P09486|SPRC_HUMAN	SPARC OS=Homo sapiens OX=9606 GN=SPARC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	273-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	245-UNIMOD:4,92-UNIMOD:21,94-UNIMOD:21	0.07	28.0	4	2	0
PRT	sp|P19105|ML12A_HUMAN	Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|O75363-2|BCAS1_HUMAN	Isoform 2 of Breast carcinoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=BCAS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	359-UNIMOD:21,368-UNIMOD:21	0.03	28.0	2	2	2
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	676-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q9Y3S1-2|WNK2_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1276-UNIMOD:21,1283-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q9UGM5-2|FETUB_HUMAN	Isoform 2 of Fetuin-B OS=Homo sapiens OX=9606 GN=FETUB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	278-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	135-UNIMOD:21,151-UNIMOD:21,155-UNIMOD:21	0.03	28.0	4	2	1
PRT	sp|Q8TF47|ZFP90_HUMAN	Zinc finger protein 90 homolog OS=Homo sapiens OX=9606 GN=ZFP90 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	435-UNIMOD:21,434-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|Q9P2R7-2|SUCB1_HUMAN	Isoform 2 of Succinate--CoA ligase [ADP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	408-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9H1B7|I2BPL_HUMAN	Interferon regulatory factor 2-binding protein-like OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	547-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P11137-3|MTAP2_HUMAN	Isoform 3 of Microtubule-associated protein 2 OS=Homo sapiens OX=9606 GN=MAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1151-UNIMOD:21,1530-UNIMOD:21	0.02	28.0	2	2	2
PRT	sp|Q15714-4|T22D1_HUMAN	Isoform 4 of TSC22 domain family protein 1 OS=Homo sapiens OX=9606 GN=TSC22D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	263-UNIMOD:21,290-UNIMOD:35,293-UNIMOD:35	0.06	28.0	1	1	1
PRT	sp|P28290-2|ITPI2_HUMAN	Isoform 2 of Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	438-UNIMOD:21,446-UNIMOD:4	0.02	28.0	2	1	0
PRT	sp|Q5T890|ER6L2_HUMAN	DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens OX=9606 GN=ERCC6L2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1370-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q9UGU5|HMGX4_HUMAN	HMG domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGXB4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	102-UNIMOD:21,110-UNIMOD:35	0.03	28.0	2	1	0
PRT	sp|Q05193-5|DYN1_HUMAN	Isoform 4 of Dynamin-1 OS=Homo sapiens OX=9606 GN=DNM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	210-UNIMOD:35	0.01	28.0	1	1	1
PRT	sp|Q15149-6|PLEC_HUMAN	Isoform 6 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	4	4	4
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	388-UNIMOD:21,1184-UNIMOD:4,1185-UNIMOD:21	0.01	28.0	4	2	0
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	515-UNIMOD:35	0.03	28.0	2	2	1
PRT	sp|Q9Y223-5|GLCNE_HUMAN	Isoform 5 of Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase OS=Homo sapiens OX=9606 GN=GNE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|Q13310-2|PABP4_HUMAN	Isoform 2 of Polyadenylate-binding protein 4 OS=Homo sapiens OX=9606 GN=PABPC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|O00203-3|AP3B1_HUMAN	Isoform 2 of AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	227-UNIMOD:21	0.01	28.0	6	1	0
PRT	sp|O75815-2|BCAR3_HUMAN	Isoform 2 of Breast cancer anti-estrogen resistance protein 3 OS=Homo sapiens OX=9606 GN=BCAR3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P35908|K22E_HUMAN	Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens OX=9606 GN=KRT2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9Y6H1|CHCH2_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 2 OS=Homo sapiens OX=9606 GN=CHCHD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	124-UNIMOD:4	0.09	28.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	3792-UNIMOD:21,3794-UNIMOD:35	0.01	28.0	1	1	1
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	41-UNIMOD:21	0.15	28.0	1	1	1
PRT	sp|Q96NY7-2|CLIC6_HUMAN	Isoform A of Chloride intracellular channel protein 6 OS=Homo sapiens OX=9606 GN=CLIC6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	293-UNIMOD:21	0.05	28.0	3	1	0
PRT	sp|Q9BXK5-4|B2L13_HUMAN	Isoform 3 of Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	141-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q76L83|ASXL2_HUMAN	Putative Polycomb group protein ASXL2 OS=Homo sapiens OX=9606 GN=ASXL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	524-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|O75592-2|MYCB2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	2869-UNIMOD:21,2723-UNIMOD:21	0.01	28.0	2	2	2
PRT	sp|Q14244-5|MAP7_HUMAN	Isoform 5 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	94-UNIMOD:21,107-UNIMOD:4,112-UNIMOD:35	0.04	28.0	1	1	1
PRT	sp|Q5HYJ3-3|FA76B_HUMAN	Isoform 3 of Protein FAM76B OS=Homo sapiens OX=9606 GN=FAM76B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	151-UNIMOD:21	0.08	28.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	721-UNIMOD:21,709-UNIMOD:35,422-UNIMOD:4,237-UNIMOD:35	0.06	28.0	8	5	4
PRT	sp|P07951-2|TPM2_HUMAN	Isoform 2 of Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	208-UNIMOD:35	0.05	28.0	2	1	0
PRT	sp|Q9Y3C5|RNF11_HUMAN	RING finger protein 11 OS=Homo sapiens OX=9606 GN=RNF11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	19-UNIMOD:21,14-UNIMOD:21	0.12	28.0	2	1	0
PRT	sp|Q9UKE5-8|TNIK_HUMAN	Isoform 8 of TRAF2 and NCK-interacting protein kinase OS=Homo sapiens OX=9606 GN=TNIK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	526-UNIMOD:21,859-UNIMOD:21,865-UNIMOD:35,873-UNIMOD:35	0.03	28.0	2	2	2
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	259-UNIMOD:35,133-UNIMOD:21,202-UNIMOD:35	0.16	28.0	5	5	5
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	258-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	355-UNIMOD:21,358-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q2M2I3|FA83E_HUMAN	Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	319-UNIMOD:21,324-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	197-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|P40818|UBP8_HUMAN	Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	716-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q01995|TAGL_HUMAN	Transgelin OS=Homo sapiens OX=9606 GN=TAGLN PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	111-UNIMOD:35	0.07	28.0	1	1	1
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	54-UNIMOD:21,55-UNIMOD:21	0.13	28.0	2	1	0
PRT	sp|P62328|TYB4_HUMAN	Thymosin beta-4 OS=Homo sapiens OX=9606 GN=TMSB4X PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	23-UNIMOD:21,31-UNIMOD:21	0.45	28.0	2	2	2
PRT	sp|P20073-2|ANXA7_HUMAN	Isoform 2 of Annexin A7 OS=Homo sapiens OX=9606 GN=ANXA7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	447-UNIMOD:35	0.03	28.0	2	1	0
PRT	sp|Q6H8Q1-4|ABLM2_HUMAN	Isoform 4 of Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	209-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q9UKT5-2|FBX4_HUMAN	Isoform 2 of F-box only protein 4 OS=Homo sapiens OX=9606 GN=FBXO4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	48-UNIMOD:21,46-UNIMOD:21	0.06	28.0	2	1	0
PRT	sp|Q16762|THTR_HUMAN	Thiosulfate sulfurtransferase OS=Homo sapiens OX=9606 GN=TST PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q8N4S9-2|MALD2_HUMAN	Isoform 2 of MARVEL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MARVELD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	173-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q01105-3|SET_HUMAN	Isoform 3 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	108-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q9NR45|SIAS_HUMAN	Sialic acid synthase OS=Homo sapiens OX=9606 GN=NANS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|Q9NR12-2|PDLI7_HUMAN	Isoform 2 of PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9UNP9-2|PPIE_HUMAN	Isoform B of Peptidyl-prolyl cis-trans isomerase E OS=Homo sapiens OX=9606 GN=PPIE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|O14907|TX1B3_HUMAN	Tax1-binding protein 3 OS=Homo sapiens OX=9606 GN=TAX1BP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.15	28.0	1	1	1
PRT	sp|Q6NV74|K121L_HUMAN	Uncharacterized protein KIAA1211-like OS=Homo sapiens OX=9606 GN=KIAA1211L PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	185-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|Q86XP3-2|DDX42_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX42 OS=Homo sapiens OX=9606 GN=DDX42	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|Q9Y6M7-14|S4A7_HUMAN	Isoform 14 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	18-UNIMOD:21,19-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q6IQ49-3|SDE2_HUMAN	Isoform 3 of Replication stress response regulator SDE2 OS=Homo sapiens OX=9606 GN=SDE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	183-UNIMOD:21	0.06	28.0	2	1	0
PRT	sp|Q0VD83-3|APOBR_HUMAN	Isoform 3 of Apolipoprotein B receptor OS=Homo sapiens OX=9606 GN=APOBR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|Q9UJC5|SH3L2_HUMAN	SH3 domain-binding glutamic acid-rich-like protein 2 OS=Homo sapiens OX=9606 GN=SH3BGRL2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	76-UNIMOD:4	0.12	28.0	1	1	1
PRT	sp|P56211-2|ARP19_HUMAN	Isoform ARPP-16 of cAMP-regulated phosphoprotein 19 OS=Homo sapiens OX=9606 GN=ARPP19	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	51-UNIMOD:35	0.13	28.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	134-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P51784|UBP11_HUMAN	Ubiquitin carboxyl-terminal hydrolase 11 OS=Homo sapiens OX=9606 GN=USP11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	648-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	397-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9Y6R1|S4A4_HUMAN	Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	254-UNIMOD:21,256-UNIMOD:21	0.02	28.0	5	1	0
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	255-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9NS62|THSD1_HUMAN	Thrombospondin type-1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THSD1 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	463-UNIMOD:21,469-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	188-UNIMOD:21	0.05	28.0	1	1	0
PRT	sp|Q9NS37|ZHANG_HUMAN	CREB/ATF bZIP transcription factor OS=Homo sapiens OX=9606 GN=CREBZF PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	50-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q96TA1-2|NIBL1_HUMAN	Isoform 2 of Niban-like protein 1 OS=Homo sapiens OX=9606 GN=FAM129B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	678-UNIMOD:21,683-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q8TDB6|DTX3L_HUMAN	E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	545-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q86TX2|ACOT1_HUMAN	Acyl-coenzyme A thioesterase 1 OS=Homo sapiens OX=9606 GN=ACOT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9NUA8-2|ZBT40_HUMAN	Isoform 2 of Zinc finger and BTB domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ZBTB40	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	139-UNIMOD:35,143-UNIMOD:21	0.12	27.0	1	1	1
PRT	sp|Q8TBC4-2|UBA3_HUMAN	Isoform 2 of NEDD8-activating enzyme E1 catalytic subunit OS=Homo sapiens OX=9606 GN=UBA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9Y2Q3-4|GSTK1_HUMAN	Isoform 4 of Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	104-UNIMOD:35	0.08	27.0	1	1	0
PRT	sp|Q03252|LMNB2_HUMAN	Lamin-B2 OS=Homo sapiens OX=9606 GN=LMNB2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9NZB2-4|F120A_HUMAN	Isoform D of Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens OX=9606 GN=FAM120A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1029-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	310-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q14643-4|ITPR1_HUMAN	Isoform 4 of Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens OX=9606 GN=ITPR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	753-UNIMOD:4,754-UNIMOD:35	0.00	27.0	1	1	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	943-UNIMOD:21,949-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|P42684-4|ABL2_HUMAN	Isoform 4 of Tyrosine-protein kinase ABL2 OS=Homo sapiens OX=9606 GN=ABL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	595-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	194-UNIMOD:21,196-UNIMOD:21,470-UNIMOD:21	0.04	27.0	3	2	1
PRT	sp|O14523|C2C2L_HUMAN	Phospholipid transfer protein C2CD2L OS=Homo sapiens OX=9606 GN=C2CD2L PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	660-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P09455|RET1_HUMAN	Retinol-binding protein 1 OS=Homo sapiens OX=9606 GN=RBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|Q6ZNJ1-2|NBEL2_HUMAN	Isoform 2 of Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1959-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q9H2Y7-2|ZN106_HUMAN	Isoform 2 of Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	556-UNIMOD:21,530-UNIMOD:21,535-UNIMOD:4	0.04	27.0	2	2	1
PRT	sp|Q96H20-2|SNF8_HUMAN	Isoform 2 of Vacuolar-sorting protein SNF8 OS=Homo sapiens OX=9606 GN=SNF8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q5SWX8-4|ODR4_HUMAN	Isoform 4 of Protein odr-4 homolog OS=Homo sapiens OX=9606 GN=ODR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O95260-2|ATE1_HUMAN	Isoform ATE1-2 of Arginyl-tRNA--protein transferase 1 OS=Homo sapiens OX=9606 GN=ATE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q8WU90|ZC3HF_HUMAN	Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	360-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|O60493-2|SNX3_HUMAN	Isoform 2 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	311-UNIMOD:21,1369-UNIMOD:21	0.02	27.0	2	2	2
PRT	sp|P07948-2|LYN_HUMAN	Isoform 2 of Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	11-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|P17612|KAPCA_HUMAN	cAMP-dependent protein kinase catalytic subunit alpha OS=Homo sapiens OX=9606 GN=PRKACA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	15-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|O15061-2|SYNEM_HUMAN	Isoform 2 of Synemin OS=Homo sapiens OX=9606 GN=SYNM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	913-UNIMOD:21	0.03	27.0	3	3	3
PRT	sp|O60565|GREM1_HUMAN	Gremlin-1 OS=Homo sapiens OX=9606 GN=GREM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	68-UNIMOD:35,76-UNIMOD:21	0.13	27.0	1	1	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	443-UNIMOD:21,448-UNIMOD:35	0.04	27.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9NZN5|ARHGC_HUMAN	Rho guanine nucleotide exchange factor 12 OS=Homo sapiens OX=9606 GN=ARHGEF12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	41-UNIMOD:21,294-UNIMOD:4,309-UNIMOD:21	0.02	27.0	2	2	2
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|P09327|VILI_HUMAN	Villin-1 OS=Homo sapiens OX=9606 GN=VIL1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	2	2
PRT	sp|Q96C23|GALM_HUMAN	Aldose 1-epimerase OS=Homo sapiens OX=9606 GN=GALM PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q13492-3|PICAL_HUMAN	Isoform 3 of Phosphatidylinositol-binding clathrin assembly protein OS=Homo sapiens OX=9606 GN=PICALM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	16-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	818-UNIMOD:21,820-UNIMOD:21,814-UNIMOD:21	0.01	27.0	3	1	0
PRT	sp|Q6PJW8-2|CNST_HUMAN	Isoform 2 of Consortin OS=Homo sapiens OX=9606 GN=CNST	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	292-UNIMOD:4,293-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P18827|SDC1_HUMAN	Syndecan-1 OS=Homo sapiens OX=9606 GN=SDC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	285-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q9NR28-2|DBLOH_HUMAN	Isoform 2 of Diablo homolog, mitochondrial OS=Homo sapiens OX=9606 GN=DIABLO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	0
PRT	sp|Q7Z406|MYH14_HUMAN	Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	5	5	5
PRT	sp|Q9NWZ8|GEMI8_HUMAN	Gem-associated protein 8 OS=Homo sapiens OX=9606 GN=GEMIN8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	170-UNIMOD:21,180-UNIMOD:4	0.07	27.0	1	1	1
PRT	sp|P35237|SPB6_HUMAN	Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	282-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1282-UNIMOD:21,1753-UNIMOD:35	0.02	27.0	4	3	2
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	27.0	null	552-UNIMOD:21,347-UNIMOD:21,98-UNIMOD:28,100-UNIMOD:21	0.08	27.0	3	3	3
PRT	sp|P00915|CAH1_HUMAN	Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.07	27.0	2	1	0
PRT	sp|Q9H3H3|CK068_HUMAN	UPF0696 protein C11orf68 OS=Homo sapiens OX=9606 GN=C11orf68 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1-UNIMOD:35	0.07	27.0	1	1	1
PRT	sp|Q9Y247|FA50B_HUMAN	Protein FAM50B OS=Homo sapiens OX=9606 GN=FAM50B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|P0DMV9|HS71B_HUMAN	Heat shock 70 kDa protein 1B OS=Homo sapiens OX=9606 GN=HSPA1B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	87-UNIMOD:35	0.07	27.0	3	3	3
PRT	sp|Q13555-9|KCC2G_HUMAN	Isoform 9 of Calcium/calmodulin-dependent protein kinase type II subunit gamma OS=Homo sapiens OX=9606 GN=CAMK2G	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	343-UNIMOD:21,344-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|Q9UBR2|CATZ_HUMAN	Cathepsin Z OS=Homo sapiens OX=9606 GN=CTSZ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q9UKV5|AMFR_HUMAN	E3 ubiquitin-protein ligase AMFR OS=Homo sapiens OX=9606 GN=AMFR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	516-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q9NP92|RT30_HUMAN	39S ribosomal protein S30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS30 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P11274-2|BCR_HUMAN	Isoform 2 of Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	122-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|O75410-7|TACC1_HUMAN	Isoform 7 of Transforming acidic coiled-coil-containing protein 1 OS=Homo sapiens OX=9606 GN=TACC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	86-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q9HCH5-15|SYTL2_HUMAN	Isoform 12 of Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	393-UNIMOD:21,50-UNIMOD:21,174-UNIMOD:21	0.08	27.0	3	3	3
PRT	sp|Q9NRX5|SERC1_HUMAN	Serine incorporator 1 OS=Homo sapiens OX=9606 GN=SERINC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	364-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|P06731-2|CEAM5_HUMAN	Isoform 2 of Carcinoembryonic antigen-related cell adhesion molecule 5 OS=Homo sapiens OX=9606 GN=CEACAM5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q6NZY4-2|ZCHC8_HUMAN	Isoform 2 of Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	360-UNIMOD:21,369-UNIMOD:4,359-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|P23246-2|SFPQ_HUMAN	Isoform Short of Splicing factor, proline- and glutamine-rich OS=Homo sapiens OX=9606 GN=SFPQ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	273-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P23508|CRCM_HUMAN	Colorectal mutant cancer protein OS=Homo sapiens OX=9606 GN=MCC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	120-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	233-UNIMOD:21,246-UNIMOD:21	0.03	27.0	3	1	0
PRT	sp|Q8TF65|GIPC2_HUMAN	PDZ domain-containing protein GIPC2 OS=Homo sapiens OX=9606 GN=GIPC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	13-UNIMOD:21	0.08	27.0	1	1	1
PRT	sp|Q9BX66-12|SRBS1_HUMAN	Isoform 12 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	270-UNIMOD:21,272-UNIMOD:35,268-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q8NF91-4|SYNE1_HUMAN	Isoform 4 of Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	8312-UNIMOD:21,8234-UNIMOD:21,8314-UNIMOD:21	0.00	27.0	3	2	1
PRT	sp|Q96N96-6|SPT13_HUMAN	Isoform 6 of Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	602-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q53SF7-4|COBL1_HUMAN	Isoform 4 of Cordon-bleu protein-like 1 OS=Homo sapiens OX=9606 GN=COBLL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	324-UNIMOD:21,325-UNIMOD:35,335-UNIMOD:4,273-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|Q9H3R5|CENPH_HUMAN	Centromere protein H OS=Homo sapiens OX=9606 GN=CENPH PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	60-UNIMOD:35,68-UNIMOD:21,73-UNIMOD:35	0.08	27.0	1	1	1
PRT	sp|Q9ULU4-4|PKCB1_HUMAN	Isoform 4 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	58-UNIMOD:35,68-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9P266|JCAD_HUMAN	Junctional protein associated with coronary artery disease OS=Homo sapiens OX=9606 GN=JCAD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	983-UNIMOD:21,982-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q92619|HMHA1_HUMAN	Rho GTPase-activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	592-UNIMOD:21,599-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|O15075-3|DCLK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase DCLK1 OS=Homo sapiens OX=9606 GN=DCLK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	39-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q15652-2|JHD2C_HUMAN	Isoform 2 of Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	482-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	889-UNIMOD:21,971-UNIMOD:21,1176-UNIMOD:21	0.06	27.0	3	3	3
PRT	sp|Q9H792|PEAK1_HUMAN	Inactive tyrosine-protein kinase PEAK1 OS=Homo sapiens OX=9606 GN=PEAK1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	902-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q15047-3|SETB1_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase SETDB1 OS=Homo sapiens OX=9606 GN=SETDB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1182-UNIMOD:35,1184-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q96QF0-8|RAB3I_HUMAN	Isoform 8 of Rab-3A-interacting protein OS=Homo sapiens OX=9606 GN=RAB3IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	69-UNIMOD:21,71-UNIMOD:35,66-UNIMOD:21	0.09	27.0	2	1	0
PRT	sp|Q7Z6B7-2|SRGP1_HUMAN	Isoform 2 of SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	413-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P78310-7|CXAR_HUMAN	Isoform 7 of Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	252-UNIMOD:21,264-UNIMOD:35,269-UNIMOD:35,256-UNIMOD:21	0.07	27.0	2	1	0
PRT	sp|P51003|PAPOA_HUMAN	Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	672-UNIMOD:21,677-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q13796|SHRM2_HUMAN	Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	845-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P23284|PPIB_HUMAN	Peptidyl-prolyl cis-trans isomerase B OS=Homo sapiens OX=9606 GN=PPIB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=HIST1H4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	85-UNIMOD:35	0.23	27.0	2	2	2
PRT	sp|Q8IZP2|ST134_HUMAN	Putative protein FAM10A4 OS=Homo sapiens OX=9606 GN=ST13P4 PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q1MSJ5-2|CSPP1_HUMAN	Isoform 2 of Centrosome and spindle pole-associated protein 1 OS=Homo sapiens OX=9606 GN=CSPP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	130-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	984-UNIMOD:21	0.02	27.0	2	2	2
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	76-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|P02042|HBD_HUMAN	Hemoglobin subunit delta OS=Homo sapiens OX=9606 GN=HBD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null		0.10	27.0	2	1	0
PRT	sp|Q9HAU4|SMUF2_HUMAN	E3 ubiquitin-protein ligase SMURF2 OS=Homo sapiens OX=9606 GN=SMURF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	44-UNIMOD:21,47-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q9UHG3-2|PCYOX_HUMAN	Isoform 2 of Prenylcysteine oxidase 1 OS=Homo sapiens OX=9606 GN=PCYOX1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	94-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P00738-2|HPT_HUMAN	Isoform 2 of Haptoglobin OS=Homo sapiens OX=9606 GN=HP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	241-UNIMOD:35,250-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	452-UNIMOD:28,471-UNIMOD:21,702-UNIMOD:21,809-UNIMOD:21	0.04	27.0	4	4	4
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	13-UNIMOD:21,26-UNIMOD:35,96-UNIMOD:21	0.08	27.0	2	2	2
PRT	sp|Q06330|SUH_HUMAN	Recombining binding protein suppressor of hairless OS=Homo sapiens OX=9606 GN=RBPJ PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	270-UNIMOD:28	0.03	27.0	1	1	1
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q9NW68|BSDC1_HUMAN	BSD domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BSDC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	387-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q2UY09|COSA1_HUMAN	Collagen alpha-1(XXVIII) chain OS=Homo sapiens OX=9606 GN=COL28A1 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q6UN15|FIP1_HUMAN	Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	492-UNIMOD:21	0.03	27.0	1	1	0
PRT	sp|P18462|1A25_HUMAN	HLA class I histocompatibility antigen, A-25 alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	356-UNIMOD:21,358-UNIMOD:35,359-UNIMOD:21,363-UNIMOD:4	0.07	27.0	1	1	0
PRT	sp|Q9Y2Q3|GSTK1_HUMAN	Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	147-UNIMOD:35	0.07	27.0	1	1	0
PRT	sp|P30443|1A01_HUMAN	HLA class I histocompatibility antigen, A-1 alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	345-UNIMOD:21,363-UNIMOD:4	0.07	27.0	1	1	1
PRT	sp|P23497|SP100_HUMAN	Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	37-UNIMOD:35	0.01	27.0	1	1	1
PRT	sp|P80303-2|NUCB2_HUMAN	Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	169-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	531-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	26.0	null	257-UNIMOD:21	0.02	26.0	5	1	0
PRT	sp|P06396-2|GELS_HUMAN	Isoform 2 of Gelsolin OS=Homo sapiens OX=9606 GN=GSN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	2	2
PRT	sp|O60749-2|SNX2_HUMAN	Isoform 2 of Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|C9J069|AJM1_HUMAN	Apical junction component 1 homolog OS=Homo sapiens OX=9606 GN=AJM1 PE=3 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	109-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q5M775-2|CYTSB_HUMAN	Isoform 2 of Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	54-UNIMOD:21,55-UNIMOD:21,131-UNIMOD:21	0.05	26.0	3	2	1
PRT	sp|Q6GTX8-3|LAIR1_HUMAN	Isoform 3 of Leukocyte-associated immunoglobulin-like receptor 1 OS=Homo sapiens OX=9606 GN=LAIR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	250-UNIMOD:21,257-UNIMOD:35	0.08	26.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	449-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P98160|PGBM_HUMAN	Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	344-UNIMOD:4,350-UNIMOD:4	0.00	26.0	1	1	1
PRT	sp|P21980|TGM2_HUMAN	Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	10-UNIMOD:4	0.03	26.0	2	2	2
PRT	sp|Q9NRL3|STRN4_HUMAN	Striatin-4 OS=Homo sapiens OX=9606 GN=STRN4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	337-UNIMOD:4,342-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9H6S3-2|ES8L2_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|A1L390-2|PKHG3_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	495-UNIMOD:21,500-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q96JC9-2|EAF1_HUMAN	Isoform 2 of ELL-associated factor 1 OS=Homo sapiens OX=9606 GN=EAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	64-UNIMOD:21	0.09	26.0	1	1	1
PRT	sp|Q5T5P2-3|SKT_HUMAN	Isoform 3 of Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P02787|TRFE_HUMAN	Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	582-UNIMOD:4,58-UNIMOD:4	0.04	26.0	2	2	2
PRT	sp|Q8IY67|RAVR1_HUMAN	Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	463-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1243-UNIMOD:21,1255-UNIMOD:35,1257-UNIMOD:21	0.03	26.0	2	2	2
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	765-UNIMOD:35,766-UNIMOD:35	0.05	26.0	6	3	2
PRT	sp|Q9BXI6|TB10A_HUMAN	TBC1 domain family member 10A OS=Homo sapiens OX=9606 GN=TBC1D10A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	143-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	289-UNIMOD:35	0.03	26.0	2	1	0
PRT	sp|P15374|UCHL3_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L3 OS=Homo sapiens OX=9606 GN=UCHL3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	129-UNIMOD:35	0.06	26.0	1	1	1
PRT	sp|Q5JPE7-3|NOMO2_HUMAN	Isoform 3 of Nodal modulator 2 OS=Homo sapiens OX=9606 GN=NOMO2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9Y6R7|FCGBP_HUMAN	IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	5151-UNIMOD:4,5155-UNIMOD:4,5157-UNIMOD:4,1905-UNIMOD:4,1910-UNIMOD:4,1911-UNIMOD:35	0.01	26.0	4	4	4
PRT	sp|P02751-4|FINC_HUMAN	Isoform 4 of Fibronectin OS=Homo sapiens OX=9606 GN=FN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	60-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1318-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|Q4FZB7|KMT5B_HUMAN	Histone-lysine N-methyltransferase KMT5B OS=Homo sapiens OX=9606 GN=KMT5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	635-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q03188-2|CENPC_HUMAN	Isoform 2 of Centromere protein C OS=Homo sapiens OX=9606 GN=CENPC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	225-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P20338|RAB4A_HUMAN	Ras-related protein Rab-4A OS=Homo sapiens OX=9606 GN=RAB4A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|P15088|CBPA3_HUMAN	Mast cell carboxypeptidase A OS=Homo sapiens OX=9606 GN=CPA3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|O14981|BTAF1_HUMAN	TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	347-UNIMOD:21,354-UNIMOD:35,272-UNIMOD:21,392-UNIMOD:21,395-UNIMOD:35	0.09	26.0	4	3	2
PRT	sp|Q92925-3|SMRD2_HUMAN	Isoform 3 of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 2 OS=Homo sapiens OX=9606 GN=SMARCD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	151-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|Q04724|TLE1_HUMAN	Transducin-like enhancer protein 1 OS=Homo sapiens OX=9606 GN=TLE1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	286-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	106-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q7Z7B0-3|FLIP1_HUMAN	Isoform 3 of Filamin-A-interacting protein 1 OS=Homo sapiens OX=9606 GN=FILIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	371-UNIMOD:21,375-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q92870|APBB2_HUMAN	Amyloid-beta A4 precursor protein-binding family B member 2 OS=Homo sapiens OX=9606 GN=APBB2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	334-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P49796-2|RGS3_HUMAN	Isoform 2 of Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	14-UNIMOD:35,15-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	600-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q6P6C2-3|ALKB5_HUMAN	Isoform 3 of RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	360-UNIMOD:21,367-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	804-UNIMOD:4,807-UNIMOD:4	0.02	26.0	3	2	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	376-UNIMOD:21,378-UNIMOD:4,1725-UNIMOD:35	0.01	26.0	2	2	2
PRT	sp|P09493-8|TPM1_HUMAN	Isoform 8 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	252-UNIMOD:21	0.16	26.0	6	4	2
PRT	sp|Q99828|CIB1_HUMAN	Calcium and integrin-binding protein 1 OS=Homo sapiens OX=9606 GN=CIB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	134-UNIMOD:4	0.07	26.0	1	1	1
PRT	sp|Q9UL25|RAB21_HUMAN	Ras-related protein Rab-21 OS=Homo sapiens OX=9606 GN=RAB21 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	180-UNIMOD:35	0.05	26.0	1	1	1
PRT	sp|Q14651|PLSI_HUMAN	Plastin-1 OS=Homo sapiens OX=9606 GN=PLS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	168-UNIMOD:35	0.04	26.0	2	2	2
PRT	sp|Q99543-2|DNJC2_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 2 OS=Homo sapiens OX=9606 GN=DNAJC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	47-UNIMOD:21,49-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	202-UNIMOD:35	0.04	26.0	3	2	1
PRT	sp|Q9BQI5-4|SGIP1_HUMAN	Isoform 4 of SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	215-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P48735|IDHP_HUMAN	Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	53-UNIMOD:35,58-UNIMOD:35,293-UNIMOD:35	0.06	26.0	3	2	1
PRT	sp|O75167-5|PHAR2_HUMAN	Isoform 5 of Phosphatase and actin regulator 2 OS=Homo sapiens OX=9606 GN=PHACTR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	200-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q8NBJ4-2|GOLM1_HUMAN	Isoform 2 of Golgi membrane protein 1 OS=Homo sapiens OX=9606 GN=GOLM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	245-UNIMOD:21	0.08	26.0	2	2	2
PRT	sp|Q9H8G2|CAAP1_HUMAN	Caspase activity and apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CAAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	89-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q9UQQ2|SH2B3_HUMAN	SH2B adapter protein 3 OS=Homo sapiens OX=9606 GN=SH2B3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	150-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q08289-6|CACB2_HUMAN	Isoform 2f of Voltage-dependent L-type calcium channel subunit beta-2 OS=Homo sapiens OX=9606 GN=CACNB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	419-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	119-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q8WVM8-2|SCFD1_HUMAN	Isoform 2 of Sec1 family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SCFD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	282-UNIMOD:21,284-UNIMOD:21,285-UNIMOD:21	0.04	26.0	3	1	0
PRT	sp|Q5VUB5|F1711_HUMAN	Protein FAM171A1 OS=Homo sapiens OX=9606 GN=FAM171A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	849-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q13428-6|TCOF_HUMAN	Isoform 6 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	381-UNIMOD:21,233-UNIMOD:21,1340-UNIMOD:21	0.04	26.0	3	3	2
PRT	sp|Q99700-2|ATX2_HUMAN	Isoform 2 of Ataxin-2 OS=Homo sapiens OX=9606 GN=ATXN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	466-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	303-UNIMOD:21,307-UNIMOD:21	0.03	26.0	1	1	0
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	285-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q9P2D3|HTR5B_HUMAN	HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1737-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q8WY36-2|BBX_HUMAN	Isoform 2 of HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	814-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P01871|IGHM_HUMAN	Immunoglobulin heavy constant mu OS=Homo sapiens OX=9606 GN=IGHM PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P54920|SNAA_HUMAN	Alpha-soluble NSF attachment protein OS=Homo sapiens OX=9606 GN=NAPA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P51648|AL3A2_HUMAN	Fatty aldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH3A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=HIST1H1E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1	0.08	26.0	1	1	1
PRT	sp|Q86V48|LUZP1_HUMAN	Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	659-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q96I99|SUCB2_HUMAN	Succinate--CoA ligase [GDP-forming] subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	345-UNIMOD:28,346-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|Q9BS40|LXN_HUMAN	Latexin OS=Homo sapiens OX=9606 GN=LXN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q15392|DHC24_HUMAN	Delta(24)-sterol reductase OS=Homo sapiens OX=9606 GN=DHCR24 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	499-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|P0C851|PIRT_HUMAN	Phosphoinositide-interacting protein OS=Homo sapiens OX=9606 GN=PIRT PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	16-UNIMOD:21	0.09	26.0	2	1	0
PRT	sp|Q9Y653|AGRG1_HUMAN	Adhesion G-protein coupled receptor G1 OS=Homo sapiens OX=9606 GN=ADGRG1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	678-UNIMOD:21	0.03	26.0	1	1	0
PRT	sp|Q92793|CBP_HUMAN	CREB-binding protein OS=Homo sapiens OX=9606 GN=CREBBP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	1076-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q03135-2|CAV1_HUMAN	Isoform 2 of Caveolin-1 OS=Homo sapiens OX=9606 GN=CAV1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	2-UNIMOD:1,6-UNIMOD:21	0.11	26.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|Q9H334|FOXP1_HUMAN	Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	610-UNIMOD:35,621-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q9HA77|SYCM_HUMAN	Probable cysteine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=CARS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q96L73-2|NSD1_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens OX=9606 GN=NSD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	2202-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	176-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	271-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P40926|MDHM_HUMAN	Malate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=MDH2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	251-UNIMOD:35,315-UNIMOD:35	0.08	25.0	2	2	2
PRT	sp|Q9UBW5-2|BIN2_HUMAN	Isoform 2 of Bridging integrator 2 OS=Homo sapiens OX=9606 GN=BIN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	332-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	211-UNIMOD:35	0.04	25.0	3	2	1
PRT	sp|P25054-2|APC_HUMAN	Isoform 2 of Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1259-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	240-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q6WN34|CRDL2_HUMAN	Chordin-like protein 2 OS=Homo sapiens OX=9606 GN=CHRDL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	179-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	65-UNIMOD:35,70-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q9NW75-2|GPTC2_HUMAN	Isoform 2 of G patch domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GPATCH2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	115-UNIMOD:21,121-UNIMOD:35	0.04	25.0	1	1	1
PRT	sp|Q14766-3|LTBP1_HUMAN	Isoform 3 of Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1198-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q6U841-4|S4A10_HUMAN	Isoform 4 of Sodium-driven chloride bicarbonate exchanger OS=Homo sapiens OX=9606 GN=SLC4A10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	89-UNIMOD:21	0.05	25.0	3	1	0
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	245-UNIMOD:21,310-UNIMOD:35,313-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|O75131|CPNE3_HUMAN	Copine-3 OS=Homo sapiens OX=9606 GN=CPNE3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	243-UNIMOD:21,249-UNIMOD:4,202-UNIMOD:4,206-UNIMOD:35	0.06	25.0	2	2	2
PRT	sp|P41214|EIF2D_HUMAN	Eukaryotic translation initiation factor 2D OS=Homo sapiens OX=9606 GN=EIF2D PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	237-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q5JSL3|DOC11_HUMAN	Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1237-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	294-UNIMOD:21,290-UNIMOD:21	0.05	25.0	3	2	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	156-UNIMOD:35,161-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	406-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q3KR16-3|PKHG6_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens OX=9606 GN=PLEKHG6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	67-UNIMOD:21,73-UNIMOD:21	0.07	25.0	2	1	0
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	100-UNIMOD:21	0.07	25.0	2	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9NVR5-2|KTU_HUMAN	Isoform 2 of Protein kintoun OS=Homo sapiens OX=9606 GN=DNAAF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	653-UNIMOD:4,655-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9HD67-3|MYO10_HUMAN	Isoform Headless of Unconventional myosin-X OS=Homo sapiens OX=9606 GN=MYO10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O94885|SASH1_HUMAN	SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	614-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P24844|MYL9_HUMAN	Myosin regulatory light polypeptide 9 OS=Homo sapiens OX=9606 GN=MYL9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	142-UNIMOD:35	0.07	25.0	2	1	0
PRT	sp|Q5JRA6-2|TGO1_HUMAN	Isoform 2 of Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	61-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|P61073|CXCR4_HUMAN	C-X-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CXCR4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	339-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|O00339-4|MATN2_HUMAN	Isoform 4 of Matrilin-2 OS=Homo sapiens OX=9606 GN=MATN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	551-UNIMOD:4	0.02	25.0	2	1	0
PRT	sp|Q14195|DPYL3_HUMAN	Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	83-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q6UX71-3|PXDC2_HUMAN	Isoform 3 of Plexin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PLXDC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	128-UNIMOD:21	0.11	25.0	1	1	0
PRT	sp|P16219|ACADS_HUMAN	Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	246-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|P13051|UNG_HUMAN	Uracil-DNA glycosylase OS=Homo sapiens OX=9606 GN=UNG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	23-UNIMOD:21	0.10	25.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	769-UNIMOD:4,771-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	42-UNIMOD:35	0.05	25.0	3	2	1
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	242-UNIMOD:21,1101-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|P24666-3|PPAC_HUMAN	Isoform 3 of Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens OX=9606 GN=ACP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	136-UNIMOD:35	0.03	25.0	2	1	0
PRT	sp|P11678|PERE_HUMAN	Eosinophil peroxidase OS=Homo sapiens OX=9606 GN=EPX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	676-UNIMOD:4,535-UNIMOD:35	0.03	25.0	2	2	2
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|O94919|ENDD1_HUMAN	Endonuclease domain-containing 1 protein OS=Homo sapiens OX=9606 GN=ENDOD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	197-UNIMOD:35	0.05	25.0	2	2	2
PRT	sp|P19634|SL9A1_HUMAN	Sodium/hydrogen exchanger 1 OS=Homo sapiens OX=9606 GN=SLC9A1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	599-UNIMOD:21,602-UNIMOD:21,606-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|P29474|NOS3_HUMAN	Nitric oxide synthase, endothelial OS=Homo sapiens OX=9606 GN=NOS3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1175-UNIMOD:21,1177-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1232-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPT7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	2	2	2
PRT	sp|O94808|GFPT2_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	244-UNIMOD:21,247-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9HA47-2|UCK1_HUMAN	Isoform 2 of Uridine-cytidine kinase 1 OS=Homo sapiens OX=9606 GN=UCK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q02218|ODO1_HUMAN	2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	1	0
PRT	sp|Q13574-6|DGKZ_HUMAN	Isoform 6 of Diacylglycerol kinase zeta OS=Homo sapiens OX=9606 GN=DGKZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	683-UNIMOD:21,686-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	490-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|Q92608|DOCK2_HUMAN	Dedicator of cytokinesis protein 2 OS=Homo sapiens OX=9606 GN=DOCK2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1784-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8NFA0|UBP32_HUMAN	Ubiquitin carboxyl-terminal hydrolase 32 OS=Homo sapiens OX=9606 GN=USP32 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1422-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1284-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q71UM5|RS27L_HUMAN	40S ribosomal protein S27-like OS=Homo sapiens OX=9606 GN=RPS27L PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	33-UNIMOD:35	0.17	25.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	522-UNIMOD:35,538-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	185-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P42167-2|LAP2B_HUMAN	Isoform Gamma of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P18615-4|NELFE_HUMAN	Isoform 3 of Negative elongation factor E OS=Homo sapiens OX=9606 GN=NELFE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	51-UNIMOD:21,56-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|Q8TEP8|CE192_HUMAN	Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	190-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P17302|CXA1_HUMAN	Gap junction alpha-1 protein OS=Homo sapiens OX=9606 GN=GJA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	255-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P98198|AT8B2_HUMAN	Phospholipid-transporting ATPase ID OS=Homo sapiens OX=9606 GN=ATP8B2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1193-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P13073|COX41_HUMAN	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	39-UNIMOD:35	0.08	25.0	1	1	1
PRT	sp|Q9NYF0-2|DACT1_HUMAN	Isoform 2 of Dapper homolog 1 OS=Homo sapiens OX=9606 GN=DACT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	511-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|O75122-2|CLAP2_HUMAN	Isoform 2 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	27-UNIMOD:21,28-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q9Y4L1-2|HYOU1_HUMAN	Isoform 2 of Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O75911|DHRS3_HUMAN	Short-chain dehydrogenase/reductase 3 OS=Homo sapiens OX=9606 GN=DHRS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	133-UNIMOD:35	0.04	25.0	2	1	0
PRT	sp|P09493-5|TPM1_HUMAN	Isoform 5 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q8TBZ3-4|WDR20_HUMAN	Isoform 4 of WD repeat-containing protein 20 OS=Homo sapiens OX=9606 GN=WDR20	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	362-UNIMOD:21	0.03	25.0	1	1	0
PRT	sp|Q9UN36-4|NDRG2_HUMAN	Isoform 4 of Protein NDRG2 OS=Homo sapiens OX=9606 GN=NDRG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	287-UNIMOD:21,289-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q9UPN6|SCAF8_HUMAN	Protein SCAF8 OS=Homo sapiens OX=9606 GN=SCAF8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	617-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|A6ND36|FA83G_HUMAN	Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	21-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q14011|CIRBP_HUMAN	Cold-inducible RNA-binding protein OS=Homo sapiens OX=9606 GN=CIRBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	163-UNIMOD:21	0.11	25.0	2	1	0
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	585-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	601-UNIMOD:21,603-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|Q9UHX3-5|AGRE2_HUMAN	Isoform 5 of Adhesion G protein-coupled receptor E2 OS=Homo sapiens OX=9606 GN=ADGRE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	663-UNIMOD:35,669-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P11172-3|UMPS_HUMAN	Isoform 3 of Uridine 5'-monophosphate synthase OS=Homo sapiens OX=9606 GN=UMPS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9NZN4-2|EHD2_HUMAN	Isoform 2 of EH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=EHD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	332-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q9UBK2-9|PRGC1_HUMAN	Isoform 9 of Peroxisome proliferator-activated receptor gamma coactivator 1-alpha OS=Homo sapiens OX=9606 GN=PPARGC1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	509-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	1179-UNIMOD:35,1182-UNIMOD:21,1189-UNIMOD:35	0.02	25.0	1	1	0
PRT	sp|Q13228|SBP1_HUMAN	Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	0
PRT	sp|Q15459|SF3A1_HUMAN	Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	325-UNIMOD:35,329-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P61923|COPZ1_HUMAN	Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.07	25.0	1	1	0
PRT	sp|Q92878|RAD50_HUMAN	DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	0
PRT	sp|Q08170|SRSF4_HUMAN	Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	0
PRT	sp|Q53GD3|CTL4_HUMAN	Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	5-UNIMOD:28	0.02	25.0	1	1	1
PRT	sp|Q8TBZ3|WDR20_HUMAN	WD repeat-containing protein 20 OS=Homo sapiens OX=9606 GN=WDR20 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	434-UNIMOD:21	0.03	25.0	1	1	0
PRT	sp|P07741|APT_HUMAN	Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	0
PRT	sp|P41229|KDM5C_HUMAN	Lysine-specific demethylase 5C OS=Homo sapiens OX=9606 GN=KDM5C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	301-UNIMOD:21,305-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q86US8|EST1A_HUMAN	Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O75874|IDHC_HUMAN	Isocitrate dehydrogenase [NADP] cytoplasmic OS=Homo sapiens OX=9606 GN=IDH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	313-UNIMOD:21,398-UNIMOD:35	0.07	25.0	2	2	2
PRT	sp|P07197|NFM_HUMAN	Neurofilament medium polypeptide OS=Homo sapiens OX=9606 GN=NEFM PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	837-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q9HDC5|JPH1_HUMAN	Junctophilin-1 OS=Homo sapiens OX=9606 GN=JPH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	185-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q9BTA9|WAC_HUMAN	WW domain-containing adapter protein with coiled-coil OS=Homo sapiens OX=9606 GN=WAC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	532-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q7Z4V5|HDGR2_HUMAN	Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	240-UNIMOD:21,250-UNIMOD:35,631-UNIMOD:385,631-UNIMOD:4,633-UNIMOD:21,608-UNIMOD:21	0.08	24.0	4	3	2
PRT	sp|Q9Y6R0|NUMBL_HUMAN	Numb-like protein OS=Homo sapiens OX=9606 GN=NUMBL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	269-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	198-UNIMOD:35	0.04	24.0	2	1	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.00	24.0	1	1	1
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9UK41|VPS28_HUMAN	Vacuolar protein sorting-associated protein 28 homolog OS=Homo sapiens OX=9606 GN=VPS28 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	150-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	532-UNIMOD:21	0.01	24.0	3	1	0
PRT	sp|Q53GG5-3|PDLI3_HUMAN	Isoform 3 of PDZ and LIM domain protein 3 OS=Homo sapiens OX=9606 GN=PDLIM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P01008|ANT3_HUMAN	Antithrombin-III OS=Homo sapiens OX=9606 GN=SERPINC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	63-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q96JP2|MY15B_HUMAN	Unconventional myosin-XVB OS=Homo sapiens OX=9606 GN=MYO15B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1025-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O75909-1|CCNK_HUMAN	Isoform 3 of Cyclin-K OS=Homo sapiens OX=9606 GN=CCNK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	340-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q9UBF2-2|COPG2_HUMAN	Isoform 2 of Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	516-UNIMOD:4,517-UNIMOD:35,518-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	272-UNIMOD:21,352-UNIMOD:21,1053-UNIMOD:21,1059-UNIMOD:4	0.04	24.0	3	3	3
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8IVF2-3|AHNK2_HUMAN	Isoform 3 of Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	194-UNIMOD:21	0.00	24.0	1	1	1
PRT	sp|P13591-1|NCAM1_HUMAN	Isoform 2 of Neural cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=NCAM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	774-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q96HH9-4|GRM2B_HUMAN	Isoform 4 of GRAM domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GRAMD2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	275-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q9UER7-3|DAXX_HUMAN	Isoform 3 of Death domain-associated protein 6 OS=Homo sapiens OX=9606 GN=DAXX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	420-UNIMOD:21,422-UNIMOD:35	0.03	24.0	2	1	0
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O15394|NCAM2_HUMAN	Neural cell adhesion molecule 2 OS=Homo sapiens OX=9606 GN=NCAM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	765-UNIMOD:21,772-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	418-UNIMOD:21	0.03	24.0	1	1	0
PRT	sp|Q15746-9|MYLK_HUMAN	Isoform 7 of Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	573-UNIMOD:21,578-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q5T0Z8|CF132_HUMAN	Uncharacterized protein C6orf132 OS=Homo sapiens OX=9606 GN=C6orf132 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	727-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	182-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P43304-2|GPDM_HUMAN	Isoform 2 of Glycerol-3-phosphate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=GPD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P52564|MP2K6_HUMAN	Dual specificity mitogen-activated protein kinase kinase 6 OS=Homo sapiens OX=9606 GN=MAP2K6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	27-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	174-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|Q96DE0-3|NUD16_HUMAN	Isoform 3 of U8 snoRNA-decapping enzyme OS=Homo sapiens OX=9606 GN=NUDT16	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q7Z3E5|ARMC9_HUMAN	LisH domain-containing protein ARMC9 OS=Homo sapiens OX=9606 GN=ARMC9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	701-UNIMOD:21,706-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q15067-3|ACOX1_HUMAN	Isoform 3 of Peroxisomal acyl-coenzyme A oxidase 1 OS=Homo sapiens OX=9606 GN=ACOX1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9Y2R0|COA3_HUMAN	Cytochrome c oxidase assembly factor 3 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	88-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q9NXV6|CARF_HUMAN	CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	131-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	438-UNIMOD:35	0.03	24.0	4	2	1
PRT	sp|Q6IWH7-2|ANO7_HUMAN	Isoform 2 of Anoctamin-7 OS=Homo sapiens OX=9606 GN=ANO7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	81-UNIMOD:21,99-UNIMOD:4	0.12	24.0	1	1	1
PRT	sp|P63267|ACTH_HUMAN	Actin, gamma-enteric smooth muscle OS=Homo sapiens OX=9606 GN=ACTG2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	437-UNIMOD:21,439-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P15927|RFA2_HUMAN	Replication protein A 32 kDa subunit OS=Homo sapiens OX=9606 GN=RPA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	97-UNIMOD:35,102-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|P07741-2|APT_HUMAN	Isoform 2 of Adenine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=APRT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	0
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	137-UNIMOD:35,6-UNIMOD:21	0.09	24.0	3	2	1
PRT	sp|Q9NWZ5-4|UCKL1_HUMAN	Isoform 4 of Uridine-cytidine kinase-like 1 OS=Homo sapiens OX=9606 GN=UCKL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O95967|FBLN4_HUMAN	EGF-containing fibulin-like extracellular matrix protein 2 OS=Homo sapiens OX=9606 GN=EFEMP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	162-UNIMOD:4,168-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|P04406-2|G3P_HUMAN	Isoform 2 of Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	110-UNIMOD:4,114-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|O60524-2|NEMF_HUMAN	Isoform 2 of Nuclear export mediator factor NEMF OS=Homo sapiens OX=9606 GN=NEMF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	31-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q14738-3|2A5D_HUMAN	Isoform Delta-3 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	467-UNIMOD:21	0.03	24.0	1	1	0
PRT	sp|Q8N8E3|CE112_HUMAN	Centrosomal protein of 112 kDa OS=Homo sapiens OX=9606 GN=CEP112 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	195-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P22694-10|KAPCB_HUMAN	Isoform 10 of cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens OX=9606 GN=PRKACB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	7-UNIMOD:21,12-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q5T0W9|FA83B_HUMAN	Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	801-UNIMOD:4,803-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|O14727-6|APAF_HUMAN	Isoform 6 of Apoptotic protease-activating factor 1 OS=Homo sapiens OX=9606 GN=APAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P14406|CX7A2_HUMAN	Cytochrome c oxidase subunit 7A2, mitochondrial OS=Homo sapiens OX=9606 GN=COX7A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.17	24.0	1	1	1
PRT	sp|P46939|UTRO_HUMAN	Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	10-UNIMOD:21	0.01	24.0	2	2	2
PRT	sp|Q15046|SYK_HUMAN	Lysine--tRNA ligase OS=Homo sapiens OX=9606 GN=KARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q12778|FOXO1_HUMAN	Forkhead box protein O1 OS=Homo sapiens OX=9606 GN=FOXO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	329-UNIMOD:21,332-UNIMOD:35,346-UNIMOD:35	0.04	24.0	1	1	1
PRT	sp|P55786-2|PSA_HUMAN	Isoform 2 of Puromycin-sensitive aminopeptidase OS=Homo sapiens OX=9606 GN=NPEPPS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8N3E9|PLCD3_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	54-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q07812-6|BAX_HUMAN	Isoform Zeta of Apoptosis regulator BAX OS=Homo sapiens OX=9606 GN=BAX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1-UNIMOD:35	0.11	24.0	1	1	1
PRT	sp|P53814-2|SMTN_HUMAN	Isoform A of Smoothelin OS=Homo sapiens OX=9606 GN=SMTN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	139-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q96KP4-2|CNDP2_HUMAN	Isoform 2 of Cytosolic non-specific dipeptidase OS=Homo sapiens OX=9606 GN=CNDP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	44-UNIMOD:35,45-UNIMOD:35	0.03	24.0	2	1	0
PRT	sp|Q8ND24|RN214_HUMAN	RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	149-UNIMOD:4,150-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q7Z460-2|CLAP1_HUMAN	Isoform 2 of CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	246-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P37802|TAGL2_HUMAN	Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q9NVE5|UBP40_HUMAN	Ubiquitin carboxyl-terminal hydrolase 40 OS=Homo sapiens OX=9606 GN=USP40 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q96A73-2|P33MX_HUMAN	Isoform 2 of Putative monooxygenase p33MONOX OS=Homo sapiens OX=9606 GN=KIAA1191	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	164-UNIMOD:21	0.07	24.0	1	1	0
PRT	sp|P13807-2|GYS1_HUMAN	Isoform 2 of Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	646-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q8TEU7-5|RPGF6_HUMAN	Isoform 5 of Rap guanine nucleotide exchange factor 6 OS=Homo sapiens OX=9606 GN=RAPGEF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1270-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q92932-2|PTPR2_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	433-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P29475-3|NOS1_HUMAN	Isoform 3 of Nitric oxide synthase, brain OS=Homo sapiens OX=9606 GN=NOS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1081-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	447-UNIMOD:21	0.06	24.0	2	2	2
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	228-UNIMOD:21	0.04	24.0	3	2	1
PRT	sp|Q9P2M7-2|CING_HUMAN	Isoform 2 of Cingulin OS=Homo sapiens OX=9606 GN=CGN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	131-UNIMOD:21,134-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9P0K7-4|RAI14_HUMAN	Isoform 4 of Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	638-UNIMOD:21	0.01	24.0	1	1	0
PRT	sp|Q5TZA2-2|CROCC_HUMAN	Isoform 2 of Rootletin OS=Homo sapiens OX=9606 GN=CROCC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	922-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q13129|RLF_HUMAN	Zinc finger protein Rlf OS=Homo sapiens OX=9606 GN=RLF PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	632-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O60291-4|MGRN1_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens OX=9606 GN=MGRN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	437-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q96JQ2|CLMN_HUMAN	Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	927-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|Q96IF1|AJUBA_HUMAN	LIM domain-containing protein ajuba OS=Homo sapiens OX=9606 GN=AJUBA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	136-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	303-UNIMOD:35,310-UNIMOD:21,296-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	164-UNIMOD:21,155-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|P26373|RL13_HUMAN	60S ribosomal protein L13 OS=Homo sapiens OX=9606 GN=RPL13 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q9NVR2|INT10_HUMAN	Integrator complex subunit 10 OS=Homo sapiens OX=9606 GN=INTS10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	230-UNIMOD:35,233-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	2	2	2
PRT	sp|P0DOY3|IGLC3_HUMAN	Immunoglobulin lambda constant 3 OS=Homo sapiens OX=9606 GN=IGLC3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	86-UNIMOD:21,87-UNIMOD:4	0.15	24.0	1	1	1
PRT	sp|Q9NWS9-2|ZN446_HUMAN	Isoform 2 of Zinc finger protein 446 OS=Homo sapiens OX=9606 GN=ZNF446	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	137-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P62495-2|ERF1_HUMAN	Isoform 2 of Eukaryotic peptide chain release factor subunit 1 OS=Homo sapiens OX=9606 GN=ETF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	208-UNIMOD:35	0.03	24.0	2	1	0
PRT	sp|Q9HCH5-12|SYTL2_HUMAN	Isoform 9 of Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	401-UNIMOD:21,413-UNIMOD:35,194-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	311-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	22-UNIMOD:21	0.03	24.0	2	2	1
PRT	sp|Q96R05|RET7_HUMAN	Retinoid-binding protein 7 OS=Homo sapiens OX=9606 GN=RBP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.08	24.0	1	1	1
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	261-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|O60701-3|UGDH_HUMAN	Isoform 3 of UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P00918|CAH2_HUMAN	Carbonic anhydrase 2 OS=Homo sapiens OX=9606 GN=CA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q92522|H1X_HUMAN	Histone H1x OS=Homo sapiens OX=9606 GN=H1FX PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|O60547-2|GMDS_HUMAN	Isoform 2 of GDP-mannose 4,6 dehydratase OS=Homo sapiens OX=9606 GN=GMDS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	293-UNIMOD:21,306-UNIMOD:4	0.09	24.0	2	2	2
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	184-UNIMOD:21,186-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	407-UNIMOD:21	0.05	24.0	2	2	0
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	622-UNIMOD:35,782-UNIMOD:28,789-UNIMOD:21	0.03	24.0	3	2	1
PRT	sp|Q08J23|NSUN2_HUMAN	tRNA (cytosine(34)-C(5))-methyltransferase OS=Homo sapiens OX=9606 GN=NSUN2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	456-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|O14745|NHRF1_HUMAN	Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	269-UNIMOD:21	0.05	24.0	1	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	381-UNIMOD:21	0.01	24.0	1	1	0
PRT	sp|Q14112|NID2_HUMAN	Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9ULV4|COR1C_HUMAN	Coronin-1C OS=Homo sapiens OX=9606 GN=CORO1C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	23-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|Q9HAB8|PPCS_HUMAN	Phosphopantothenate--cysteine ligase OS=Homo sapiens OX=9606 GN=PPCS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	2	1	0
PRT	sp|P18583|SON_HUMAN	Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1545-UNIMOD:35,1551-UNIMOD:4,1556-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q16555|DPYL2_HUMAN	Dihydropyrimidinase-related protein 2 OS=Homo sapiens OX=9606 GN=DPYSL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P52209|6PGD_HUMAN	6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|A0MZ66|SHOT1_HUMAN	Shootin-1 OS=Homo sapiens OX=9606 GN=SHTN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	308-UNIMOD:28	0.02	24.0	1	1	1
PRT	sp|Q6UX71|PXDC2_HUMAN	Plexin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PLXDC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	506-UNIMOD:21	0.03	24.0	1	1	0
PRT	sp|Q9Y3C6|PPIL1_HUMAN	Peptidyl-prolyl cis-trans isomerase-like 1 OS=Homo sapiens OX=9606 GN=PPIL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	81-UNIMOD:28	0.07	24.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	305-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P67775|PP2AA_HUMAN	Serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP2CA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	83-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|Q9UJX4|APC5_HUMAN	Anaphase-promoting complex subunit 5 OS=Homo sapiens OX=9606 GN=ANAPC5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	357-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q12955|ANK3_HUMAN	Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1459-UNIMOD:21,1462-UNIMOD:21	0.00	24.0	1	1	1
PRT	sp|Q3B8N2|LEG9B_HUMAN	Galectin-9B OS=Homo sapiens OX=9606 GN=LGALS9B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	74-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|P15941|MUC1_HUMAN	Mucin-1 OS=Homo sapiens OX=9606 GN=MUC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1227-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q15042|RB3GP_HUMAN	Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	537-UNIMOD:21	0.02	24.0	1	1	0
PRT	sp|P28482|MK01_HUMAN	Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	333-UNIMOD:35	0.03	24.0	1	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	893-UNIMOD:21	0.01	24.0	1	1	0
PRT	sp|P78310|CXAR_HUMAN	Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	301-UNIMOD:21,305-UNIMOD:35,310-UNIMOD:35	0.07	24.0	1	1	0
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1042-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P12236|ADT3_HUMAN	ADP/ATP translocase 3 OS=Homo sapiens OX=9606 GN=SLC25A6 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9UK58-6|CCNL1_HUMAN	Isoform 4 of Cyclin-L1 OS=Homo sapiens OX=9606 GN=CCNL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	352-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q99653|CHP1_HUMAN	Calcineurin B homologous protein 1 OS=Homo sapiens OX=9606 GN=CHP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	6-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|Q5TH69|BIG3_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Homo sapiens OX=9606 GN=ARFGEF3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1049-UNIMOD:21,1058-UNIMOD:4,1066-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q9BUK0|CHCH7_HUMAN	Coiled-coil-helix-coiled-coil-helix domain-containing protein 7 OS=Homo sapiens OX=9606 GN=CHCHD7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	26-UNIMOD:4	0.12	23.0	1	1	1
PRT	sp|Q9UKK3|PARP4_HUMAN	Poly [ADP-ribose] polymerase 4 OS=Homo sapiens OX=9606 GN=PARP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P30041|PRDX6_HUMAN	Peroxiredoxin-6 OS=Homo sapiens OX=9606 GN=PRDX6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	47-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|O00409-2|FOXN3_HUMAN	Isoform 2 of Forkhead box protein N3 OS=Homo sapiens OX=9606 GN=FOXN3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	390-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1497-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	167-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q15056-2|IF4H_HUMAN	Isoform Short of Eukaryotic translation initiation factor 4H OS=Homo sapiens OX=9606 GN=EIF4H	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q9H5I5-3|PIEZ2_HUMAN	Isoform 3 of Piezo-type mechanosensitive ion channel component 2 OS=Homo sapiens OX=9606 GN=PIEZO2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	16-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q5F1R6|DJC21_HUMAN	DnaJ homolog subfamily C member 21 OS=Homo sapiens OX=9606 GN=DNAJC21 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	283-UNIMOD:21,288-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|O00767|ACOD_HUMAN	Acyl-CoA desaturase OS=Homo sapiens OX=9606 GN=SCD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	198-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q16630-3|CPSF6_HUMAN	Isoform 3 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	329-UNIMOD:35,331-UNIMOD:21,345-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	498-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O94988-6|FA13A_HUMAN	Isoform 5 of Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	243-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|O14745-2|NHRF1_HUMAN	Isoform 2 of Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	113-UNIMOD:21	0.16	23.0	2	2	1
PRT	sp|Q06323-3|PSME1_HUMAN	Isoform 3 of Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q8TEW0-8|PARD3_HUMAN	Isoform 8 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	959-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	486-UNIMOD:21,490-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P01042-3|KNG1_HUMAN	Isoform 3 of Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	292-UNIMOD:4,296-UNIMOD:21,304-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|Q71UI9-3|H2AV_HUMAN	Isoform 3 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AFV	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.12	23.0	1	1	1
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	134-UNIMOD:35	0.04	23.0	2	2	2
PRT	sp|O75368|SH3L1_HUMAN	SH3 domain-binding glutamic acid-rich-like protein OS=Homo sapiens OX=9606 GN=SH3BGRL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.10	23.0	1	1	1
PRT	sp|P32121-5|ARRB2_HUMAN	Isoform 5 of Beta-arrestin-2 OS=Homo sapiens OX=9606 GN=ARRB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	384-UNIMOD:35,394-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q53TN4-3|CYBR1_HUMAN	Isoform 3 of Cytochrome b reductase 1 OS=Homo sapiens OX=9606 GN=CYBRD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	191-UNIMOD:35,199-UNIMOD:35,202-UNIMOD:21	0.11	23.0	1	1	1
PRT	sp|Q92560|BAP1_HUMAN	Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Homo sapiens OX=9606 GN=BAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	583-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P62942|FKB1A_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP1A OS=Homo sapiens OX=9606 GN=FKBP1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.13	23.0	1	1	1
PRT	sp|Q92545|TM131_HUMAN	Transmembrane protein 131 OS=Homo sapiens OX=9606 GN=TMEM131 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1341-UNIMOD:21,1354-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|Q9BQE5|APOL2_HUMAN	Apolipoprotein L2 OS=Homo sapiens OX=9606 GN=APOL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9Y3B4|SF3B6_HUMAN	Splicing factor 3B subunit 6 OS=Homo sapiens OX=9606 GN=SF3B6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	35-UNIMOD:35	0.10	23.0	1	1	1
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	273-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1062-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q8NDI1-3|EHBP1_HUMAN	Isoform 3 of EH domain-binding protein 1 OS=Homo sapiens OX=9606 GN=EHBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	987-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	971-UNIMOD:21,979-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P12277|KCRB_HUMAN	Creatine kinase B-type OS=Homo sapiens OX=9606 GN=CKB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q96BN6-2|F149B_HUMAN	Isoform 2 of Protein FAM149B1 OS=Homo sapiens OX=9606 GN=FAM149B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	37-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P50452-3|SPB8_HUMAN	Isoform 3 of Serpin B8 OS=Homo sapiens OX=9606 GN=SERPINB8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|Q8NFW9-5|MYRIP_HUMAN	Isoform 5 of Rab effector MyRIP OS=Homo sapiens OX=9606 GN=MYRIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	534-UNIMOD:21,561-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|Q8TBP0-3|TBC16_HUMAN	Isoform 3 of TBC1 domain family member 16 OS=Homo sapiens OX=9606 GN=TBC1D16	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	21-UNIMOD:21,30-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O95834|EMAL2_HUMAN	Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P62166-2|NCS1_HUMAN	Isoform 2 of Neuronal calcium sensor 1 OS=Homo sapiens OX=9606 GN=NCS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|O00429-4|DNM1L_HUMAN	Isoform 3 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P49961-3|ENTP1_HUMAN	Isoform 3 of Ectonucleoside triphosphate diphosphohydrolase 1 OS=Homo sapiens OX=9606 GN=ENTPD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	146-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	471-UNIMOD:35,477-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P63220|RS21_HUMAN	40S ribosomal protein S21 OS=Homo sapiens OX=9606 GN=RPS21 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	62-UNIMOD:35	0.13	23.0	1	1	1
PRT	sp|Q9NUQ2|PLCE_HUMAN	1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon OS=Homo sapiens OX=9606 GN=AGPAT5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	291-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|A6NLC5|CC070_HUMAN	UPF0524 protein C3orf70 OS=Homo sapiens OX=9606 GN=C3orf70 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	157-UNIMOD:35,158-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q04446|GLGB_HUMAN	1,4-alpha-glucan-branching enzyme OS=Homo sapiens OX=9606 GN=GBE1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q6IQ23|PKHA7_HUMAN	Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	117-UNIMOD:21,119-UNIMOD:35,903-UNIMOD:21,907-UNIMOD:21	0.03	23.0	2	2	2
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1456-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P55010|IF5_HUMAN	Eukaryotic translation initiation factor 5 OS=Homo sapiens OX=9606 GN=EIF5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y2X9-2|ZN281_HUMAN	Isoform 2 of Zinc finger protein 281 OS=Homo sapiens OX=9606 GN=ZNF281	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	584-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P01275|GLUC_HUMAN	Glucagon OS=Homo sapiens OX=9606 GN=GCG PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	32-UNIMOD:21,47-UNIMOD:35	0.12	23.0	1	1	1
PRT	sp|A0JNW5|UH1BL_HUMAN	UHRF1-binding protein 1-like OS=Homo sapiens OX=9606 GN=UHRF1BP1L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	987-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q6NZI2|CAVN1_HUMAN	Caveolae-associated protein 1 OS=Homo sapiens OX=9606 GN=CAVIN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	171-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q6P3S1|DEN1B_HUMAN	DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	596-UNIMOD:21,597-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q15306-2|IRF4_HUMAN	Isoform 2 of Interferon regulatory factor 4 OS=Homo sapiens OX=9606 GN=IRF4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9Y653-5|AGRG1_HUMAN	Isoform 5 of Adhesion G-protein coupled receptor G1 OS=Homo sapiens OX=9606 GN=ADGRG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	503-UNIMOD:21	0.04	23.0	1	1	0
PRT	sp|Q12929|EPS8_HUMAN	Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	685-UNIMOD:21,687-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q9ULL8-2|SHRM4_HUMAN	Isoform 2 of Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	549-UNIMOD:21,551-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|O14639-3|ABLM1_HUMAN	Isoform 3 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	235-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q7L576-2|CYFP1_HUMAN	Isoform 2 of Cytoplasmic FMR1-interacting protein 1 OS=Homo sapiens OX=9606 GN=CYFIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	174-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	tRNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2020-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|Q9HAH7|FBRS_HUMAN	Probable fibrosin-1 OS=Homo sapiens OX=9606 GN=FBRS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	428-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P11279|LAMP1_HUMAN	Lysosome-associated membrane glycoprotein 1 OS=Homo sapiens OX=9606 GN=LAMP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	609-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P07910-4|HNRPC_HUMAN	Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P62857|RS28_HUMAN	40S ribosomal protein S28 OS=Homo sapiens OX=9606 GN=RPS28 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	35-UNIMOD:35	0.14	23.0	1	1	1
PRT	sp|P17066|HSP76_HUMAN	Heat shock 70 kDa protein 6 OS=Homo sapiens OX=9606 GN=HSPA6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P54868-3|HMCS2_HUMAN	Isoform 3 of Hydroxymethylglutaryl-CoA synthase, mitochondrial OS=Homo sapiens OX=9606 GN=HMGCS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9NX63|MIC19_HUMAN	MICOS complex subunit MIC19 OS=Homo sapiens OX=9606 GN=CHCHD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	50-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	243-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	104-UNIMOD:21,108-UNIMOD:35	0.16	23.0	1	1	0
PRT	sp|Q13905|RPGF1_HUMAN	Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	360-UNIMOD:21	0.01	23.0	1	1	0
PRT	sp|Q2LD37|K1109_HUMAN	Transmembrane protein KIAA1109 OS=Homo sapiens OX=9606 GN=KIAA1109 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	4894-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|O43493|TGON2_HUMAN	Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	71-UNIMOD:21,224-UNIMOD:21	0.08	23.0	2	2	1
PRT	sp|P09525|ANXA4_HUMAN	Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q8NEY1|NAV1_HUMAN	Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	806-UNIMOD:21	0.01	23.0	1	1	0
PRT	sp|P07148|FABPL_HUMAN	Fatty acid-binding protein, liver OS=Homo sapiens OX=9606 GN=FABP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	2	1	0
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P62491|RB11A_HUMAN	Ras-related protein Rab-11A OS=Homo sapiens OX=9606 GN=RAB11A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.06	23.0	1	1	1
PRT	sp|Q9NZV5|SELN_HUMAN	Selenoprotein N OS=Homo sapiens OX=9606 GN=SELENON PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	13-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q9UQ88|CD11A_HUMAN	Cyclin-dependent kinase 11A OS=Homo sapiens OX=9606 GN=CDK11A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	740-UNIMOD:21	0.03	23.0	1	1	0
PRT	sp|P52948|NUP98_HUMAN	Nuclear pore complex protein Nup98-Nup96 OS=Homo sapiens OX=9606 GN=NUP98 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	888-UNIMOD:21	0.01	23.0	3	1	0
PRT	sp|Q8NEZ2|VP37A_HUMAN	Vacuolar protein sorting-associated protein 37A OS=Homo sapiens OX=9606 GN=VPS37A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	264-UNIMOD:28	0.03	23.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q9NY27|PP4R2_HUMAN	Serine/threonine-protein phosphatase 4 regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PPP4R2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	226-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q709C8|VP13C_HUMAN	Vacuolar protein sorting-associated protein 13C OS=Homo sapiens OX=9606 GN=VPS13C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	3612-UNIMOD:28,3614-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|P63313|TYB10_HUMAN	Thymosin beta-10 OS=Homo sapiens OX=9606 GN=TMSB10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1,7-UNIMOD:35	0.34	23.0	1	1	1
PRT	sp|Q15404|RSU1_HUMAN	Ras suppressor protein 1 OS=Homo sapiens OX=9606 GN=RSU1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9NR28|DBLOH_HUMAN	Diablo homolog, mitochondrial OS=Homo sapiens OX=9606 GN=DIABLO PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	1	1	0
PRT	sp|O60293|ZC3H1_HUMAN	Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	766-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9NTX5|ECHD1_HUMAN	Ethylmalonyl-CoA decarboxylase OS=Homo sapiens OX=9606 GN=ECHDC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	289-UNIMOD:28,291-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q6P9F7|LRC8B_HUMAN	Volume-regulated anion channel subunit LRRC8B OS=Homo sapiens OX=9606 GN=LRRC8B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	186-UNIMOD:21,195-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P21359|NF1_HUMAN	Neurofibromin OS=Homo sapiens OX=9606 GN=NF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	876-UNIMOD:21,877-UNIMOD:35,881-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|Q9NW64|RBM22_HUMAN	Pre-mRNA-splicing factor RBM22 OS=Homo sapiens OX=9606 GN=RBM22 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	102-UNIMOD:21,107-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P20020|AT2B1_HUMAN	Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|O94979|SC31A_HUMAN	Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	799-UNIMOD:21	0.01	23.0	1	1	0
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	303-UNIMOD:21,307-UNIMOD:21	0.03	23.0	1	1	0
PRT	sp|Q9H3S1|SEM4A_HUMAN	Semaphorin-4A OS=Homo sapiens OX=9606 GN=SEMA4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	170-UNIMOD:35,176-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q8TF40|FNIP1_HUMAN	Folliculin-interacting protein 1 OS=Homo sapiens OX=9606 GN=FNIP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	73-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q14746|COG2_HUMAN	Conserved oligomeric Golgi complex subunit 2 OS=Homo sapiens OX=9606 GN=COG2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	651-UNIMOD:21,656-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	1616-UNIMOD:21,1619-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q6NXS1|IPP2B_HUMAN	Protein phosphatase inhibitor 2 family member B OS=Homo sapiens OX=9606 GN=PPP1R2B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	20-UNIMOD:21,25-UNIMOD:35	0.09	23.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	127-UNIMOD:4,128-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q15814|TBCC_HUMAN	Tubulin-specific chaperone C OS=Homo sapiens OX=9606 GN=TBCC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q8NDF8-4|PAPD5_HUMAN	Isoform 4 of Non-canonical poly(A) RNA polymerase PAPD5 OS=Homo sapiens OX=9606 GN=TENT4B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	49-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|P61923-5|COPZ1_HUMAN	Isoform 5 of Coatomer subunit zeta-1 OS=Homo sapiens OX=9606 GN=COPZ1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	73-UNIMOD:35	0.07	22.0	2	2	2
PRT	sp|Q14247-2|SRC8_HUMAN	Isoform 2 of Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	364-UNIMOD:21,368-UNIMOD:21,381-UNIMOD:21	0.05	22.0	2	2	2
PRT	sp|Q9UJC3-2|HOOK1_HUMAN	Isoform 2 of Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9NYM9|BET1L_HUMAN	BET1-like protein OS=Homo sapiens OX=9606 GN=BET1L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.13	22.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q99442|SEC62_HUMAN	Translocation protein SEC62 OS=Homo sapiens OX=9606 GN=SEC62 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	55-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q08722|CD47_HUMAN	Leukocyte surface antigen CD47 OS=Homo sapiens OX=9606 GN=CD47 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	316-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P35659-2|DEK_HUMAN	Isoform 2 of Protein DEK OS=Homo sapiens OX=9606 GN=DEK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	188-UNIMOD:4,198-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O15551|CLD3_HUMAN	Claudin-3 OS=Homo sapiens OX=9606 GN=CLDN3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.06	22.0	1	1	1
PRT	sp|O43493-4|TGON2_HUMAN	Isoform 4 of Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	221-UNIMOD:21	0.05	22.0	1	1	0
PRT	sp|Q86U44-2|MTA70_HUMAN	Isoform 2 of N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	64-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|P55084-2|ECHB_HUMAN	Isoform 2 of Trifunctional enzyme subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=HADHB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P41219|PERI_HUMAN	Peripherin OS=Homo sapiens OX=9606 GN=PRPH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q96JN0-2|LCOR_HUMAN	Isoform 2 of Ligand-dependent corepressor OS=Homo sapiens OX=9606 GN=LCOR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	249-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P12110|CO6A2_HUMAN	Collagen alpha-2(VI) chain OS=Homo sapiens OX=9606 GN=COL6A2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q8N8V4|ANS4B_HUMAN	Ankyrin repeat and SAM domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ANKS4B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	466-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	310-UNIMOD:4,317-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	108-UNIMOD:4	0.13	22.0	1	1	1
PRT	sp|Q99996-5|AKAP9_HUMAN	Isoform 5 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1543-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9UIQ6-3|LCAP_HUMAN	Isoform 3 of Leucyl-cystinyl aminopeptidase OS=Homo sapiens OX=9606 GN=LNPEP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q4V328-3|GRAP1_HUMAN	Isoform 3 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9H7C9-3|AAMDC_HUMAN	Isoform 3 of Mth938 domain-containing protein OS=Homo sapiens OX=9606 GN=AAMDC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	46-UNIMOD:21	0.19	22.0	1	1	1
PRT	sp|Q9Y3P9|RBGP1_HUMAN	Rab GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RABGAP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	996-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q15059-2|BRD3_HUMAN	Isoform 2 of Bromodomain-containing protein 3 OS=Homo sapiens OX=9606 GN=BRD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O43704|ST1B1_HUMAN	Sulfotransferase family cytosolic 1B member 1 OS=Homo sapiens OX=9606 GN=SULT1B1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	285-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|Q01469|FABP5_HUMAN	Fatty acid-binding protein 5 OS=Homo sapiens OX=9606 GN=FABP5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P49748-3|ACADV_HUMAN	Isoform 3 of Very long-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADVL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q96S38-2|KS6C1_HUMAN	Isoform 2 of Ribosomal protein S6 kinase delta-1 OS=Homo sapiens OX=9606 GN=RPS6KC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	411-UNIMOD:21,415-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O00748-2|EST2_HUMAN	Isoform 2 of Cocaine esterase OS=Homo sapiens OX=9606 GN=CES2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9C0B5-2|ZDHC5_HUMAN	Isoform 2 of Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	327-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	2	2	2
PRT	sp|P29350-2|PTN6_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	441-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q13425-2|SNTB2_HUMAN	Isoform 2 of Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	95-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O15195-2|VILL_HUMAN	Isoform 2 of Villin-like protein OS=Homo sapiens OX=9606 GN=VILL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	759-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P16234|PGFRA_HUMAN	Platelet-derived growth factor receptor alpha OS=Homo sapiens OX=9606 GN=PDGFRA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1041-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q96QZ7-4|MAGI1_HUMAN	Isoform 4 of Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAGI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1022-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	139-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|Q8NHP6-2|MSPD2_HUMAN	Isoform 2 of Motile sperm domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MOSPD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	236-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9BXN1|ASPN_HUMAN	Asporin OS=Homo sapiens OX=9606 GN=ASPN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q6F5E8|CARL2_HUMAN	Capping protein, Arp2/3 and myosin-I linker protein 2 OS=Homo sapiens OX=9606 GN=CARMIL2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1251-UNIMOD:35,1253-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	384-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1186-UNIMOD:21,1208-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q70Z35-2|PREX2_HUMAN	Isoform 2 of Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1067-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	391-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P16615-5|AT2A2_HUMAN	Isoform 5 of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens OX=9606 GN=ATP2A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O95359-6|TACC2_HUMAN	Isoform 6 of Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	395-UNIMOD:21,399-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P62195-2|PRS8_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q8ND76-2|CCNY_HUMAN	Isoform 2 of Cyclin-Y OS=Homo sapiens OX=9606 GN=CCNY	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	25-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q96Q15-4|SMG1_HUMAN	Isoform 4 of Serine/threonine-protein kinase SMG1 OS=Homo sapiens OX=9606 GN=SMG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	772-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	257-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|A0A1B0GTU1|ZC11B_HUMAN	Zinc finger CCCH domain-containing protein 11B OS=Homo sapiens OX=9606 GN=ZC3H11B PE=4 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	762-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P30086|PEBP1_HUMAN	Phosphatidylethanolamine-binding protein 1 OS=Homo sapiens OX=9606 GN=PEBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|P15822|ZEP1_HUMAN	Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1034-UNIMOD:35,1036-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9GZM8-3|NDEL1_HUMAN	Isoform 3 of Nuclear distribution protein nudE-like 1 OS=Homo sapiens OX=9606 GN=NDEL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=H2AFY	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	294-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O75449|KTNA1_HUMAN	Katanin p60 ATPase-containing subunit A1 OS=Homo sapiens OX=9606 GN=KATNA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	170-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|Q14469|HES1_HUMAN	Transcription factor HES-1 OS=Homo sapiens OX=9606 GN=HES1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	10-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q12774|ARHG5_HUMAN	Rho guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=ARHGEF5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1163-UNIMOD:21,1168-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P48552|NRIP1_HUMAN	Nuclear receptor-interacting protein 1 OS=Homo sapiens OX=9606 GN=NRIP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	518-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q13625-2|ASPP2_HUMAN	Isoform 2 of Apoptosis-stimulating of p53 protein 2 OS=Homo sapiens OX=9606 GN=TP53BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	550-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P02675|FIBB_HUMAN	Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	62-UNIMOD:28	0.01	22.0	2	1	0
PRT	sp|Q8WW12-2|PCNP_HUMAN	Isoform 2 of PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	53-UNIMOD:21	0.12	22.0	1	1	1
PRT	sp|Q16891-3|MIC60_HUMAN	Isoform 3 of MICOS complex subunit MIC60 OS=Homo sapiens OX=9606 GN=IMMT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	400-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q14112-2|NID2_HUMAN	Isoform 2 of Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P81408-2|F189B_HUMAN	Isoform B of Protein FAM189B OS=Homo sapiens OX=9606 GN=FAM189B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	397-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	2804-UNIMOD:21,2813-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|O75110-2|ATP9A_HUMAN	Isoform Short of Probable phospholipid-transporting ATPase IIA OS=Homo sapiens OX=9606 GN=ATP9A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q14141-2|SEPT6_HUMAN	Isoform I of Septin-6 OS=Homo sapiens OX=9606 GN=SEPT6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P14314-2|GLU2B_HUMAN	Isoform 2 of Glucosidase 2 subunit beta OS=Homo sapiens OX=9606 GN=PRKCSH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	175-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q14241|ELOA1_HUMAN	Elongin-A OS=Homo sapiens OX=9606 GN=ELOA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	222-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q13207|TBX2_HUMAN	T-box transcription factor TBX2 OS=Homo sapiens OX=9606 GN=TBX2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	94-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P26045-2|PTN3_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 3 OS=Homo sapiens OX=9606 GN=PTPN3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	228-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P11171-7|41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	6-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q08AE8-3|SPIR1_HUMAN	Isoform 3 of Protein spire homolog 1 OS=Homo sapiens OX=9606 GN=SPIRE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	505-UNIMOD:21,506-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q14667-3|K0100_HUMAN	Isoform 3 of Protein KIAA0100 OS=Homo sapiens OX=9606 GN=KIAA0100	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	248-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P02652|APOA2_HUMAN	Apolipoprotein A-II OS=Homo sapiens OX=9606 GN=APOA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.10	22.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	734-UNIMOD:21,741-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q6VY07|PACS1_HUMAN	Phosphofurin acidic cluster sorting protein 1 OS=Homo sapiens OX=9606 GN=PACS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	485-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q5T5C0-2|STXB5_HUMAN	Isoform 2 of Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	744-UNIMOD:21	0.01	22.0	1	1	0
PRT	sp|O95394|AGM1_HUMAN	Phosphoacetylglucosamine mutase OS=Homo sapiens OX=9606 GN=PGM3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	60-UNIMOD:35,64-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q13480|GAB1_HUMAN	GRB2-associated-binding protein 1 OS=Homo sapiens OX=9606 GN=GAB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	208-UNIMOD:21,213-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q96A49|SYAP1_HUMAN	Synapse-associated protein 1 OS=Homo sapiens OX=9606 GN=SYAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	86-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1569-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9C0D5|TANC1_HUMAN	Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	207-UNIMOD:21,209-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|P39656-3|OST48_HUMAN	Isoform 3 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P11216|PYGB_HUMAN	Glycogen phosphorylase, brain form OS=Homo sapiens OX=9606 GN=PYGB PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	326-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q9Y678|COPG1_HUMAN	Coatomer subunit gamma-1 OS=Homo sapiens OX=9606 GN=COPG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|A0JLT2|MED19_HUMAN	Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	194-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	520-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q6ZSS7|MFSD6_HUMAN	Major facilitator superfamily domain-containing protein 6 OS=Homo sapiens OX=9606 GN=MFSD6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	10-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P01009|A1AT_HUMAN	Alpha-1-antitrypsin OS=Homo sapiens OX=9606 GN=SERPINA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9NZM1-2|MYOF_HUMAN	Isoform 2 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q02880-2|TOP2B_HUMAN	Isoform Beta-1 of DNA topoisomerase 2-beta OS=Homo sapiens OX=9606 GN=TOP2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1395-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O60361|NDK8_HUMAN	Putative nucleoside diphosphate kinase OS=Homo sapiens OX=9606 GN=NME2P1 PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	75-UNIMOD:35	0.09	22.0	1	1	1
PRT	sp|O43423|AN32C_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member C OS=Homo sapiens OX=9606 GN=ANP32C PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P00338-4|LDHA_HUMAN	Isoform 4 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	62-UNIMOD:21	0.12	22.0	1	1	1
PRT	sp|Q9UMZ2-6|SYNRG_HUMAN	Isoform 5 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	559-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9Y3A6-2|TMED5_HUMAN	Isoform 2 of Transmembrane emp24 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=TMED5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	151-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q5JSH3-3|WDR44_HUMAN	Isoform 3 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	88-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P09493|TPM1_HUMAN	Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	141-UNIMOD:35	0.07	22.0	4	2	0
PRT	sp|P60174|TPIS_HUMAN	Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	120-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	131-UNIMOD:21	0.13	22.0	1	1	1
PRT	sp|Q68DQ2|CRBG3_HUMAN	Very large A-kinase anchor protein OS=Homo sapiens OX=9606 GN=CRYBG3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	142-UNIMOD:28,143-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|O75420|GGYF1_HUMAN	GRB10-interacting GYF protein 1 OS=Homo sapiens OX=9606 GN=GIGYF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	538-UNIMOD:21,546-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|P07305|H10_HUMAN	Histone H1.0 OS=Homo sapiens OX=9606 GN=H1F0 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	5-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q5T5C0|STXB5_HUMAN	Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	785-UNIMOD:21	0.01	22.0	1	1	0
PRT	sp|P0CK96|S352B_HUMAN	Solute carrier family 35 member E2B OS=Homo sapiens OX=9606 GN=SLC35E2B PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,7-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|A6NHL2|TBAL3_HUMAN	Tubulin alpha chain-like 3 OS=Homo sapiens OX=9606 GN=TUBAL3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	420-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|P61601|NCALD_HUMAN	Neurocalcin-delta OS=Homo sapiens OX=9606 GN=NCALD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P42568|AF9_HUMAN	Protein AF-9 OS=Homo sapiens OX=9606 GN=MLLT3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	483-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P29597|TYK2_HUMAN	Non-receptor tyrosine-protein kinase TYK2 OS=Homo sapiens OX=9606 GN=TYK2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	613-UNIMOD:21,621-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q9P0K7|RAI14_HUMAN	Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	667-UNIMOD:21	0.01	22.0	1	1	0
PRT	sp|P46459|NSF_HUMAN	Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	393-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q9ULJ7|ANR50_HUMAN	Ankyrin repeat domain-containing protein 50 OS=Homo sapiens OX=9606 GN=ANKRD50 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	729-UNIMOD:21,732-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P37235|HPCL1_HUMAN	Hippocalcin-like protein 1 OS=Homo sapiens OX=9606 GN=HPCAL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	22.0	null		0.07	22.0	2	1	0
PRT	sp|Q9Y2I1|NISCH_HUMAN	Nischarin OS=Homo sapiens OX=9606 GN=NISCH PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	1284-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,10-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O95744|PM2P2_HUMAN	Putative postmeiotic segregation increased 2-like protein 2 OS=Homo sapiens OX=9606 GN=PMS2P2 PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	4-UNIMOD:21,5-UNIMOD:21,12-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q9H4L5|OSBL3_HUMAN	Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	437-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q03112-4|MECOM_HUMAN	Isoform 4 of MDS1 and EVI1 complex locus protein OS=Homo sapiens OX=9606 GN=MECOM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	1-UNIMOD:35,7-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P49023|PAXI_HUMAN	Paxillin OS=Homo sapiens OX=9606 GN=PXN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	118-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9UEY8|ADDG_HUMAN	Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	681-UNIMOD:21	0.03	22.0	1	1	0
PRT	sp|Q9BX66|SRBS1_HUMAN	Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	350-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P78549|NTH_HUMAN	Endonuclease III-like protein 1 OS=Homo sapiens OX=9606 GN=NTHL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	73-UNIMOD:21	0.06	22.0	1	1	0
PRT	sp|Q9NQF3|SERHL_HUMAN	Serine hydrolase-like protein OS=Homo sapiens OX=9606 GN=SERHL PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	184-UNIMOD:21,186-UNIMOD:21,190-UNIMOD:4,198-UNIMOD:4	0.10	22.0	1	1	1
PRT	sp|Q9H2Y7|ZN106_HUMAN	Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	1298-UNIMOD:21,1307-UNIMOD:4	0.01	22.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	GDQPAASGDSDDDEPPPLPR	1	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=10483	49.488	2	2034.8767	2034.8767	R	L	48	68
PSM	KGSSGNASEVSVACLTER	2	sp|Q69YQ0-2|CYTSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	47	3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13419	62.698	2	1930.8456	1930.8456	R	I	382	400
PSM	GDQPAASGDSDDDEPPPLPR	3	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=10252	48.489	2	2034.8767	2034.8767	R	L	48	68
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	4	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	45	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6772	33.08600833333333	3	3007.3255	3007.3290	K	S	145	174
PSM	GDQPAASGDSDDDEPPPLPR	5	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=10709	50.502	2	2034.8767	2034.8767	R	L	48	68
PSM	KGSSSSVCSVASSSDISLGSTK	6	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=13192	61.644	2	2209.9774	2209.9774	R	T	1382	1404
PSM	KYSASSGGLCEEATAAK	7	sp|Q9UHV7|MED13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=8587	41.073	2	1808.7652	1808.7652	R	V	393	410
PSM	SKSISSSNPDLAVAPGSVDDEVSR	8	sp|Q96HP0|DOCK6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44	1-UNIMOD:21	ms_run[2]:scan=14579	68.316	2	2496.1381	2496.1381	R	I	878	902
PSM	IQPDSHSLSYGTLPDGSDSTK	9	sp|Q9H841-2|NPAL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	9-UNIMOD:21	ms_run[2]:scan=13622	63.684	2	2283.9897	2283.9897	K	S	354	375
PSM	SKFDSDEEEEDTENVEAASSGK	10	sp|Q8TF01-2|PNISR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	5-UNIMOD:21	ms_run[2]:scan=11375	53.463	2	2481.9544	2481.9544	R	V	286	308
PSM	GQKSPGALETPSAAGSQGNTASQGK	11	sp|Q9Y2D5|AKAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	4-UNIMOD:21	ms_run[2]:scan=5586	27.824	3	2408.0969	2408.0969	K	E	390	415
PSM	NEKPTQSVSSPEATSGSTGSVEK	12	sp|Q9BZ95-3|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	10-UNIMOD:21	ms_run[2]:scan=4675	24.065	3	2386.0537	2386.0537	R	K	552	575
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	13	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7447	36.07529166666667	3	3008.3292	3007.3292	K	S	145	174
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	14	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	42	14-UNIMOD:21	ms_run[1]:scan=13132	61.36646833333334	3	3323.230750	3322.231806	K	D	929	958
PSM	GDQPAASGDSDDDEPPPLPR	15	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=10947	51.513	2	2034.8767	2034.8767	R	L	48	68
PSM	IQPDSHSLSYGTLPDGSDSTK	16	sp|Q9H841-2|NPAL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	7-UNIMOD:21	ms_run[2]:scan=13415	62.679	2	2283.9897	2283.9897	K	S	354	375
PSM	KEESEESDDDMGFGLFD	17	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	11-UNIMOD:35	ms_run[2]:scan=18855	92.278	2	1964.7469	1964.7469	K	-	99	116
PSM	KLSSSDAPAQDTGSSAAAVETDASR	18	sp|Q7Z4S6-2|KI21A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	3-UNIMOD:21	ms_run[2]:scan=10266	48.542	2	2501.0919	2501.0919	R	T	838	863
PSM	KTSASDVTNIYPGDAGK	19	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	3-UNIMOD:21	ms_run[2]:scan=10817	50.959	2	1802.8088	1802.8088	K	A	491	508
PSM	KTSASDVTNIYPGDAGK	20	sp|Q15042-4|RB3GP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	3-UNIMOD:21	ms_run[2]:scan=11041	51.977	2	1802.8088	1802.8088	K	A	491	508
PSM	TSGPLSPPTGPPGPAPAGPAVR	21	sp|P49815-7|TSC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	6-UNIMOD:21	ms_run[2]:scan=15415	72.46	2	2060.0092	2060.0092	K	L	610	632
PSM	VDNALQSGNSQESVTEQDSK	22	sp|P01834|IGKC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6433	31.566	2	2134.9614	2134.9614	K	D	43	63
PSM	PEDTGAEKSPTTSADLK	23	sp|O75363|BCAS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	41	9-UNIMOD:21	ms_run[1]:scan=3911	20.713175	2	1825.7959	1825.7977	D	S	306	323
PSM	KVSQSTSSLVDTSVSATSR	24	sp|Q8IY17-5|PLPL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:21	ms_run[2]:scan=11941	55.927	2	2018.9521	2018.9521	R	P	66	85
PSM	LLGSAAEEEEEEEEDGK	25	sp|Q86U38-2|NOP9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=10556	49.791	2	1862.7905	1862.7905	R	D	156	173
PSM	LPNLSSPSAEGPPGPPSGPAPR	26	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	6-UNIMOD:21	ms_run[2]:scan=15231	71.551	2	2161.0205	2161.0205	R	K	412	434
PSM	PAPEASSLEEPHSPETGEK	27	sp|Q5JTC6-2|AMER1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	13-UNIMOD:21	ms_run[2]:scan=8005	38.521	2	2070.8783	2070.8783	K	V	274	293
PSM	PFPSEETTENDDDVYR	28	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=12578	58.789	2	1912.7963	1912.7963	R	S	128	144
PSM	RDSLGAYASQDANEQGQDLGK	29	sp|Q9C0C2-2|TB182_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:21	ms_run[2]:scan=11782	55.232	2	2301.9863	2301.9863	K	R	342	363
PSM	SFHSSSSSSSSSTSSSASR	30	sp|Q9UBY9-3|HSPB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	1-UNIMOD:21	ms_run[2]:scan=673	6.0656	2	1928.7385	1928.7385	R	A	14	33
PSM	SSHSSDSGGSDVDLDPTDGK	31	sp|P78545-2|ELF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	10-UNIMOD:21	ms_run[2]:scan=6422	31.511	2	2041.775	2041.7750	R	L	183	203
PSM	SSSMSSIDLVSASDDVHR	32	sp|Q9Y5P4|C43BP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=13435	62.783	2	1987.8194	1987.8194	R	F	375	393
PSM	GGVTGSPEASISGSKGDLK	33	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	14-UNIMOD:21	ms_run[2]:scan=9338	44.366	2	1825.8459	1825.8459	K	S	5726	5745
PSM	HGSGADSDYENTQSGDPLLGLEGK	34	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:21	ms_run[2]:scan=17931	86.379	2	2526.0548	2526.0548	R	R	590	614
PSM	KETESEAEDNLDDLEK	35	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:21	ms_run[2]:scan=13306	62.179	2	1943.7885	1943.7885	K	H	868	884
PSM	KSSADTEFSDECTTAER	36	sp|Q9H6S0|YTDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=7146	34.653	2	2012.767	2012.7670	R	V	1200	1217
PSM	KSSTGEASENGLEDIDR	37	sp|Q9BQ70|TCF25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:21	ms_run[2]:scan=10064	47.663	2	1886.7895	1886.7895	K	I	136	153
PSM	RSSASVSDSSGFSDSESADSLYR	38	sp|Q9H4X1-2|RGCC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:21	ms_run[2]:scan=13837	64.727	3	2476.0027	2476.0027	R	N	43	66
PSM	SQSSHSYDDSTLPLIDR	39	sp|O60716-32|CTND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:21	ms_run[2]:scan=16199	76.526	2	1999.8524	1999.8524	R	N	530	547
PSM	TAKDSDDDDDVAVTVDR	40	sp|Q16623-3|STX1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:21	ms_run[2]:scan=7598	36.8	2	1915.7684	1915.7684	R	D	10	27
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	41	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7063	34.30909833333333	3	3007.3271	3007.3290	K	S	145	174
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	42	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39	14-UNIMOD:21	ms_run[1]:scan=12565	58.730901666666675	3	3324.234704	3322.231806	K	D	929	958
PSM	CIPALDSLTPANEDQK	43	sp|P10809|CH60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:4	ms_run[2]:scan=17226	82.314	2	1770.8458	1770.8458	R	I	447	463
PSM	HSAGSGAEESNSSSTVQK	44	sp|Q8IYL3|CA174_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:21	ms_run[2]:scan=588	5.5902	2	1841.7429	1841.7429	K	Q	144	162
PSM	KDSSSVVEWTQAPK	45	sp|Q8TC07-2|TBC15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21	ms_run[2]:scan=12848	60.076	2	1640.7447	1640.7447	R	E	68	82
PSM	KETESEAEDNLDDLEK	46	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	5-UNIMOD:21	ms_run[2]:scan=10099	47.807	2	1943.7885	1943.7885	K	H	868	884
PSM	KETESEAEDNLDDLEK	47	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	5-UNIMOD:21	ms_run[2]:scan=13290	62.11	2	1943.7885	1943.7885	K	H	868	884
PSM	KGSAVDASVQEESPVTK	48	sp|O95613|PCNT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21	ms_run[2]:scan=7517	36.428	2	1810.835	1810.8350	R	E	42	59
PSM	KQSFDDNDSEELEDK	49	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21	ms_run[2]:scan=7907	38.096	2	1877.7204	1877.7204	K	D	105	120
PSM	LKSEDGVEGDLGETQSR	50	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21	ms_run[2]:scan=8333	39.947	2	1898.8259	1898.8259	R	T	133	150
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	51	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:35,5-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11202	52.679	3	3061.253	3061.2530	R	V	320	347
PSM	RSSSNESFSSNQSTESTQDEETLALR	52	sp|O60268-2|K0513_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:21	ms_run[2]:scan=14099	65.988	3	2969.2524	2969.2524	R	D	71	97
PSM	SASDASISSGTHGQYSILQTAR	53	sp|O15056-3|SYNJ2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:21	ms_run[2]:scan=15091	70.869	2	2316.0383	2316.0383	K	L	1122	1144
PSM	TGRDTPENGETAIGAENSEK	54	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	5-UNIMOD:21	ms_run[2]:scan=5073	25.694	2	2154.9066	2154.9067	K	I	475	495
PSM	VHSPSGALEECYVTEIDQDK	55	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=18096	87.431	2	2355.993	2355.9930	K	Y	2360	2380
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	56	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=7680	37.147465000000004	3	3007.3259	3007.3290	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	57	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7116	34.53353333333333	3	3007.3271	3007.3290	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	58	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=7875	37.96056666666667	3	3007.3259	3007.3290	K	S	145	174
PSM	PDAQPGGELMLGGTDSK	59	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	10-UNIMOD:35	ms_run[1]:scan=10759	50.725746666666666	2	1687.7704	1687.7718	D	Y	237	254
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	60	sp|O60763|USO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38	14-UNIMOD:21	ms_run[1]:scan=13228	61.814478333333334	3	3323.230750	3322.231806	K	D	929	958
PSM	EREESEDELEEANGNNPIDIEVDQNK	61	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:21	ms_run[2]:scan=17159	81.917	3	3094.2888	3094.2888	R	E	256	282
PSM	FASEASGYQDNIAR	62	sp|P17661|DESM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9752	46.249	2	1527.6954	1527.6954	R	L	356	370
PSM	FDVPGDENAEMDAR	63	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35	ms_run[2]:scan=10839	51.047	2	1580.6413	1580.6413	K	T	1369	1383
PSM	KGDDSDEEDLCISNK	64	sp|Q9Y3M8-5|STA13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=7827	37.766	2	1803.687	1803.6870	K	W	121	136
PSM	LFEESDDKEDEDADGK	65	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:21	ms_run[2]:scan=7423	35.942	2	1920.715	1920.7150	K	E	672	688
PSM	LYGSAGPPPTGEEDTAEKDEL	66	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=14067	65.823	2	2174.9855	2174.9855	K	-	634	655
PSM	RASVCAEAYNPDEEEDDAESR	67	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10015	47.455	2	2491.9435	2491.9435	R	I	112	133
PSM	SETAPAETATPAPVEKSPAK	68	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	17-UNIMOD:21	ms_run[2]:scan=5824	28.864	2	2060.9667	2060.9667	M	K	2	22
PSM	SGSPSDNSGAEEMEVSLAKPK	69	sp|P31749-2|AKT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=9114	43.407	2	2214.9352	2214.9352	R	H	60	81
PSM	SSHSLPSEASSQPQVK	70	sp|O43426|SYNJ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:21	ms_run[2]:scan=6418	31.492	2	1747.7778	1747.7778	R	T	1292	1308
PSM	TTKSPSDSGYSYETIGK	71	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	4-UNIMOD:21	ms_run[2]:scan=9843	46.681	2	1899.8139	1899.8139	R	T	1912	1929
PSM	VFDDESDEKEDEEYADEK	72	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37	6-UNIMOD:21	ms_run[1]:scan=10460	49.387315	2	2271.827225	2270.826395	K	G	637	655
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	73	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=6550	32.076335	3	3007.3270	3007.3290	K	S	145	174
PSM	RVSVCAETYNPDEEEEDTD	74	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=12058	56.46665333333333	2	2336.8597	2336.8623	R	P	97	116
PSM	QVAGDAPVEQATAETASPVHR	75	sp|Q92766|RREB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:28,17-UNIMOD:21	ms_run[1]:scan=13117	61.285808333333335	2	2195.9833	2195.9843	R	E	1304	1325
PSM	AGDRNSEDDGVVMTFSSVK	76	sp|Q9NY61|AATF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=14644	68.623	2	2108.8722	2108.8722	R	V	198	217
PSM	DDKEEEEDGTGSPQLNNR	77	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:21	ms_run[2]:scan=3452	18.729	2	2111.8281	2111.8281	K	-	393	411
PSM	FADQDDIGNVSFDR	78	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=16118	76.106	2	1597.7009	1597.7009	K	V	489	503
PSM	GGEYGFGAAFDADGDR	79	sp|Q15124|PGM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=16489	78.184	2	1603.6539	1603.6539	K	Y	283	299
PSM	GGEYGFGAAFDADGDR	80	sp|Q15124|PGM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=17134	81.778	2	1603.6539	1603.6539	K	Y	283	299
PSM	GSYLTHEASGLDEQGEAR	81	sp|Q8NFZ8|CADM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	9-UNIMOD:21	ms_run[2]:scan=12337	57.705	2	1998.832	1998.8320	K	E	353	371
PSM	ILDQGEDFPASEMTR	82	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	13-UNIMOD:35	ms_run[2]:scan=12369	57.854	2	1723.7723	1723.7723	K	I	209	224
PSM	ILGENEEEEDLAESGR	83	sp|Q9Y4C8|RBM19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=13288	62.099	2	1788.8014	1788.8014	R	L	388	404
PSM	KDSIPQVLLPEEEK	84	sp|Q15052-2|ARHG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=17628	84.651	2	1703.8383	1703.8383	R	L	528	542
PSM	KETESEAEDNLDDLEK	85	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:21	ms_run[2]:scan=12510	58.493	2	1943.7885	1943.7885	K	H	868	884
PSM	KVSSSSESEPELAQLK	86	sp|Q01484|ANK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=11792	55.276	2	1797.8397	1797.8397	R	K	2659	2675
PSM	KYSEVDDSLPSGGEK	87	sp|Q05D32-2|CTSL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=10008	47.43	2	1689.7135	1689.7135	R	P	26	41
PSM	LEGDSDDLLEDSDSEEHSR	88	sp|Q9NR09|BIRC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:21	ms_run[2]:scan=11334	53.286	2	2226.8438	2226.8438	K	S	469	488
PSM	LEGLGSSEADQDGLASTVR	89	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=15165	71.237	2	1903.9123	1903.9123	R	S	455	474
PSM	LKSEDGVEGDLGETQSR	90	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=8039	38.666	2	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	91	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=9167	43.632	2	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	92	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=9422	44.711	2	1898.8259	1898.8259	R	T	133	150
PSM	MQNTDDEERPQLSDDER	93	sp|Q8WVC0-2|LEO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=5689	28.234	2	2172.8267	2172.8267	K	Q	185	202
PSM	NLTSSSLNDISDKPEK	94	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=11653	54.687	2	1826.8299	1826.8299	R	D	252	268
PSM	NQVAMNPTNTVFDAK	95	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:35	ms_run[2]:scan=11664	54.73	2	1664.7828	1664.7828	K	R	57	72
PSM	QKSDAEEDGGTVSQEEEDR	96	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=3634	19.507	2	2187.8441	2187.8441	K	K	444	463
PSM	SEAAAPHTDAGGGLSSDEEEGTSSQAEAAR	97	sp|Q01831-2|XPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	15-UNIMOD:21	ms_run[2]:scan=8451	40.477	3	2967.2003	2967.2003	K	I	832	862
PSM	SLGDDISSETSGDFR	98	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=15547	73.145	2	1584.6904	1584.6904	K	K	139	154
PSM	SSAGDTEFVHQNSQEIQR	99	sp|O43164-2|PJA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	13-UNIMOD:21	ms_run[2]:scan=9074	43.2	2	2111.8909	2111.8909	K	S	241	259
PSM	TEIKEEEDQPSTSATQSSPAPGQSK	100	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	18-UNIMOD:21	ms_run[2]:scan=4841	24.781	3	2711.1811	2711.1811	K	K	1021	1046
PSM	TKSPTDDEVTPSAVVR	101	sp|Q9Y2H5|PKHA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:21	ms_run[2]:scan=9541	45.239	2	1780.8244	1780.8244	R	R	775	791
PSM	TPEELEDVSDLEEEHEVR	102	sp|Q9UI47|CTNA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	9-UNIMOD:21	ms_run[2]:scan=16957	80.765	2	2233.9264	2233.9264	R	S	629	647
PSM	TPVASTHSISSAATPDR	103	sp|P27448-8|MARK3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:21	ms_run[2]:scan=7853	37.873	2	1776.8044	1776.8044	R	I	457	474
PSM	VELKSEANDAVNSSTK	104	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:21	ms_run[2]:scan=10000	47.398	2	1770.8037	1770.8037	K	E	113	129
PSM	VQVAALQASPPLDQDDR	105	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=15112	70.969	2	1821.9221	1821.9221	K	A	99	116
PSM	QAAASATQTIAAAQHAASTPK	106	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=16016	75.55589666666667	2	2057.9592	2056.9572	K	A	923	944
PSM	APSEEELHGDQTDFGQGSQSPQK	107	sp|Q8TE77-4|SSH3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21	ms_run[2]:scan=10027	47.503	3	2551.05	2551.0500	K	Q	68	91
PSM	ATQQQHDFTLTQTADGR	108	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:21	ms_run[2]:scan=10510	49.597	2	1996.864	1996.8640	R	S	2637	2654
PSM	DPDAQPGGELMLGGTDSK	109	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:35	ms_run[2]:scan=11539	54.199	2	1802.7993	1802.7993	R	Y	236	254
PSM	ELVSSSSSGSDSDSEVDKK	110	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	12-UNIMOD:21	ms_run[2]:scan=3755	20.022	2	2021.8314	2021.8314	K	L	6	25
PSM	ESEDKPEIEDVGSDEEEEK	111	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:21	ms_run[2]:scan=9314	44.271	2	2271.8792	2271.8792	K	K	251	270
PSM	FSGEEGEIEDDESGTENREEK	112	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:21	ms_run[2]:scan=8563	40.974	2	2464.9391	2464.9391	K	D	927	948
PSM	GAAEEAELEDSDDEEKPVK	113	sp|Q9UBB9|TFP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:21	ms_run[2]:scan=8065	38.779	2	2139.8733	2139.8733	K	Q	88	107
PSM	GAVAAEGASDTEREEPTESQGLAAR	114	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:21	ms_run[2]:scan=9801	46.487	3	2581.1293	2581.1293	R	L	907	932
PSM	GGEYGFGAAFDADGDR	115	sp|Q15124|PGM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=16958	80.769	2	1603.6539	1603.6539	K	Y	283	299
PSM	GKLSAEENPDDSEVPSSSGINSTK	116	sp|Q9Y5Q9-2|TF3C3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:21	ms_run[2]:scan=10251	48.485	2	2527.0963	2527.0963	K	S	40	64
PSM	HYSPEDEPSPEAQPIAAYK	117	sp|Q6ZSR9|YJ005_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21	ms_run[2]:scan=12961	60.582	2	2207.9412	2207.9412	R	I	292	311
PSM	ILDSVGIEADDDR	118	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=12742	59.56	2	1416.6733	1416.6733	K	L	26	39
PSM	ILDSVGIEADDDR	119	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=12972	60.635	2	1416.6733	1416.6733	K	L	26	39
PSM	IMVDMLDSDGSGK	120	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8008	38.538	2	1398.6007	1398.6007	K	L	501	514
PSM	IQVLQQQADDAEER	121	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10265	48.539	2	1641.7958	1641.7958	K	A	14	28
PSM	KGGSYSQAASSDSAQGSDVSLTACK	122	sp|Q09160|1A80_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=9287	44.165	3	2541.069	2541.0690	R	V	340	365
PSM	KSSLDSNSSEMAIMMGADAK	123	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21,11-UNIMOD:35,14-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=8601	41.138	2	2199.8735	2199.8735	K	I	1108	1128
PSM	KTSLVIVESADNQPETCER	124	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=12640	59.076	2	2255.0141	2255.0141	R	L	3843	3862
PSM	LLDEEEATDNDLR	125	sp|Q8WUM4|PDC6I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=11900	55.76	2	1531.7002	1531.7002	R	A	457	470
PSM	LQGQLEQGDDTAAER	126	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5648	28.071	2	1629.7594	1629.7594	R	L	359	374
PSM	LYGSAGPPPTGEEDTAEKDEL	127	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=13857	64.814	2	2174.9855	2174.9855	K	-	634	655
PSM	NSLVTGGEDDRMSVNSGSSSSK	128	sp|Q8WVM7-2|STAG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	12-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=4950	25.223	2	2308.9479	2308.9479	R	T	1050	1072
PSM	PAEKPAETPVATSPTATDSTSGDSSR	129	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:21	ms_run[2]:scan=5316	26.691	3	2639.16	2639.1600	K	S	148	174
PSM	PFPSEETTENDDDVYR	130	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=12792	59.816	2	1912.7963	1912.7963	R	S	128	144
PSM	RASVCAEAYNPDEEEDDAESR	131	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9781	46.403	3	2491.9435	2491.9435	R	I	112	133
PSM	RGTVEGSVQEVQEEK	132	sp|Q9UPV7|PHF24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21	ms_run[2]:scan=7955	38.312	2	1753.7884	1753.7884	R	E	45	60
PSM	RVSVCAETYNPDEEEEDTDPR	133	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11979	56.086	3	2590.0167	2590.0167	R	V	97	118
PSM	RVSVCAETYNPDEEEEDTDPR	134	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11748	55.091	2	2590.0167	2590.0167	R	V	97	118
PSM	SEEETSPLVTHQNPAGPVASAPELESK	135	sp|P43007-2|SATT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	20-UNIMOD:21	ms_run[2]:scan=15454	72.682	3	2883.3175	2883.3175	K	E	204	231
PSM	STSMDSGSSESPASLKR	136	sp|Q15811-6|ITSN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=2521	14.435	2	1821.7452	1821.7452	K	V	971	988
PSM	VADGLPLAASMQEDEQSGR	137	sp|O75396|SC22B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:35	ms_run[2]:scan=12492	58.411	2	1988.9109	1988.9109	R	D	10	29
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	138	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=15536	73.09470166666667	3	3222.376223	3221.393230	R	S	38	70
PSM	AQLGINEDHSEGDEK	139	sp|Q69YQ0-2|CYTSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:21	ms_run[2]:scan=5469	27.352	2	1720.6941	1720.6941	R	S	211	226
PSM	AVLVDLEPGTMDSVR	140	sp|Q3ZCM7|TBB8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=16423	77.776	2	1616.808	1616.8080	R	S	63	78
PSM	FVCYCEGEESGEGDR	141	sp|Q9BUH6-2|PAXX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=8465	40.536	2	1792.6669	1792.6669	R	G	20	35
PSM	GEEGSDDDETENGPKPK	142	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:21	ms_run[2]:scan=896	7.1028	2	1882.7106	1882.7106	K	K	966	983
PSM	GNASPGAATHDSLSDYGPQDSR	143	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:21	ms_run[2]:scan=11004	51.787	2	2281.9237	2281.9237	R	P	963	985
PSM	GPSSEGPEEEDGEGFSFK	144	sp|P84157-2|MXRA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=14270	66.824	2	1883.7697	1883.7697	K	Y	125	143
PSM	GVVDSDDLPLNVSR	145	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=16671	79.176	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	146	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=16850	80.189	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	147	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=17035	81.204	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	148	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=17741	85.305	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	149	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=17918	86.313	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	150	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=18554	90.35	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	151	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=19184	94.401	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	152	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=19328	95.419	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	153	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=20082	100.85	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	154	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=20214	101.85	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	155	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=20337	102.86	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	156	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=20470	103.88	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	157	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=20594	104.88	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	158	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=20721	105.89	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	159	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=20847	106.91	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	160	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=20969	107.91	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	161	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=21465	111.93	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	162	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=21823	114.96	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	163	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=22419	120	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	164	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=22534	121.01	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	165	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=23565	130.1	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	166	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=23914	133.19	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	167	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=24149	135.32	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	168	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=19615	97.455	2	1484.7471	1484.7471	K	E	435	449
PSM	IAQLEEQLDNETK	169	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=13251	61.918	2	1529.7573	1529.7573	K	E	1816	1829
PSM	ILEDHGSPAGEIDDEDK	170	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:21	ms_run[2]:scan=10002	47.405	2	1918.7833	1918.7833	R	D	1670	1687
PSM	KGGSYSQAASSDSAQGSDMSLTACK	171	sp|P30512|1A29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:21,19-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=6834	33.344	3	2589.036	2589.0360	R	V	340	365
PSM	KGSITEYTAAEEK	172	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21	ms_run[2]:scan=7109	34.507	2	1505.6651	1505.6651	R	E	112	125
PSM	KGSITEYTAAEEK	173	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21	ms_run[2]:scan=7552	36.585	2	1505.6651	1505.6651	R	E	112	125
PSM	KTLTTVQGIADDYDK	174	sp|P41567|EIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:21	ms_run[2]:scan=15031	70.582	2	1746.8077	1746.8077	R	K	42	57
PSM	LEEKSEDQDLQGLK	175	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:21	ms_run[2]:scan=9210	43.827	2	1710.7713	1710.7713	R	D	21	35
PSM	LNQVCFDDDGTSSPQDR	176	sp|Q8N1F7-2|NUP93_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:4	ms_run[2]:scan=11002	51.776	2	1952.817	1952.8170	K	L	295	312
PSM	LPNLSSPSAEGPPGPPSGPAPR	177	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:21	ms_run[2]:scan=15219	71.499	3	2161.0205	2161.0205	R	K	412	434
PSM	LSSSDRYSDASDDSFSEPR	178	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:21	ms_run[2]:scan=10522	49.649	2	2199.8594	2199.8594	K	I	561	580
PSM	NGPLNESQEDEEDSEHGTSLNR	179	sp|Q9H2K8|TAOK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:21	ms_run[2]:scan=8825	42.107	2	2535.9987	2535.9987	R	E	318	340
PSM	NKSESQCDEDGMTSSLSESLK	180	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21,7-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=9495	45.03	3	2426.9455	2426.9455	R	T	1047	1068
PSM	NPETASEPLSEPESQRK	181	sp|Q7L4E1-3|MIGA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	14-UNIMOD:21	ms_run[2]:scan=5728	28.4	2	1977.8681	1977.8681	R	E	215	232
PSM	NYDFGSSTETSDSHLTK	182	sp|P49685|GPR15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:21	ms_run[2]:scan=10928	51.428	2	1967.7786	1967.7786	K	A	323	340
PSM	SGDEEFKGEDELCDSGR	183	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=11543	54.214	2	2008.7357	2008.7357	R	Q	339	356
PSM	SKSEANLIPSQEPFPASDNSGETPQR	184	sp|O00763-2|ACACB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:21	ms_run[2]:scan=16074	75.873	3	2865.2818	2865.2818	K	N	35	61
PSM	SKSQDADSPGSSGAPENLTFK	185	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:21	ms_run[2]:scan=11925	55.86	2	2201.9478	2201.9478	R	E	1772	1793
PSM	SVEHVSPDTADAESGK	186	sp|Q8TDY2-2|RBCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:21	ms_run[2]:scan=4694	24.149	2	1707.6989	1707.6989	K	E	261	277
PSM	TDKTDEPVPGASSATAALSPQEK	187	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	19-UNIMOD:21	ms_run[2]:scan=11535	54.181	2	2379.0843	2379.0843	K	R	415	438
PSM	THSDASDDEAFTTSK	188	sp|Q13017-2|RHG05_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21	ms_run[2]:scan=4404	22.919	2	1690.636	1690.6360	R	T	1171	1186
PSM	TPDTNHTPVALYPDSDLEK	189	sp|Q15653-2|IKBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:21	ms_run[2]:scan=14569	68.263	2	2191.9675	2191.9675	R	E	169	188
PSM	VFAQNEEIQEMAQNK	190	sp|Q8TD06|AGR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=8949	42.632	2	1793.8254	1793.8254	K	F	80	95
PSM	VGEGFEEETVDGR	191	sp|P29762|RABP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10737	50.614	2	1422.6263	1422.6263	K	K	68	81
PSM	VTQHESDNENEIQIQNK	192	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:21	ms_run[2]:scan=6301	31.006	2	2104.9063	2104.9063	R	L	117	134
PSM	YGLQDSDEEEEEHPSK	193	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:21	ms_run[2]:scan=6822	33.301	2	1970.7419	1970.7419	K	T	866	882
PSM	CSSPVDTECSHAEGSR	194	sp|O75170|PP6R2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=6340	31.164526666666667	2	1840.6364	1840.6388	R	S	769	785
PSM	QPSPSHDGSLSPLQDR	195	sp|Q96A00|PP14A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=13238	61.856231666666666	2	1782.7528	1782.7569	R	A	126	142
PSM	APSTSPSFEGTQETYTVAHEENVR	196	sp|Q9BUT9|MCRI2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:21	ms_run[2]:scan=14626	68.538	3	2716.1654	2716.1654	R	F	76	100
PSM	CLCYDGFMASEDMK	197	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:4,3-UNIMOD:4,8-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=13620	63.672	2	1757.6405	1757.6405	R	T	1263	1277
PSM	CTLPEHESPSQDISDACEAESTER	198	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:4,10-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14386	67.35	3	2827.095	2827.0950	R	C	670	694
PSM	DLDEDELLGNLSETELK	199	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=22181	117.98	2	1931.9211	1931.9211	K	Q	14	31
PSM	DYSTLTSVSSHDSR	200	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=10799	50.884	2	1633.6621	1633.6621	R	L	1439	1453
PSM	EAGAGGLAIAVEGPSK	201	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=13749	64.331	2	1425.7464	1425.7464	R	A	2257	2273
PSM	FGYVDFESAEDLEK	202	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=20256	102.19	2	1647.7304	1647.7304	K	A	349	363
PSM	GGVTGSPEASISGSKGDLK	203	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	12-UNIMOD:21	ms_run[2]:scan=9579	45.401	2	1825.8459	1825.8459	K	S	5726	5745
PSM	GKAESSEDETSSPAPSK	204	sp|Q96NA2-2|RILP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:21	ms_run[2]:scan=798	6.6625	2	1785.7306	1785.7306	R	L	140	157
PSM	GPSSEGPEEEDGEGFSFK	205	sp|P84157-2|MXRA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=13866	64.858	2	1883.7697	1883.7697	K	Y	125	143
PSM	GVVDSDDLPLNVSR	206	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=16311	77.087	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	207	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=16483	78.163	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	208	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=17205	82.21	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	209	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=17374	83.221	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	210	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=17567	84.292	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	211	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=18076	87.322	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	212	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=18241	88.334	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	213	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=18404	89.345	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	214	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=18717	91.368	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	215	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=18869	92.379	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	216	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=19030	93.386	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	217	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=19469	96.43	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	218	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=19810	98.832	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	219	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=19942	99.842	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	220	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=21092	108.92	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	221	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=21215	109.92	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	222	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=21582	112.94	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	223	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=21704	113.95	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	224	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=22061	116.99	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	225	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=22301	119	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	226	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=22883	124.04	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	227	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=22998	125.04	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	228	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=23112	126.05	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	229	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=24034	134.29	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	230	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=24382	137.4	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	231	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=25886	151.08	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	232	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=23452	129.09	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSEDLPLNISR	233	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=18022	86.96	2	1512.7784	1512.7784	R	E	387	401
PSM	IEEIKTPDSFEESQGEEIGK	234	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=15226	71.528	3	2344.0359	2344.0359	R	V	1123	1143
PSM	IEEVLSPEGSPSKSPSK	235	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	14-UNIMOD:21	ms_run[2]:scan=9147	43.549	2	1849.871	1849.8710	K	K	636	653
PSM	IMVDMLDSDGSGK	236	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8001	38.507	2	1398.6007	1398.6007	K	L	501	514
PSM	KAASTDLGAGETVVGK	237	sp|Q15032-2|R3HD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:21	ms_run[2]:scan=8923	42.506	2	1582.7604	1582.7604	K	V	842	858
PSM	KGSITEYTAAEEK	238	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=7346	35.519	2	1505.6651	1505.6651	R	E	112	125
PSM	KSTAALEEDAQILK	239	sp|Q15052-2|ARHG6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:21	ms_run[2]:scan=14803	69.428	2	1595.7808	1595.7808	R	V	494	508
PSM	KSTGDSQNLGSSSPSK	240	sp|O60861-1|GAS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:21	ms_run[2]:scan=969	7.4218	2	1658.7149	1658.7149	R	K	87	103
PSM	LESIDNHSSTGGQSDQGYGSK	241	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=5892	29.2	2	2245.9125	2245.9125	R	D	951	972
PSM	LQQEATEHATESEER	242	sp|Q9Y6C2|EMIL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	12-UNIMOD:21	ms_run[2]:scan=2131	12.613	2	1836.7527	1836.7527	R	F	692	707
PSM	LSKSNIDISSGLEDEEPK	243	sp|Q9BZ71-3|PITM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:21	ms_run[2]:scan=15586	73.326	2	2039.93	2039.9300	R	R	282	300
PSM	LSSQEAASSFGDDR	244	sp|P05165-3|PCCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8835	42.148	2	1468.643	1468.6430	R	L	244	258
PSM	LTLSEGHPETPVDGDLGK	245	sp|Q8WUY3-4|PRUN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:21	ms_run[2]:scan=13235	61.845	2	1943.8878	1943.8878	K	Q	2322	2340
PSM	MLENTDNSSPSTEHSQGLEK	246	sp|Q96H79|ZCCHL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=4632	23.876	2	2298.9312	2298.9312	K	Q	249	269
PSM	NGVAAEVSPAKEENPR	247	sp|Q9BW71|HIRP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:21	ms_run[2]:scan=5924	29.333	2	1746.7938	1746.7938	K	R	118	134
PSM	NLTSSSLNDISDKPEK	248	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:21	ms_run[2]:scan=12936	60.476	2	1826.8299	1826.8299	R	D	252	268
PSM	NSLQDQLDEEMEAK	249	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:35	ms_run[2]:scan=11555	54.262	2	1664.7199	1664.7199	R	Q	1346	1360
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	250	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	18-UNIMOD:21	ms_run[2]:scan=5345	26.812	3	3336.3553	3336.3553	R	R	157	186
PSM	PASVSENHDAGPDGDK	251	sp|Q9H4G0|E41L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=1034	7.6916	2	1674.6523	1674.6523	R	R	439	455
PSM	QVAGDAPVEQATAETASPVHR	252	sp|Q92766-4|RREB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:21	ms_run[2]:scan=10039	47.561	2	2213.0114	2213.0114	R	E	95	116
PSM	RVSVCAETYNPDEEEEDTDPR	253	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11734	55.031	3	2590.0167	2590.0167	R	V	97	118
PSM	SAEIDSDDTGGSAAQK	254	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1823	11.143	2	1550.6696	1550.6696	K	Q	814	830
PSM	SASATSLTLSHCVDVVK	255	sp|Q8NAA4-2|A16L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=15873	74.792	2	1853.8594	1853.8594	R	G	170	187
PSM	SLEPAENVHGAGGGAFPASQTPSK	256	sp|P12931|SRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:21	ms_run[2]:scan=12263	57.388	2	2388.0747	2388.0747	R	P	17	41
PSM	SLIGVEYKPVSATGAEDK	257	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:21	ms_run[2]:scan=15076	70.799	2	1942.9289	1942.9289	K	D	944	962
PSM	SPSDVSASESPQHDVVDLGSTAPLK	258	sp|Q8N9M5|TM102_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:21	ms_run[2]:scan=16985	80.916	3	2602.18	2602.1800	K	T	209	234
PSM	SQSESSDEVTELDLSHGK	259	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=11888	55.707	2	2026.8368	2026.8368	R	K	657	675
PSM	SQSSHSYDDSTLPLIDR	260	sp|O60716-32|CTND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=15785	74.342	2	1999.8524	1999.8524	R	N	530	547
PSM	SRSESDLSQPESDEEGYALSGR	261	sp|Q15751|HERC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=12860	60.127	3	2478.0184	2478.0184	K	R	1510	1532
PSM	SSSLGSTPHEELER	262	sp|Q9NRA8-2|4ET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=7937	38.227	2	1607.6828	1607.6828	R	L	188	202
PSM	STGKYSLATEEIER	263	sp|Q66K14-2|TBC9B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=12465	58.293	2	1662.7502	1662.7502	K	D	542	556
PSM	SVTEQGAELSNEER	264	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6609	32.342	2	1547.7063	1547.7063	K	N	28	42
PSM	TGSQEGTSMEGSRPAAPAEPGTLK	265	sp|Q8IV36-3|HID1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=7776	37.567	2	2454.0734	2454.0734	R	T	363	387
PSM	TIGGGDDSFNTFFSETGAGK	266	sp|Q71U36-2|TBA1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=20857	106.99	2	2006.8858	2006.8858	K	H	6	26
PSM	TNSDSALHTSALSTK	267	sp|Q6UUV7-3|CRTC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=7166	34.732	2	1611.7141	1611.7141	R	P	160	175
PSM	TSGPLSPPTGPPGPAPAGPAVR	268	sp|P49815-7|TSC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=15207	71.44	2	2060.0092	2060.0092	K	L	610	632
PSM	VGDAIPAVEVFEGEPGNK	269	sp|P30044-2|PRDX5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=20102	100.98	2	1826.905	1826.9050	K	V	6	24
PSM	VLQATVVAVGSGSK	270	sp|P61604|CH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10852	51.097	2	1314.7507	1314.7507	K	G	41	55
PSM	VNQIGSVTESLQACK	271	sp|P06733|ENOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	14-UNIMOD:4	ms_run[2]:scan=14450	67.667	2	1632.8141	1632.8141	K	L	344	359
PSM	VVESPDFSKDEDYLGK	272	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:21	ms_run[2]:scan=15367	72.215	2	1906.8238	1906.8238	K	V	923	939
PSM	YLTESYGTGQDIDDR	273	sp|Q9UM54-5|MYO6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11679	54.788	2	1731.7588	1731.7588	R	I	167	182
PSM	YNLDASEEEDSNKK	274	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=5719	28.365	2	1720.6829	1720.6829	K	K	183	197
PSM	AEEKENDTVTISPK	275	sp|Q9UGU0-2|TCF20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:21	ms_run[2]:scan=5446	27.255	2	1639.7342	1639.7342	K	Q	1511	1525
PSM	AELVLIDEDDEKSLR	276	sp|Q8IXS6|PALM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:21	ms_run[2]:scan=17319	82.872	2	1823.8554	1823.8554	K	E	306	321
PSM	AKSEELAALSSQQPEK	277	sp|Q13506|NAB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=10322	48.785	2	1794.8401	1794.8401	R	V	354	370
PSM	AQTLPTSVVTITSESSPGKR	278	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:21	ms_run[2]:scan=15869	74.777	2	2138.062	2138.0620	R	E	2326	2346
PSM	DEVQEVVFVPAGTHTPGSR	279	sp|Q96FV2-2|SCRN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	15-UNIMOD:21	ms_run[2]:scan=16221	76.64	2	2103.9626	2103.9626	R	L	38	57
PSM	DKYEPAAVSEQGDK	280	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=4909	25.055	2	1615.6767	1615.6767	R	K	8	22
PSM	DQEKPYFSSFDSGASTNR	281	sp|O15504-2|NUPL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=14362	67.237	3	2114.8582	2114.8582	R	K	74	92
PSM	DSAEGNDSYPSGIHLELQR	282	sp|P50443|S26A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:21	ms_run[2]:scan=16976	80.869	2	2166.9219	2166.9219	R	E	15	34
PSM	DSGRGDSVSDSGSDALR	283	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=4535	23.51	2	1759.701	1759.7010	R	S	59	76
PSM	DTDDVPMILVGNK	284	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:35	ms_run[2]:scan=16249	76.78	2	1431.6915	1431.6915	K	C	86	99
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	285	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:21	ms_run[2]:scan=9059	43.129	3	3001.2673	3001.2673	R	E	120	150
PSM	ELDEATESNEAMGR	286	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:35	ms_run[2]:scan=3987	21.054	2	1566.6468	1566.6468	R	E	1906	1920
PSM	ELDQDMVTEDEDDPGSHK	287	sp|Q9NRL2-2|BAZ1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=6399	31.415	2	2154.7937	2154.7937	K	R	692	710
PSM	FEGLEADADDSNTR	288	sp|Q86VI3|IQGA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9966	47.246	2	1538.6485	1538.6485	K	S	1350	1364
PSM	FNAVLTNPQGDYDTSTGK	289	sp|P02747|C1QC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=14317	67.036	2	1926.8959	1926.8959	R	F	140	158
PSM	FNTANDDNVTQVR	290	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8081	38.847	2	1492.6906	1492.6906	R	A	432	445
PSM	GECQAEGVLFFQGDR	291	sp|P02790|HEMO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:4	ms_run[2]:scan=19028	93.375	2	1711.7624	1711.7624	R	E	152	167
PSM	GSSQPNLSTSHSEQEYGK	292	sp|O95208-3|EPN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:21	ms_run[2]:scan=5597	27.868	2	2014.8269	2014.8269	R	A	132	150
PSM	GVGDDQLGEESEER	293	sp|P20645|MPRD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6521	31.95	2	1518.6434	1518.6434	R	D	257	271
PSM	GVVDSDDLPLNVSR	294	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=14834	69.586	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	295	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=21336	110.93	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	296	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=22183	117.99	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	297	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=22651	122.01	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	298	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=24612	139.45	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	299	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=26147	153.1	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	300	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=22768	123.02	2	1484.7471	1484.7471	K	E	435	449
PSM	IINEPTAAAIAYGLDK	301	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=19623	97.518	2	1658.8879	1658.8879	R	K	172	188
PSM	ILDQGEDFPASEMTR	302	sp|P30040|ERP29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:35	ms_run[2]:scan=12597	58.873	2	1723.7723	1723.7723	K	I	209	224
PSM	INDDLISEFPDK	303	sp|Q15700-5|DLG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=18352	88.998	2	1404.6773	1404.6773	R	F	157	169
PSM	KDSISEDEMVLR	304	sp|Q8N5D0-5|WDTC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=10615	50.077	2	1516.648	1516.6480	R	E	508	520
PSM	KESAPQVLLPEEEK	305	sp|Q14155-1|ARHG7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=13154	61.475	2	1675.807	1675.8070	R	I	558	572
PSM	KSSPSTGSLDSGNESK	306	sp|Q15057|ACAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=1382	9.1641	2	1659.6989	1659.6989	K	E	377	393
PSM	KTLDELSQGTTTVK	307	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:21	ms_run[2]:scan=9178	43.682	2	1599.7757	1599.7757	R	E	1542	1556
PSM	LENVSQLSLDKSPTEK	308	sp|Q86W56-3|PARG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:21	ms_run[2]:scan=13167	61.529	2	1866.8976	1866.8976	K	S	18	34
PSM	LIDSSGSASVLTHSSSGNSLK	309	sp|Q96SU4-5|OSBL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	16-UNIMOD:21	ms_run[2]:scan=12935	60.473	2	2125.9893	2125.9893	R	R	133	154
PSM	LKSEDGVEGDLGETQSR	310	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=8565	40.982	2	1898.8259	1898.8259	R	T	133	150
PSM	LLDPEDISVDHPDEK	311	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:21	ms_run[2]:scan=15382	72.292	2	1800.7819	1800.7819	K	S	250	265
PSM	LPNLSSPSAEGPPGPPSGPAPR	312	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:21	ms_run[2]:scan=15023	70.544	2	2161.0205	2161.0205	R	K	412	434
PSM	LQSPIKEENTTAVEEIGR	313	sp|Q9NS73-3|MBIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=14026	65.617	3	2093.0042	2093.0042	K	T	89	107
PSM	LSSPPGKPEDSSSVDGQSVGTPVGPETGGEK	314	sp|Q3T8J9-2|GON4L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:21	ms_run[2]:scan=11827	55.442	3	3061.3765	3061.3765	R	N	1424	1455
PSM	LTLSEGHPETPVDGDLGK	315	sp|Q8WUY3-4|PRUN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:21	ms_run[2]:scan=13284	62.079	2	1943.8878	1943.8878	K	Q	2322	2340
PSM	NEEENIYSVPHDSTQGK	316	sp|Q9NRY4|RHG35_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:21	ms_run[2]:scan=7658	37.053	2	2025.8317	2025.8317	R	I	1099	1116
PSM	NLTSSSLNDISDKPEK	317	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21	ms_run[2]:scan=10641	50.185	2	1826.8299	1826.8299	R	D	252	268
PSM	PFPSEETTENDDDVYR	318	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12350	57.76	2	1912.7963	1912.7963	R	S	128	144
PSM	PTSNPQVVNEGGAKPELASQATEGSK	319	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	19-UNIMOD:21	ms_run[2]:scan=10295	48.663	3	2675.244	2675.2440	K	S	321	347
PSM	RASVCAEAYNPDEEEDDAESR	320	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10007	47.428	3	2491.9435	2491.9435	R	I	112	133
PSM	RSEDLDNATEVNPK	321	sp|O95171-3|SCEL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:21	ms_run[2]:scan=6384	31.354	2	1666.72	1666.7200	R	G	324	338
PSM	SASQSSLDKLDQELK	322	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21	ms_run[2]:scan=16170	76.38	2	1727.7979	1727.7979	R	E	714	729
PSM	SAYQEYDSDSDVPEELKR	323	sp|Q96JG6-3|VPS50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:21	ms_run[2]:scan=14107	66.023	2	2209.9053	2209.9053	K	D	522	540
PSM	SEEETSPLVTHQNPAGPVASAPELESK	324	sp|P43007-2|SATT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:21	ms_run[2]:scan=15180	71.313	3	2883.3175	2883.3175	K	E	204	231
PSM	SHSSSSSSEENSSSSAAQPLLAGEK	325	sp|Q2LD37-2|K1109_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21	ms_run[2]:scan=9426	44.73	3	2543.0661	2543.0661	R	E	1225	1250
PSM	SLSKSDSDLLTCSPTEDATMGSR	326	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=14454	67.692	3	2553.0612	2553.0612	R	S	622	645
PSM	SPSGPVKSPPLSPVGTTPVK	327	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=12927	60.435	2	2091.0054	2091.0054	K	L	178	198
PSM	SSEDLAGPLPSSVSSSSTTSSKPK	328	sp|Q9NRF2-2|SH2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21	ms_run[2]:scan=12355	57.788	2	2415.1054	2415.1054	R	L	125	149
PSM	STPSHGSVSSLNSTGSLSPK	329	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21	ms_run[2]:scan=9973	47.278	2	2008.9103	2008.9103	R	H	238	258
PSM	STSTPNVHMVSTTLPVDSR	330	sp|P04049|RAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=13011	60.798	2	2123.9558	2123.9558	R	M	257	276
PSM	SVELDLNQAHMEETPK	331	sp|Q14680-3|MELK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=12303	57.566	2	1935.8285	1935.8285	R	R	311	327
PSM	TAAAVAAQSGILDR	332	sp|Q9Y6N5|SQOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12055	56.451	2	1342.7205	1342.7205	K	T	345	359
PSM	THSLSNADGQYDPYTDSR	333	sp|Q8IVL1-5|NAV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=10426	49.249	2	2105.8328	2105.8328	R	F	630	648
PSM	TKPSTVEVLESIDK	334	sp|Q9C0E8-2|LNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:21	ms_run[2]:scan=16306	77.065	2	1624.7961	1624.7961	K	E	5	19
PSM	TQEISRPNSPSEGEGESSDSR	335	sp|Q9P2R6-2|RERE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=4033	21.255	2	2327.9503	2327.9503	K	S	117	138
PSM	TSSKESSPIPSPTSDR	336	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21	ms_run[2]:scan=6987	33.973	2	1754.7724	1754.7724	R	K	2159	2175
PSM	TTKTPEDGDYSYEIIEK	337	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21	ms_run[2]:scan=14297	66.952	3	2067.8926	2067.8926	K	T	1929	1946
PSM	VALSDDETKETENMR	338	sp|Q15054-3|DPOD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=5654	28.092	2	1832.7499	1832.7499	R	K	198	213
PSM	VIPEDASESEEKLDQK	339	sp|Q9H2P0|ADNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:21	ms_run[2]:scan=9987	47.338	2	1895.8401	1895.8401	K	E	915	931
PSM	VNFSEEGETEEDDQDSSHSSVTTVK	340	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=10785	50.83	3	2835.1244	2835.1244	K	A	213	238
PSM	VNSNSLDLPSSSDTTHASK	341	sp|Q8NEY1-5|NAV1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:21	ms_run[2]:scan=9402	44.634	2	2038.8845	2038.8845	K	V	413	432
PSM	VSEDEEKLPASPK	342	sp|Q7RTP6|MICA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:21	ms_run[2]:scan=5987	29.599	2	1507.6807	1507.6807	R	H	1133	1146
PSM	VTAQGPGLEPSGNIANK	343	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9454	44.853	2	1651.8529	1651.8529	K	T	384	401
PSM	GVVDSDDLPLNVSR	344	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=26017	152.08735666666666	2	1485.749715	1484.747087	K	E	435	449
PSM	GVVDSDDLPLNVSR	345	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=23678	131.11354166666666	2	1484.746773	1484.747087	K	E	435	449
PSM	TTKTPEDGDYSYEIIEK	346	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	4-UNIMOD:21	ms_run[1]:scan=14313	67.02083	2	2068.908532	2067.892564	K	T	1929	1946
PSM	VQVAALQASPPLDQDDR	347	sp|Q9UDY2|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=15333	72.05422666666668	2	1821.920820	1821.922091	K	A	122	139
PSM	QKSDHGAYSQSPAIK	348	sp|Q9Y4B6|DCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5012	25.458348333333333	2	1678.7345	1678.7347	R	K	977	992
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	349	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	10-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=11359	53.39816999999999	3	3047.238188	3045.258042	R	V	320	347
PSM	QQSIAGSADSKPIDVSR	350	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=11554	54.25797166666667	2	1820.8297	1820.8300	K	L	138	155
PSM	QHSGDHENLMNVPSDK	351	sp|Q9NWQ8|PHAG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28,3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=5490	27.424609999999998	2	1885.7278	1885.7297	R	E	48	64
PSM	QPASAQSTPSTTPHSSPK	352	sp|Q96A73|P33MX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=3579	19.26926	2	1870.8078	1870.8093	R	Q	168	186
PSM	KGSITEYTAAEEK	353	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	3-UNIMOD:21	ms_run[1]:scan=8067	38.785848333333334	2	1507.665591	1505.665071	R	E	112	125
PSM	TGGADQSLQQGEGSKK	354	sp|P09132|SRP19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	14-UNIMOD:21	ms_run[1]:scan=1132	8.091073333333334	2	1669.729369	1669.730859	K	G	122	138
PSM	AHTSSTQLQEELEK	355	sp|Q9Y6Y8|S23IP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=10790	50.848	2	1679.7404	1679.7404	R	V	891	905
PSM	ASLEAAIADAEQR	356	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=17505	83.956	2	1343.6681	1343.6681	R	G	329	342
PSM	ASSLNENVDHSALLK	357	sp|Q96SB3|NEB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:21	ms_run[2]:scan=12244	57.304	2	1676.7771	1676.7771	R	L	98	113
PSM	DKDSPETEENPAPEPR	358	sp|Q14CZ8|HECAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=3918	20.738	2	1889.768	1889.7680	K	S	315	331
PSM	DLDDIEDENEQLK	359	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13911	65.08	2	1574.6948	1574.6948	R	Q	313	326
PSM	DSDDVPMVLVGNK	360	sp|P01112-2|RASH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=13525	63.228	2	1403.6602	1403.6602	K	C	105	118
PSM	DVPPDILLDSPERK	361	sp|Q6KC79-2|NIPBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:21	ms_run[2]:scan=16846	80.166	2	1672.8073	1672.8073	R	Q	309	323
PSM	DVTTPGHSTPVPDGK	362	sp|Q71F56|MD13L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:21	ms_run[2]:scan=4189	21.952	2	1586.6978	1586.6978	K	N	755	770
PSM	EARESPDTQALLTCAEK	363	sp|Q2T9K0-2|TMM44_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13630	63.729	2	1997.8765	1997.8765	K	E	282	299
PSM	EDILENEDEQNSPPKK	364	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=7884	37.996	2	1963.8412	1963.8412	K	G	1272	1288
PSM	EDSDEVHLEELSLSK	365	sp|P33241-2|LSP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:21	ms_run[2]:scan=16840	80.135	2	1808.7717	1808.7717	K	E	66	81
PSM	ELDVEEAHAASTEEK	366	sp|Q96C86|DCPS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:21	ms_run[2]:scan=7475	36.235	2	1736.7142	1736.7142	R	E	14	29
PSM	EPQTTVVHNATDGIK	367	sp|Q13555-10|KCC2G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=10357	48.935	2	1688.7771	1688.7771	K	G	331	346
PSM	ETNLDSLPLVDTHSK	368	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=16418	77.748	2	1747.803	1747.8030	R	R	425	440
PSM	FEDGVLDPDYPR	369	sp|P04004|VTNC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=16196	76.512	2	1421.6463	1421.6463	R	N	230	242
PSM	GASSAGEASEKEPLK	370	sp|O00192-2|ARVC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=3921	20.755	2	1539.6818	1539.6818	R	L	850	865
PSM	GDSQPSTVVQPLSHPSR	371	sp|P27216-2|ANX13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	16-UNIMOD:21	ms_run[2]:scan=9345	44.396	2	1870.8575	1870.8575	K	N	21	38
PSM	GGPVQVLEDEELK	372	sp|Q13228-2|SBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=17978	86.691	2	1411.7195	1411.7195	K	S	294	307
PSM	GKSESQMDITDINTPK	373	sp|P08473|NEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=8773	41.885	2	1858.802	1858.8020	M	P	2	18
PSM	GKSSPICSTTGDDK	374	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=1175	8.2657	2	1531.6226	1531.6226	K	L	647	661
PSM	GLAITFVSDENDAK	375	sp|O00148|DX39A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=17313	82.839	2	1478.7253	1478.7253	K	I	384	398
PSM	GNAEGSSDEEGKLVIDEPAK	376	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:21	ms_run[2]:scan=11542	54.211	2	2123.926	2123.9260	K	E	120	140
PSM	GPVEGYEENEEFLR	377	sp|Q9UI30-2|TR112_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=16030	75.629	2	1666.7475	1666.7475	K	T	64	78
PSM	GVGIISEGNETVEDIAAR	378	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=19255	94.888	2	1828.9167	1828.9167	K	L	630	648
PSM	GVVDSDDLPLNVSR	379	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=16971	80.843	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	380	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=23224	127.06	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	381	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=24261	136.33	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	382	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=23339	128.09	2	1484.7471	1484.7471	K	E	435	449
PSM	IAQLEEQVEQEAR	383	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13927	65.152	2	1541.7686	1541.7686	K	E	1823	1836
PSM	IHVSDQELQSANASVDDSR	384	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=12608	58.924	3	2149.9277	2149.9277	K	L	767	786
PSM	IMVDMLDSDGSGK	385	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8241	39.549	2	1398.6007	1398.6007	K	L	501	514
PSM	IQALQQQADEAEDR	386	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8725	41.668	2	1613.7645	1613.7645	K	A	14	28
PSM	KAALSASEGEEVPQDK	387	sp|O95831-6|AIFM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21	ms_run[2]:scan=7157	34.698	2	1737.7822	1737.7822	K	A	25	41
PSM	KCSLPAEEDSVLEK	388	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10661	50.276	2	1683.7427	1683.7427	K	L	634	648
PSM	KCSLPAEEDSVLEK	389	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=12406	58.034	2	1683.7427	1683.7427	K	L	634	648
PSM	KDSSSEVFSDAAK	390	sp|Q5T5U3|RHG21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=6795	33.192	2	1449.6025	1449.6025	R	E	921	934
PSM	KGGSYSQAASSDSAQGSDVSLTACK	391	sp|Q09160|1A80_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:21,20-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=8198	39.341	3	2621.0354	2621.0354	R	V	340	365
PSM	KGTVEGFEPADNK	392	sp|P37108|SRP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=7052	34.256	2	1470.6392	1470.6392	K	C	43	56
PSM	KLSSSDAPAQDTGSSAAAVETDASR	393	sp|Q7Z4S6-2|KI21A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=10232	48.404	3	2501.0919	2501.0919	R	T	838	863
PSM	KTSGLSSSPSTPTQVTK	394	sp|Q9UGJ0-3|AAKG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=5698	28.271	2	1784.8557	1784.8557	R	Q	111	128
PSM	LEEKSEDQDLQGLK	395	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21	ms_run[2]:scan=9925	47.052	2	1710.7713	1710.7713	R	D	21	35
PSM	LGIYDADGDGDFDVDDAK	396	sp|Q12797-7|ASPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=18120	87.572	2	1899.801	1899.8010	K	V	102	120
PSM	LINDCHGSVSEASSEQK	397	sp|P50851-2|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=4881	24.939	2	1939.7983	1939.7983	K	I	1224	1241
PSM	LMGIKSEDEAGCSSVDEESYK	398	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35,6-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=10800	50.888	3	2428.9652	2428.9652	K	T	371	392
PSM	LQSPIKEENTTAVEEIGR	399	sp|Q9NS73-3|MBIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=14059	65.783	2	2093.0042	2093.0042	K	T	89	107
PSM	LSKSDEQLSSLDR	400	sp|Q13905-2|RPGF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=10219	48.348	2	1556.7083	1556.7083	K	D	318	331
PSM	LSLEGDHSTPPSAYGSVK	401	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:21	ms_run[2]:scan=13332	62.289	2	1923.8615	1923.8615	K	A	11	29
PSM	LSLQGHPTDLQTSNVK	402	sp|Q9P270|SLAI2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:21	ms_run[2]:scan=12442	58.197	2	1816.872	1816.8720	R	N	390	406
PSM	MADFESGSIKNEEETK	403	sp|Q63HK5|TSH3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=7694	37.207	2	1909.7653	1909.7653	R	E	85	101
PSM	MAPYQGPDAVPGALDYK	404	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35	ms_run[2]:scan=15784	74.339	2	1807.8451	1807.8451	R	S	883	900
PSM	NLVVGDETTSSLR	405	sp|Q05707-2|COEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12266	57.403	2	1389.71	1389.7100	R	V	740	753
PSM	NQLTSNPENTVFDAK	406	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=14284	66.884	2	1676.8006	1676.8006	K	R	82	97
PSM	NVATEGTSTQKEFEVK	407	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:21	ms_run[2]:scan=8901	42.413	2	1846.835	1846.8350	K	D	106	122
PSM	PSVPSADSETPLTQDRPGSPSGSEDK	408	sp|Q96FS4|SIPA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	19-UNIMOD:21	ms_run[2]:scan=11747	55.087	2	2720.1814	2720.1814	K	G	866	892
PSM	QEEIDESDDDLDDKPSPIK	409	sp|Q9ULH1|ASAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:21	ms_run[2]:scan=12304	57.57	2	2266.9366	2266.9366	R	K	711	730
PSM	RASVCAEAYNPDEEEDDAESR	410	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9262	44.06	3	2491.9435	2491.9435	R	I	112	133
PSM	RSPTDSDVSLDSEDSGAK	411	sp|Q8N3V7-2|SYNPO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:21	ms_run[2]:scan=6369	31.291	2	1944.795	1944.7950	R	S	853	871
PSM	SASTEKLEQGTSALIR	412	sp|Q8IWC1-2|MA7D3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=15081	70.822	2	1769.8561	1769.8561	R	Q	183	199
PSM	SGSSQELDVKPSASPQER	413	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=7420	35.934	2	1980.879	1980.8790	R	S	1539	1557
PSM	SKSDATASISLSSNLK	414	sp|Q9UBF8-2|PI4KB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21	ms_run[2]:scan=12579	58.792	2	1687.803	1687.8030	R	R	275	291
PSM	SLDGASVNENHEIYMK	415	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=10201	48.273	2	1901.7867	1901.7867	R	D	443	459
PSM	SLSSSLDDTEVKK	416	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=10529	49.679	2	1487.6756	1487.6756	K	V	156	169
PSM	SNGHASTDQLSEEK	417	sp|P51159-2|RB27A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21	ms_run[2]:scan=1741	10.792	2	1581.6308	1581.6308	R	E	193	207
PSM	SNSQENVEASHPSQDGK	418	sp|Q02410-2|APBA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21	ms_run[2]:scan=1016	7.6181	2	1892.7538	1892.7538	R	R	555	572
PSM	SQSESSDEVTELDLSHGK	419	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=12373	57.869	2	2026.8368	2026.8368	R	K	657	675
PSM	SSGEIVYCGQVFEKSPLR	420	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=17265	82.527	2	2134.9759	2134.9759	K	V	57	75
PSM	SSSLGSTPHEELER	421	sp|Q9NRA8-2|4ET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:21	ms_run[2]:scan=7296	35.309	2	1607.6828	1607.6828	R	L	188	202
PSM	SSSMSSIDLVSASDDVHR	422	sp|Q9Y5P4|C43BP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=13547	63.326	3	1987.8194	1987.8194	R	F	375	393
PSM	TCVADESAENCDK	423	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1604	10.199	2	1497.5712	1497.5712	K	S	76	89
PSM	TDEEAEGPYSDNEMLTHK	424	sp|Q6NUK4|REEP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=7750	37.44	2	2160.8195	2160.8195	K	G	201	219
PSM	TEEGEIDYSAEEGENRR	425	sp|Q8WVV9-3|HNRLL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:21	ms_run[2]:scan=8187	39.295	2	2062.8117	2062.8117	K	E	22	39
PSM	TGNESGSNLSDSGSVKR	426	sp|Q9UDT6-2|CLIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:21	ms_run[2]:scan=1729	10.74	2	1773.753	1773.7531	K	G	198	215
PSM	TKGDSDEEVIQDGVR	427	sp|Q9BUE6|ISCA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21	ms_run[2]:scan=9311	44.255	2	1726.7411	1726.7411	K	V	69	84
PSM	TKSPTDDEVTPSAVVR	428	sp|Q9Y2H5|PKHA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=9300	44.211	2	1780.8244	1780.8244	R	R	775	791
PSM	TPAFAESVTEGDVR	429	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13737	64.272	2	1477.7049	1477.7049	K	W	75	89
PSM	TSSGTSLSAMHSSGSSGK	430	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=880	7.034	2	1763.7033	1763.7033	R	G	1315	1333
PSM	VANPSGNLTETYVQDR	431	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12542	58.634	2	1762.8486	1762.8486	R	G	1297	1313
PSM	VASGSDLHLTDIDSDSNR	432	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=14344	67.158	3	1980.8426	1980.8426	K	G	70	88
PSM	VAYEGSDSEKGEGAEPLK	433	sp|P78549-3|NTH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21	ms_run[2]:scan=7471	36.21	2	1944.8354	1944.8354	R	V	51	69
PSM	VFAQNEEIQEMAQNK	434	sp|Q8TD06|AGR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=9171	43.651	2	1793.8254	1793.8254	K	F	80	95
PSM	VMSSSNPDLAGTHSAADEEVK	435	sp|Q8NF50-4|DOCK8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=7696	37.215	2	2239.9304	2239.9304	R	N	832	853
PSM	VNVDEVGGEALGR	436	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13039	60.929	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	437	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13971	65.357	2	1313.6575	1313.6575	K	L	19	32
PSM	VQTTPKVEEEQDLK	438	sp|Q8N3X1|FNBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=7521	36.451	2	1722.8077	1722.8077	K	F	514	528
PSM	VVDALGNAIDGK	439	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12570	58.754	2	1170.6245	1170.6245	R	G	150	162
PSM	YEDEECTLPIAGR	440	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=12825	59.98	2	1551.6875	1551.6875	R	H	962	975
PSM	YESGPDGGEEDGTGSLKR	441	sp|Q07866-6|KLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	15-UNIMOD:21	ms_run[2]:scan=4641	23.914	2	1932.7738	1932.7738	K	S	532	550
PSM	YLQEIYNSNNQK	442	sp|P02679-2|FIBG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9984	47.322	2	1512.7209	1512.7209	R	I	135	147
PSM	TLTIVDTGIGMTK	443	sp|Q58FG1|HS904_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:35	ms_run[1]:scan=15877	74.810935	2	1364.722150	1364.722118	R	A	28	41
PSM	ILDSVGIEADDDR	444	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=12919	60.39765833333334	2	1416.670079	1416.673253	K	L	26	39
PSM	ILDSVGIEADDDR	445	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=12915	60.37923166666666	2	1416.670079	1416.673253	K	L	26	39
PSM	LQAALDDEEAGGRPAMEPGNGSLDLGGDSAGR	446	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	16-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=15793	74.39012	3	3222.373934	3221.393230	R	S	38	70
PSM	LSSERPSSDGEGVVENGITTCNGK	447	sp|Q8N556|AFAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:21,21-UNIMOD:4	ms_run[1]:scan=10437	49.29490833333333	3	2573.094007	2572.111241	K	E	276	300
PSM	QLVYEADGCSPHGTLK	448	sp|Q5JU85|IQEC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28,9-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=15554	73.18068833333334	2	1836.7728	1836.7748	R	H	618	634
PSM	EIQNGNLHESDSESVPR	449	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	10-UNIMOD:21	ms_run[1]:scan=8375	40.14209	2	1990.827868	1989.842928	K	D	66	83
PSM	GNSRPGTPSAEGGSTSSTLR	450	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	3-UNIMOD:21	ms_run[1]:scan=5282	26.536268333333336	3	1998.864072	1997.880377	R	A	383	403
PSM	ADGATSDDLDLHDDR	451	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=8195	39.331	2	1694.6421	1694.6421	K	L	805	820
PSM	ADLINNLGTIAK	452	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17823	85.783	2	1241.698	1241.6980	K	S	101	113
PSM	AEEEHLSSSGGLAK	453	sp|Q52LW3-2|RHG29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=5133	25.921	2	1493.6399	1493.6399	R	N	349	363
PSM	AGPESDAQYQFTGIK	454	sp|Q96IX5|USMG5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=14614	68.483	2	1610.7577	1610.7577	M	K	2	17
PSM	AGQSAAGAAPGGGVDTR	455	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2439	14.092	2	1441.691	1441.6910	R	D	8	25
PSM	AGTQIENIDEDFR	456	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=16231	76.688	2	1506.6951	1506.6951	K	D	67	80
PSM	ALDIYSAVDDASHEK	457	sp|Q16568|CART_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=15303	71.898	2	1712.7295	1712.7295	R	E	37	52
PSM	ALDSNSLENDDLSAPGR	458	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=13222	61.784	2	1772.8177	1772.8177	K	E	707	724
PSM	APSEEELHGDQTDFGQGSQSPQK	459	sp|Q8TE77-4|SSH3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	20-UNIMOD:21	ms_run[2]:scan=9634	45.645	3	2551.05	2551.0500	K	Q	68	91
PSM	AQLGGPEAAKSDETAAK	460	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=4018	21.192	2	1722.7826	1722.7826	R	-	189	206
PSM	ASTNNESSNHSFGSLGSLSDK	461	sp|Q9UKI8-5|TLK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21	ms_run[2]:scan=13969	65.345	2	2217.9175	2217.9175	K	E	39	60
PSM	AVSPPHLDGPPSPR	462	sp|P29590-2|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=12308	57.589	2	1585.6691	1585.6691	K	S	516	530
PSM	AVTIANSPSKPSEK	463	sp|Q8NEF9|SRFB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21	ms_run[2]:scan=3136	17.299	2	1507.7283	1507.7283	K	D	197	211
PSM	CVSVQTDPTDEIPTKK	464	sp|P18583-2|SON_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10699	50.453	2	1896.854	1896.8540	R	S	92	108
PSM	DAGTIAGLNVMR	465	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=12417	58.08	2	1232.6183	1232.6183	K	I	186	198
PSM	DLSNVSNIHSSFATSPTGASNSK	466	sp|Q6UB98-2|ANR12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:21	ms_run[2]:scan=14480	67.814	3	2400.0595	2400.0595	R	Y	1335	1358
PSM	DVPPDILLDSPERK	467	sp|Q6KC79-2|NIPBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21	ms_run[2]:scan=16669	79.164	2	1672.8073	1672.8073	R	Q	309	323
PSM	DYSTLTSVSSHDSR	468	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21	ms_run[2]:scan=8789	41.958	2	1633.6621	1633.6621	R	L	1439	1453
PSM	EDALDDSVSSSSVHASPLASSPVR	469	sp|Q7Z3J3|RGPD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	20-UNIMOD:21	ms_run[2]:scan=15210	71.451	2	2492.1068	2492.1068	R	K	1256	1280
PSM	EDDVGTGAGLLEIK	470	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17596	84.461	2	1415.7144	1415.7144	R	K	302	316
PSM	EKEEVAEEAQSGGD	471	sp|O76070|SYUG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2111	12.518	2	1476.6216	1476.6216	K	-	114	128
PSM	ETPHSPGVEDAPIAK	472	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21	ms_run[2]:scan=7726	37.339	2	1626.7291	1626.7291	R	V	184	199
PSM	EVQDLFEAQGNDR	473	sp|Q9H3U1-3|UN45A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=14017	65.575	2	1519.6903	1519.6903	K	L	85	98
PSM	FDDGAGGDNEVQR	474	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4108	21.592	2	1378.5749	1378.5749	R	T	285	298
PSM	FNADEFEDMVAEK	475	sp|P27635|RL10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:35	ms_run[2]:scan=16166	76.362	2	1559.645	1559.6450	K	R	176	189
PSM	GADSGEEKEEGINR	476	sp|Q9BVG4|PBDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=1974	11.845	2	1569.6308	1569.6308	K	E	194	208
PSM	GAKLTPEEEEILNK	477	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21	ms_run[2]:scan=13919	65.114	2	1649.7913	1649.7913	K	K	126	140
PSM	GATAEGGETITEIKPK	478	sp|Q68DA7-3|FMN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=10603	50.021	2	1680.7971	1680.7971	K	D	286	302
PSM	GGDRDSDDDSVLEATSSR	479	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=8965	42.711	2	1960.7647	1960.7647	K	D	171	189
PSM	GGKPEPPAMPQPVPTA	480	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=7902	38.074	2	1668.7583	1668.7583	K	-	228	244
PSM	GILAADESTGSIAK	481	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11391	53.534	2	1331.6933	1331.6933	K	R	29	43
PSM	GLEVTAYSPLGSSDR	482	sp|P14550|AK1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=16903	80.474	2	1550.7577	1550.7577	R	A	204	219
PSM	GVVDSDDLPLNVSR	483	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=21937	115.97	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	484	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=23798	132.14	2	1484.7471	1484.7471	K	E	435	449
PSM	IAQEIASLSKEDVSK	485	sp|Q15311|RBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=11651	54.682	2	1696.8284	1696.8284	K	E	455	470
PSM	IDVDTEDVGDER	486	sp|Q9Y2W6-3|TDRKH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9264	44.067	2	1361.5947	1361.5947	R	V	86	98
PSM	IEENSLKEEESIEGEK	487	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=10287	48.63	2	1941.8456	1941.8456	K	E	1566	1582
PSM	IEEVLSPEGSPSKSPSK	488	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:21	ms_run[2]:scan=9384	44.555	2	1849.871	1849.8710	K	K	636	653
PSM	IFDIDEAEEGVK	489	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17008	81.049	2	1363.6507	1363.6507	K	D	88	100
PSM	IFYPETTDIYDR	490	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17333	82.949	2	1531.7195	1531.7195	K	K	131	143
PSM	IQALQQQADEAEDR	491	sp|P67936|TPM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8744	41.762	3	1613.7645	1613.7645	K	A	14	28
PSM	KESLDVYELDAK	492	sp|Q13510|ASAH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=15026	70.56	2	1488.6749	1488.6749	R	Q	299	311
PSM	KGDSEAEALSEIK	493	sp|Q5T1M5-2|FKB15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=11918	55.835	2	1455.6494	1455.6494	R	D	999	1012
PSM	KGSPCDTLASSTEK	494	sp|Q15788-2|NCOA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=4630	23.869	2	1559.6539	1559.6539	R	R	20	34
PSM	KLSGDQITLPTTVDYSSVPK	495	sp|O00559|RCAS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=19074	93.69	2	2228.0977	2228.0977	R	Q	34	54
PSM	KPSVSEEVQATPNK	496	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=5250	26.4	2	1592.7447	1592.7447	R	A	1027	1041
PSM	KTGSQYDIQDAIDK	497	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=12815	59.94	2	1660.7345	1660.7345	R	G	2523	2537
PSM	KTSLVIVESADNQPETCER	498	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=12823	59.974	3	2255.0141	2255.0141	R	L	3843	3862
PSM	LEASDCDHQQNSPTLER	499	sp|Q9HAN9|NMNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=5245	26.382	3	2078.8365	2078.8365	K	P	106	123
PSM	LFDEEEDSSEKLFDDSDER	500	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21	ms_run[2]:scan=18159	87.813	2	2383.9217	2383.9217	K	G	706	725
PSM	LFESSENIEDSNNPK	501	sp|P34910|EVI2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10626	50.121	2	1721.7744	1721.7744	K	T	291	306
PSM	LKSEDGVEGDLGETQSR	502	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=7251	35.108	2	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	503	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=9409	44.665	3	1898.8259	1898.8259	R	T	133	150
PSM	LPQQDHTTTTDSEMEEPYLQESK	504	sp|Q8IXK0-3|PHC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=11031	51.925	3	2802.1579	2802.1579	K	E	25	48
PSM	LQSIGTENTEENR	505	sp|P04075|ALDOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5049	25.604	2	1489.7009	1489.7009	R	R	44	57
PSM	LVFNPDQEDLDGDGR	506	sp|P35442|TSP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=15429	72.548	2	1688.7642	1688.7642	R	G	914	929
PSM	LYAQDADGCPIDIK	507	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:4	ms_run[2]:scan=13878	64.918	2	1577.7396	1577.7396	K	V	704	718
PSM	MDTIDQDDELIR	508	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:35	ms_run[2]:scan=12979	60.663	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	509	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:35,3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=10811	50.933	3	3061.253	3061.2530	R	V	320	347
PSM	NFQLEEEEQNEAK	510	sp|Q9Y5A7-2|NUB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10789	50.845	2	1606.7111	1606.7111	K	L	168	181
PSM	NQVAMNPTNTVFDAK	511	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:35	ms_run[2]:scan=11630	54.59	2	1664.7828	1664.7828	K	R	57	72
PSM	NTVSQSISGDPEIDKK	512	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=7351	35.539	2	1796.8193	1796.8193	R	I	307	323
PSM	PAGDSVNKDSMNATSTPAALSPSVLTTPSK	513	sp|P54198|HIRA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=16187	76.46	3	3039.4108	3039.4108	R	I	529	559
PSM	QAAASATQTIAAAQHAASTPK	514	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	18-UNIMOD:21	ms_run[2]:scan=12382	57.914	2	2073.9844	2073.9844	K	A	923	944
PSM	RDSDGVDGFEAEGK	515	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=7782	37.593	2	1560.6093	1560.6093	R	K	1052	1066
PSM	RISSSSVQPCSEEVSTPQDSLAQCK	516	sp|P42694|HELZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,10-UNIMOD:4,24-UNIMOD:4	ms_run[2]:scan=12904	60.336	3	2859.2416	2859.2416	R	E	1761	1786
PSM	SAEIASLTSGHENYGR	517	sp|A8TX70-2|CO6A5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:21	ms_run[2]:scan=12567	58.738	2	1770.7574	1770.7574	K	K	2255	2271
PSM	SAIDLTPIVVEDKEEK	518	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=17748	85.34	2	1864.9071	1864.9071	K	K	1648	1664
PSM	SEAPAEVTHFSPK	519	sp|Q6PID6|TTC33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=9867	46.783	2	1478.6443	1478.6443	K	S	187	200
PSM	SGELEQEEERLSK	520	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=8992	42.837	2	1612.6982	1612.6982	K	E	322	335
PSM	SGPDCAGSLKEETGPSYQR	521	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=8051	38.72	2	2117.8725	2117.8725	R	A	148	167
PSM	SGSSQELDVKPSASPQER	522	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:21	ms_run[2]:scan=6735	32.903	2	1980.879	1980.8790	R	S	1539	1557
PSM	SIFDDDMDDIFSSGIQAK	523	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=21467	111.94	2	2018.8779	2018.8779	K	T	1268	1286
PSM	SKFDSDEEEEDTENVEAASSGK	524	sp|Q8TF01-2|PNISR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21	ms_run[2]:scan=11330	53.266	3	2481.9544	2481.9544	R	V	286	308
PSM	SLGANPDDLKDPIK	525	sp|Q96L93-5|KI16B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:21	ms_run[2]:scan=14314	67.025	2	1561.7389	1561.7389	R	I	1016	1030
PSM	SPPASSAASADQHSQSGSSSDNTER	526	sp|Q8IY57-3|YAF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:21	ms_run[2]:scan=928	7.236	3	2540.0049	2540.0049	K	G	94	119
PSM	SRSTTELDDYSTNK	527	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=6826	33.314	2	1695.6989	1695.6989	K	N	1087	1101
PSM	SRTASGSSVTSLDGTR	528	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=7312	35.383	2	1740.7081	1740.7081	R	S	245	261
PSM	SRVAPAEPQEAPDSTAAGGSASK	529	sp|Q3LXA3-2|TKFC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:21	ms_run[2]:scan=5399	27.063	3	2263.0118	2263.0118	R	R	350	373
PSM	STSGGTAALGCLVK	530	sp|P01857|IGHG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:4	ms_run[2]:scan=13480	63.007	2	1320.6708	1320.6708	K	D	17	31
PSM	TESNQEVANPEHYIK	531	sp|P06730|IF4E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=13158	61.488	2	1837.7884	1837.7884	K	H	22	37
PSM	TESVTSGPMSPEGSPSKSPSK	532	sp|P35612|ADDB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=3930	20.79	2	2171.9294	2171.9294	K	K	684	705
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	533	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=14160	66.274	3	2909.304	2909.3040	R	V	1118	1147
PSM	TSLYSEDDCKSLR	534	sp|O00763-2|ACACB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=8889	42.366	2	1652.6753	1652.6753	R	E	1334	1347
PSM	VAAAAGSGPSPPGSPGHDR	535	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3949	20.879	2	1846.7401	1846.7401	R	E	38	57
PSM	VNVDEVGGEALGR	536	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12807	59.902	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	537	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=13255	61.936	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	538	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=13467	62.95	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	539	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=13754	64.355	2	1313.6575	1313.6575	K	L	19	32
PSM	VPEEAAQDRPMSPGDCPPETTETPK	540	sp|P13994|CC130_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35,12-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=7962	38.341	3	2834.1776	2834.1776	R	C	321	346
PSM	VTQGAASPGHGIQEK	541	sp|Q9HB58-5|SP110_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21	ms_run[2]:scan=2343	13.661	2	1558.7141	1558.7141	R	L	372	387
PSM	VVESLDVGQDR	542	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9095	43.316	2	1215.6095	1215.6095	R	V	447	458
PSM	YAGVFAENAEDADGK	543	sp|Q96EU7|C1GLC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11787	55.253	2	1555.6791	1555.6791	K	D	229	244
PSM	YGLQDSDEEEEEHPSK	544	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=6596	32.287	2	1970.7419	1970.7419	K	T	866	882
PSM	YICENQDSISSK	545	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:4	ms_run[2]:scan=5456	27.295	2	1442.6348	1442.6348	K	L	287	299
PSM	QRGSETGSETHESDLAPSDK	546	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=5274	26.498368333333335	2	2192.8833	2192.8854	R	E	1103	1123
PSM	CTLPEHESPSQDISDACEAESTER	547	sp|Q32MZ4|LRRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:385,1-UNIMOD:4,10-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=17213	82.25143	3	2811.0692	2810.0682	R	C	726	750
PSM	VNVDEVGGEALGR	548	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=15745	74.135565	2	1314.665394	1313.657543	K	L	19	32
PSM	AASDTERDGLAPEKTSPDR	549	sp|Q7L4I2|RSRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,16-UNIMOD:21	ms_run[1]:scan=6482	31.786393333333336	3	2136.9304	2136.9319	M	D	2	21
PSM	SETAPAETATPAPVEKSPAK	550	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8365	40.093538333333335	2	2102.9751	2102.9768	M	K	2	22
PSM	ETPHSPGVEDAPIAK	551	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:21	ms_run[1]:scan=11673	54.761435	2	1626.738733	1626.729068	R	V	486	501
PSM	TPAFAESVTEGDVR	552	sp|P36957|ODO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=13712	64.1647	2	1477.703983	1477.704888	K	W	75	89
PSM	QQIAEDPELTHSSSNK	553	sp|Q9ULC3|RAB23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=10608	50.043398333333336	2	1845.7761	1845.7777	K	I	175	191
PSM	QEEIDESDDDLDDKPSPIK	554	sp|Q9ULH1|ASAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=14716	69.00374166666666	2	2249.9065	2249.9095	R	K	711	730
PSM	KSELPQDVYTIK	555	sp|Q14738|2A5D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	2-UNIMOD:21	ms_run[1]:scan=13244	61.885665	2	1500.739052	1499.727277	R	A	572	584
PSM	SSAEDRSPENTGSSVAVDNFPQVDK	556	sp|Q7Z3E2|CC186_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:21	ms_run[1]:scan=14534	68.08921666666666	3	2716.163954	2715.166113	R	A	734	759
PSM	IFTSIGEDYDER	557	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=14481	67.817595	2	1442.655476	1443.651789	R	V	106	118
PSM	AEDGATPSPSNETPKK	558	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:21	ms_run[2]:scan=965	7.4081	2	1707.7353	1707.7353	K	K	138	154
PSM	AGLESGAEPGDGDSDTTKK	559	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=4116	21.625	2	1913.7892	1913.7892	K	K	481	500
PSM	AGVQSVGEKESLEAAK	560	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:21	ms_run[2]:scan=7041	34.207	2	1681.7924	1681.7924	K	E	169	185
PSM	ANLPQSFQVDTSK	561	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13156	61.481	2	1433.7151	1433.7151	R	A	1465	1478
PSM	APGAEEDDSELQR	562	sp|Q53F19-2|NCBP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4517	23.436	2	1415.6165	1415.6165	R	A	287	300
PSM	AVTDTHENGDLGTASETPLDDGASK	563	sp|Q9HD26-2|GOPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	17-UNIMOD:21	ms_run[2]:scan=9997	47.383	3	2580.0865	2580.0865	K	L	417	442
PSM	CCQLKPGGDSSSSLDSSVTSSSDIK	564	sp|Q8TF40-3|FNIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=12619	58.975	3	2681.1198	2681.1198	K	D	87	112
PSM	DADDAVYELDGK	565	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11096	52.228	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELNGK	566	sp|Q13247-2|SRSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11412	53.631	2	1308.5834	1308.5834	R	E	47	59
PSM	DASDDLDDLNFFNQK	567	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=21938	115.98	2	1755.7588	1755.7588	K	K	65	80
PSM	DDISEIQSLASDHSGR	568	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:21	ms_run[2]:scan=17407	83.413	2	1808.7578	1808.7578	R	S	287	303
PSM	DETFGEYSDSDEKPLK	569	sp|O00533|NCHL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:21	ms_run[2]:scan=12214	57.175	2	1938.7772	1938.7772	K	G	1130	1146
PSM	DMESPTKLDVTLAK	570	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=13370	62.459	2	1642.7525	1642.7525	K	D	277	291
PSM	DQEPKPSPEPAAVSR	571	sp|Q9H7S9|ZN703_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=4614	23.8	2	1686.7614	1686.7614	K	G	246	261
PSM	DSLLQDGEFSMDLR	572	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=19235	94.76	2	1640.7352	1640.7352	R	T	76	90
PSM	DVPPDILLDSPERK	573	sp|Q6KC79-2|NIPBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=16480	78.145	2	1672.8073	1672.8073	R	Q	309	323
PSM	EKEISDDEAEEEK	574	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=2596	14.799	2	1629.6295	1629.6295	R	G	222	235
PSM	ELGPLPDDDDMASPK	575	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=11663	54.727	2	1614.7083	1614.7083	K	L	624	639
PSM	ELSLAGNELGDEGAR	576	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=14594	68.387	2	1529.7322	1529.7322	K	L	288	303
PSM	ELVSSSSSGSDSDSEVDKK	577	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=4010	21.156	2	2021.8314	2021.8314	K	L	6	25
PSM	ENAEQGEVDMESHR	578	sp|P14209-3|CD99_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=1198	8.3618	2	1725.6302	1725.6302	K	N	141	155
PSM	ETNLDSLPLVDTHSK	579	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=15841	74.634	2	1747.803	1747.8030	R	R	425	440
PSM	FDVPGDENAEMDAR	580	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=11064	52.079	2	1580.6413	1580.6413	K	T	1369	1383
PSM	FEDEDSDDVPR	581	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6841	33.372	2	1322.5263	1322.5263	K	K	698	709
PSM	FGVEQPEGDEDLTKEK	582	sp|P24928-2|RPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:21	ms_run[2]:scan=12093	56.626	2	1899.8139	1899.8139	K	G	164	180
PSM	GAKLTPEEEEILNK	583	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=14130	66.127	2	1649.7913	1649.7913	K	K	126	140
PSM	GGETPEGLATSVVHYGAGAK	584	sp|Q9ULL5-3|PRR12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=18329	88.842	2	1979.899	1979.8990	R	E	735	755
PSM	GTDDLNPVTSTPAKPSSPPPEFSFNTPGK	585	sp|Q6NXT4-4|ZNT6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	16-UNIMOD:21	ms_run[2]:scan=18916	92.665	3	3064.4067	3064.4067	K	N	337	366
PSM	GTSPRPPEGGLGYSQLGDDDLK	586	sp|Q9UQ88-8|CD11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:21	ms_run[2]:scan=16443	77.923	3	2338.0478	2338.0478	R	E	122	144
PSM	GVVDSDDLPLNVSR	587	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16470	78.096	3	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	588	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=24498	138.43	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	589	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=25769	150.07	2	1484.7471	1484.7471	K	E	435	449
PSM	HSTSDLSDATFSDIR	590	sp|Q9P227-2|RHG23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:21	ms_run[2]:scan=15200	71.405	2	1730.7149	1730.7149	R	R	676	691
PSM	IASLEVENQSLR	591	sp|P29692-3|EF1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12974	60.641	2	1357.7201	1357.7201	R	G	60	72
PSM	IEEVLSPEGSPSKSPSK	592	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:21	ms_run[2]:scan=8929	42.532	2	1849.871	1849.8710	K	K	636	653
PSM	IFTSIGEDYDER	593	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=14777	69.29	2	1443.6518	1443.6518	R	V	106	118
PSM	IIYGGSVTGATCK	594	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:4	ms_run[2]:scan=9009	42.903	2	1325.6649	1325.6649	R	E	207	220
PSM	ILDSVGIEADDDR	595	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12393	57.968	2	1416.6733	1416.6733	K	L	26	39
PSM	INSLTEEKDDFINK	596	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=13945	65.232	2	1744.7921	1744.7921	K	L	589	603
PSM	IQFENNEDQDVNPLK	597	sp|O95163|ELP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=15501	72.906	2	1801.8483	1801.8483	K	L	488	503
PSM	IQVLQQQADDAEER	598	sp|P06753-4|TPM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10283	48.611	3	1641.7958	1641.7958	K	A	14	28
PSM	KGGSYSQAASSDSAQGSDMSLTACK	599	sp|P30512|1A29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21,19-UNIMOD:35,24-UNIMOD:4	ms_run[2]:scan=6873	33.491	2	2589.036	2589.0360	R	V	340	365
PSM	KGSSTDISEDWEK	600	sp|Q9NW68-9|BSDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=10342	48.873	2	1560.6345	1560.6345	K	D	290	303
PSM	KNSTDLDSAPEDPTSPK	601	sp|Q96RK0|CIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=6496	31.847	2	1880.8041	1880.8041	R	R	1395	1412
PSM	KPSVSEEVQATPNK	602	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=4942	25.188	2	1592.7447	1592.7447	R	A	1027	1041
PSM	KQSTDEEVTSLAK	603	sp|P23193-2|TCEA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=7975	38.398	2	1514.6865	1514.6865	R	S	34	47
PSM	KSSSYSSSSTTVK	604	sp|P55085|PAR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=981	7.4684	2	1427.6181	1427.6181	R	T	382	395
PSM	KSSTVESEIASEEK	605	sp|Q9Y2K1-2|ZBTB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=9975	47.285	2	1602.7026	1602.7026	R	S	303	317
PSM	LDDFVETGDIR	606	sp|Q14108-2|SCRB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=15193	71.375	2	1278.6092	1278.6092	K	T	249	260
PSM	LDSSEMDHSENEDYTMSSPLPGK	607	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=10116	47.875	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LEEKSEDQDLQGLK	608	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=9537	45.221	2	1710.7713	1710.7713	R	D	21	35
PSM	LEGLTDEINFLR	609	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=22077	117.11	2	1418.7405	1418.7405	R	Q	214	226
PSM	LEGPVSPDVEPGKEETEESK	610	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=10745	50.65	2	2234.9832	2234.9832	K	K	1666	1686
PSM	LESIDNHSSTGGQSDQGYGSK	611	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=5872	29.11	3	2245.9125	2245.9125	R	D	951	972
PSM	LIAINANDPEASK	612	sp|Q9H2U2-6|IPYR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11284	53.049	2	1354.7092	1354.7092	K	F	102	115
PSM	LSLEGDHSTPPSAYGSVK	613	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:21	ms_run[2]:scan=12883	60.239	2	1923.8615	1923.8615	K	A	11	29
PSM	LSLEGDHSTPPSAYGSVK	614	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:21	ms_run[2]:scan=13114	61.272	2	1923.8615	1923.8615	K	A	11	29
PSM	MFVLDEADEMLSR	615	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=17343	83.011	2	1586.6956	1586.6956	K	G	178	191
PSM	MNSLMDEDIAHK	616	sp|Q9ULK0-2|GRID1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:35,3-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=5541	27.64	2	1514.5782	1514.5782	R	Q	451	463
PSM	NEEPSEEEIDAPKPK	617	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=7019	34.109	2	1790.7612	1790.7612	K	K	49	64
PSM	NPDELAEALDER	618	sp|O14908-2|GIPC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16290	76.997	2	1370.6314	1370.6314	R	L	199	211
PSM	QDKPLSPAGSSQEAADTPDTR	619	sp|P13994|CC130_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=6957	33.841	2	2249.9801	2249.9801	R	H	357	378
PSM	QNCELFEQLGEYK	620	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:4	ms_run[2]:scan=19540	96.924	2	1656.7454	1656.7454	K	F	414	427
PSM	RASVCAEAYNPDEEEDDAESR	621	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10242	48.448	3	2491.9435	2491.9435	R	I	112	133
PSM	RASVCAEAYNPDEEEDDAESR	622	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10776	50.794	3	2491.9435	2491.9435	R	I	112	133
PSM	RDSLGAYASQDANEQGQDLGK	623	sp|Q9C0C2-2|TB182_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=11765	55.162	3	2301.9863	2301.9863	K	R	342	363
PSM	RSLTVSDDAESSEPER	624	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:21	ms_run[2]:scan=6927	33.718	2	1856.7789	1856.7789	K	K	2953	2969
PSM	SCWVCFATDEDDR	625	sp|Q9NX47|MARH5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=17672	84.896	2	1659.6294	1659.6294	R	T	13	26
PSM	SDILKDPPSEANSIQSANATTK	626	sp|Q8N488|RYBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:21	ms_run[2]:scan=12999	60.744	3	2366.1003	2366.1003	K	T	115	137
PSM	SDNHSPAVVTTTVSSK	627	sp|O75179-6|ANR17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=5599	27.876	2	1708.7669	1708.7669	K	K	1384	1400
PSM	SDSELEVKPAESLLR	628	sp|Q92539|LPIN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=17801	85.663	2	1751.8343	1751.8343	K	S	243	258
PSM	SEAEEGEVRTPTK	629	sp|Q9H4G0|E41L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=1618	10.263	2	1511.6505	1511.6505	R	I	466	479
PSM	SEAEEGEVRTPTK	630	sp|Q9H4G0|E41L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=1854	11.283	2	1511.6505	1511.6505	R	I	466	479
PSM	SGPDCAGSLKEETGPSYQR	631	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=8027	38.618	3	2117.8725	2117.8725	R	A	148	167
PSM	SLENLNSGTVEPTHSK	632	sp|Q14191|WRN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=9293	44.182	2	1791.804	1791.8040	K	C	478	494
PSM	SNSVEKPVSSILSR	633	sp|Q9UI08-4|EVL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=14474	67.787	3	1581.7764	1581.7764	R	T	329	343
PSM	SQEPIPDDQKVSDDDK	634	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:21	ms_run[2]:scan=5980	29.569	2	1894.7833	1894.7833	K	E	415	431
PSM	SQSESSDEVTELDLSHGK	635	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=12388	57.941	3	2026.8368	2026.8368	R	K	657	675
PSM	SSDGSLSHEEDLAK	636	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=6966	33.878	2	1553.6247	1553.6247	R	V	238	252
PSM	SSEDPNEDIVER	637	sp|P01591|IGJ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6451	31.644	2	1388.6056	1388.6056	R	N	47	59
PSM	SSGHSSSELSPDAVEK	638	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=6565	32.138	2	1695.6989	1695.6989	R	A	1378	1394
PSM	TCSDGGPSSELAHSPTNSGK	639	sp|Q86YV5|PRAG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=4298	22.452	2	2067.8205	2067.8205	R	K	769	789
PSM	TEPHDSDCSVDLGISK	640	sp|Q96RT1-7|ERBIN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=10812	50.936	2	1838.7394	1838.7394	R	S	836	852
PSM	TEVALAKDMESPTK	641	sp|P27816-6|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5106	25.816	2	1614.7212	1614.7212	K	L	270	284
PSM	TIQEVLEEQSEDEDR	642	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16023	75.593	2	1818.8119	1818.8119	R	E	132	147
PSM	TKSPTDDEVTPSAVVR	643	sp|Q9Y2H5|PKHA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=8519	40.792	2	1780.8244	1780.8244	R	R	775	791
PSM	TTRTPEEGGYSYDISEK	644	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=10275	48.579	2	2011.8412	2011.8412	K	T	1946	1963
PSM	TVEVAEGEAVRTPQSVTAK	645	sp|Q86UE4|LYRIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:21	ms_run[2]:scan=10123	47.904	2	2050.9936	2050.9936	R	Q	132	151
PSM	VDPSLMEDSDDGPSLPTK	646	sp|O15258|RER1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35	ms_run[2]:scan=12937	60.48	2	1917.8514	1917.8514	K	Q	87	105
PSM	VDSTTCLFPVEEK	647	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=17722	85.181	2	1603.6841	1603.6841	R	A	241	254
PSM	VLEQLEDLDSR	648	sp|P26358-3|DNMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16265	76.868	2	1315.662	1315.6620	R	V	574	585
PSM	VLNNMEIGTSLFDEEGAK	649	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:35	ms_run[2]:scan=18710	91.326	2	1981.9303	1981.9303	K	I	219	237
PSM	VNVEDAGGETLGR	650	sp|P69892|HBG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9413	44.677	2	1315.6368	1315.6368	K	L	19	32
PSM	VQVAALQASPPLDQDDR	651	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=14914	69.963	2	1821.9221	1821.9221	K	A	99	116
PSM	YELQQLEGSSDR	652	sp|Q92878-3|RAD50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12696	59.351	2	1423.6579	1423.6579	K	I	323	335
PSM	YNLDASEEEDSNKK	653	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=5233	26.336	2	1720.6829	1720.6829	K	K	183	197
PSM	YPGPQAEGDSEGLSQGLVDR	654	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=15356	72.158	2	2073.9603	2073.9603	K	E	194	214
PSM	YQSSPAKPDSSFYK	655	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=9319	44.294	2	1683.7182	1683.7182	R	G	282	296
PSM	YSEFTSTTSGTGHNQTR	656	sp|P48960-2|CD97_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	16-UNIMOD:21	ms_run[2]:scan=5264	26.459	2	1952.7902	1952.7902	K	A	717	734
PSM	NLVVGDETTSSLR	657	sp|Q05707|COEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=12280	57.46642833333333	2	1389.709163	1389.709973	R	V	740	753
PSM	QRGSETGSETHESDLAPSDK	658	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=5244	26.379105	3	2192.8831	2192.8854	R	E	1103	1123
PSM	VFDDESDEKEDEEYADEK	659	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:21	ms_run[1]:scan=10432	49.273513333333334	3	2271.828339	2270.826395	K	G	637	655
PSM	GYGYGQGAGTLSTDK	660	sp|P21291|CSRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=8713	41.606341666666665	2	1473.684720	1473.673587	K	G	70	85
PSM	ILDSVGIEADDDR	661	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=13987	65.43081166666667	2	1416.675732	1416.673253	K	L	26	39
PSM	QAQTQTSPEHLVLQQK	662	sp|Q9ULV3|CIZ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=13909	65.06716333333333	2	1897.8920	1897.8930	K	Q	344	360
PSM	RSSSDTAAYPAGTTAVGTPGNGTPCSQDTSFSSSR	663	sp|O15047|SET1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=13505	63.13986833333333	3	3558.479279	3557.500214	R	Q	219	254
PSM	QQIAEDPELTHSSSNK	664	sp|Q9ULC3|RAB23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=11014	51.833505	2	1845.7763	1845.7777	K	I	175	191
PSM	SLIIDEGEDDLGR	665	sp|O14618|CCS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=16318	77.11423166666667	2	1431.691146	1430.688903	R	G	197	210
PSM	CDSSPDSAEDVRK	666	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1412	9.306911666666666	2	1544.580399	1544.581418	K	V	132	145
PSM	SCSLVLEHQPDNIK	667	sp|Q14318|FKBP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=12548	58.660798333333325	2	1717.746044	1718.769887	R	A	294	308
PSM	KETESEAEDNLDDLEK	668	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	5-UNIMOD:21	ms_run[1]:scan=13284	62.079273333333326	2	1943.786968	1943.788493	K	H	870	886
PSM	DLTGFPGPLNDQDNEDCINR	669	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	17-UNIMOD:4	ms_run[1]:scan=19393	95.88614166666666	3	2289.978647	2288.996789	K	H	626	646
PSM	AAYFGIYDTAK	670	sp|P05141|ADT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16324	77.136	2	1218.5921	1218.5921	R	G	189	200
PSM	AEPLETFPFDQSK	671	sp|Q9Y6N5|SQOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=19123	94.013	2	1507.7195	1507.7195	K	E	397	410
PSM	AFALNDLDDYEK	672	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=18805	91.959	2	1412.646	1412.6460	R	H	499	511
PSM	AGDRNSEDDGVVMTFSSVK	673	sp|Q9NY61|AATF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=14434	67.596	2	2108.8722	2108.8722	R	V	198	217
PSM	ALEDMFDALEGK	674	sp|P23786|CPT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:35	ms_run[2]:scan=17855	85.935	2	1353.6122	1353.6122	K	S	643	655
PSM	AQSPVITTTAAHATDSALSR	675	sp|Q9H0E3|SP130_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=14628	68.545	2	2076.9841	2076.9841	R	P	298	318
PSM	ASDTCLDVIGGRDTPGAK	676	sp|Q68DQ2-1|CRBG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=12043	56.393	2	1911.8398	1911.8398	K	V	941	959
PSM	ASQSRPNSSALETLGGEK	677	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:21	ms_run[2]:scan=10954	51.548	2	1910.8735	1910.8735	K	L	447	465
PSM	ASSHSSQTQGGGSVTK	678	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21	ms_run[2]:scan=473	4.8776	2	1597.6733	1597.6733	R	K	402	418
PSM	ASTSDYQVISDRQTPK	679	sp|Q8NFH5-3|NUP35_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:21	ms_run[2]:scan=8588	41.076	2	1874.8411	1874.8411	K	K	160	176
PSM	CGFQDDVAYGK	680	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:4	ms_run[2]:scan=10369	48.988	2	1258.5288	1258.5288	R	T	666	677
PSM	DDGSTLMEIDGDK	681	sp|O96019-2|ACL6A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=10532	49.689	2	1410.5821	1410.5821	R	G	6	19
PSM	DFVDDDDDDDLER	682	sp|Q9H9C1-2|SPE39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12587	58.827	2	1582.5907	1582.5907	R	V	44	57
PSM	DGDDVIIIGVFK	683	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=22384	119.69	2	1289.6867	1289.6867	K	G	302	314
PSM	DGDDVIIIGVFK	684	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=22257	118.64	2	1289.6867	1289.6867	K	G	302	314
PSM	DLGGFDEDAEPR	685	sp|Q9BRK5-4|CAB45_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12467	58.299	2	1319.563	1319.5630	K	R	86	98
PSM	DLMVGDEASELR	686	sp|P61160|ARP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35	ms_run[2]:scan=13277	62.045	2	1349.6133	1349.6133	K	S	54	66
PSM	DMESPTKLDVTLAK	687	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=13798	64.552	2	1642.7525	1642.7525	K	D	277	291
PSM	DNVESAQASEVKPLRS	688	sp|Q12864|CAD17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:21	ms_run[2]:scan=8247	39.575	2	1808.8306	1808.8306	K	-	817	833
PSM	DPDDVVPVGQR	689	sp|Q9Y287-2|ITM2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8552	40.93	2	1195.5833	1195.5833	K	R	40	51
PSM	DSGRGDSVSDSGSDALR	690	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21	ms_run[2]:scan=5060	25.645	2	1759.701	1759.7010	R	S	59	76
PSM	DSLLQDGEFSMDLR	691	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=18616	90.727	2	1640.7352	1640.7352	R	T	76	90
PSM	DSSGQHVDVSPTSQR	692	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=3290	17.979	2	1678.6948	1678.6948	K	L	550	565
PSM	DSYSSSRSDLYSSGR	693	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:21	ms_run[2]:scan=6859	33.439	2	1745.6894	1745.6894	R	D	312	327
PSM	DVPPDILLDSPERK	694	sp|Q6KC79-2|NIPBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=17030	81.176	2	1672.8073	1672.8073	R	Q	309	323
PSM	DVPPDILLDSPERK	695	sp|Q6KC79-2|NIPBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=16319	77.117	2	1672.8073	1672.8073	R	Q	309	323
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	696	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=9327	44.327	3	3001.2673	3001.2673	R	E	120	150
PSM	EIIDASDKEGMSPAK	697	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=4778	24.51	2	1685.7219	1685.7219	K	R	82	97
PSM	ESSPSVQDSTSPGEHPAK	698	sp|Q2M1Z3|RHG31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=2621	14.92	2	1918.7946	1918.7946	K	L	1070	1088
PSM	ESTQLSPADLTEGKPTDPSK	699	sp|Q08J23-3|NSUN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21	ms_run[2]:scan=12717	59.441	2	2179.9886	2179.9886	R	L	215	235
PSM	EYVNVSQELHPGAAK	700	sp|O43561-4|LAT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=13420	62.702	2	1720.7822	1720.7822	R	T	189	204
PSM	FAAYFQQGDMESNGK	701	sp|P06744|G6PI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=11882	55.681	2	1707.7199	1707.7199	R	Y	348	363
PSM	FDDAVVQSDMK	702	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=6845	33.384	2	1269.5547	1269.5547	R	H	78	89
PSM	FDGDELTTDER	703	sp|O43149|ZZEF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9356	44.444	2	1296.547	1296.5470	R	I	2503	2514
PSM	FEDGVLDPDYPR	704	sp|P04004|VTNC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16004	75.497	2	1421.6463	1421.6463	R	N	230	242
PSM	FFETCDLDNDK	705	sp|P09486|SPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4	ms_run[2]:scan=12768	59.68	2	1402.5711	1402.5711	R	Y	269	280
PSM	FSGDLDDQTCR	706	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=6652	32.52	2	1312.5354	1312.5354	K	E	236	247
PSM	FTDEEVDELYR	707	sp|P19105|ML12A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16101	76.007	2	1414.6252	1414.6252	R	E	133	144
PSM	GAEKSPTTSADLK	708	sp|O75363-2|BCAS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=1989	11.941	2	1383.6283	1383.6283	K	S	355	368
PSM	GAGATLEHQQEISK	709	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=5199	26.202	2	1547.6981	1547.6981	R	I	672	686
PSM	GAGTGGLGLAVEGPSEAK	710	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13565	63.406	2	1569.7999	1569.7999	R	M	1382	1400
PSM	GGKSGELEQEEER	711	sp|P10645|CMGA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=2819	15.852	2	1526.625	1526.6250	R	L	319	332
PSM	GGVTGSPEASISGSKGDLK	712	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:21	ms_run[2]:scan=9789	46.437	2	1825.8459	1825.8459	K	S	5726	5745
PSM	GSDPGTSPPHLSTCGLGTGEESR	713	sp|Q9Y3S1-2|WNK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13279	62.057	3	2377.9846	2377.9846	R	Q	1270	1293
PSM	GSVQYLPDLDDKNSQEK	714	sp|Q9UGM5-2|FETUB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:21	ms_run[2]:scan=14890	69.855	2	2014.8885	2014.8885	R	G	265	282
PSM	GTAQYSSQKSVEER	715	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=1789	10.995	2	1648.7094	1648.7094	R	S	126	140
PSM	HSTSLTQDESTLTEVK	716	sp|Q8TF47|ZFP90_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=12994	60.722	2	1854.8248	1854.8248	K	S	433	449
PSM	HYSPEDEPSPEAQPIAAYK	717	sp|Q6ZSR9|YJ005_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=12910	60.358	3	2207.9412	2207.9412	R	I	292	311
PSM	IEEVLSPEGSPSKSPSK	718	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:21	ms_run[2]:scan=9911	46.99	2	1849.871	1849.8710	K	K	636	653
PSM	IEEVLSPEGSPSKSPSK	719	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:21	ms_run[2]:scan=10257	48.507	2	1849.871	1849.8710	K	K	636	653
PSM	ILACDDLDEAAR	720	sp|Q9P2R7-2|SUCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:4	ms_run[2]:scan=11940	55.924	2	1360.6293	1360.6293	K	M	405	417
PSM	ILDSVGIEADDDR	721	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14019	65.582	2	1416.6733	1416.6733	K	L	26	39
PSM	ILEDSGFDEQQEFR	722	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16027	75.612	2	1711.7689	1711.7689	R	S	300	314
PSM	KASPEPPDSAEGALK	723	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=6811	33.257	2	1575.7182	1575.7182	R	L	545	560
PSM	KASVVDPSTESSPAPQEGSEQPASPASPLSSR	724	sp|Q66K14-2|TBC9B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=12328	57.668	3	3259.4882	3259.4882	R	Q	409	441
PSM	KDSSSEVFSDAAK	725	sp|Q5T5U3|RHG21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=7040	34.204	2	1449.6025	1449.6025	R	E	921	934
PSM	KETSPESSLIQDEIAVK	726	sp|P11137-3|MTAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=17299	82.742	2	1952.9344	1952.9344	K	L	1148	1165
PSM	KGSSSSVCSVASSSDISLGSTK	727	sp|Q9ULT8|HECD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=13169	61.541	3	2209.9774	2209.9774	R	T	1382	1404
PSM	KLSTTGSSDSITPVAPTSAVSSSGSPASVMTNMR	728	sp|Q15714-4|T22D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,30-UNIMOD:35,33-UNIMOD:35	ms_run[2]:scan=14383	67.333	3	3422.5582	3422.5582	R	A	261	295
PSM	KSGSQDFPQCNTIENTGTK	729	sp|P28290-2|ITPI2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=9824	46.597	3	2190.9253	2190.9253	R	Q	437	456
PSM	KSPVSSTQEIDSGK	730	sp|Q5T890|ER6L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21	ms_run[2]:scan=3424	18.611	2	1541.6974	1541.6974	K	N	1369	1383
PSM	KSSPQSTDTAMDLLK	731	sp|Q9UGU5|HMGX4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=10844	51.064	2	1716.7641	1716.7641	K	A	100	115
PSM	LDLMDEGTDAR	732	sp|Q05193-5|DYN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35	ms_run[2]:scan=7667	37.09	2	1250.5449	1250.5449	K	D	207	218
PSM	LEDLLQDAQDEK	733	sp|Q15149-6|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15496	72.884	2	1415.678	1415.6780	R	E	764	776
PSM	LEEKSEDQDLQGLK	734	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=11490	53.981	2	1710.7713	1710.7713	R	D	21	35
PSM	LEGDSDDLLEDSDSEEHSR	735	sp|Q9NR09|BIRC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:21	ms_run[2]:scan=11312	53.187	3	2226.8438	2226.8438	K	S	469	488
PSM	LKFSDDEEEEEVVK	736	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=13818	64.637	2	1774.755	1774.7550	K	D	385	399
PSM	LKSEDGVEGDLGETQSR	737	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=8326	39.917	3	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	738	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=8788	41.954	3	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	739	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=9170	43.649	3	1898.8259	1898.8259	R	T	133	150
PSM	LQAALDDEEAGGR	740	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7253	35.12	2	1343.6317	1343.6317	R	P	38	51
PSM	MFVLDEADEMLSR	741	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=17172	81.992	2	1586.6956	1586.6956	K	G	178	191
PSM	MIEQDDFDINTR	742	sp|Q9Y223-5|GLCNE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35	ms_run[2]:scan=13260	61.961	2	1511.6562	1511.6562	-	L	1	13
PSM	NEEPSEEEIDAPKPK	743	sp|Q9NR30-2|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=6773	33.089	2	1790.7612	1790.7612	K	K	49	64
PSM	NFGEEVDDESLK	744	sp|Q13310-2|PABP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12262	57.385	2	1380.6045	1380.6045	K	E	197	209
PSM	NFYESDDDQKEK	745	sp|O00203-3|AP3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=4421	23.011	2	1596.5981	1596.5981	K	T	223	235
PSM	NSGVNYLILDDDDR	746	sp|O75815-2|BCAR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17946	86.483	2	1607.7427	1607.7427	R	E	146	160
PSM	NVELQCLDADDAK	747	sp|P02730-2|B3AT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4	ms_run[2]:scan=12889	60.267	2	1489.6719	1489.6719	R	A	815	828
PSM	NVQDAIADAEQR	748	sp|P35908|K22E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12170	56.997	2	1328.6321	1328.6321	K	G	419	431
PSM	PANDFNPDADAK	749	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4985	25.354	2	1273.5575	1273.5575	R	A	327	339
PSM	QFLECAQNQGDIK	750	sp|Q9Y6H1|CHCH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4	ms_run[2]:scan=11263	52.96	2	1549.7195	1549.7195	K	L	120	133
PSM	QLEEAEEEAQR	751	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4316	22.53	2	1330.6001	1330.6001	R	A	1878	1889
PSM	REESPMDVDQPSPSAQDTQSIASDGTPQGEK	752	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=10348	48.9	3	3382.4144	3382.4144	R	E	3789	3820
PSM	RNSSEASSGDFLDLK	753	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=15964	75.272	2	1704.7356	1704.7356	R	G	39	54
PSM	RVSGEPQQSGDGSLSPQAEAIEVAAGESAGR	754	sp|Q96NY7-2|CLIC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=18294	88.641	3	3119.4157	3119.4157	R	S	291	322
PSM	SENNSSNSDIVHVEK	755	sp|Q9BXK5-4|B2L13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=5755	28.514	2	1737.7207	1737.7207	K	E	136	151
PSM	SESQESLVTSPSKPK	756	sp|Q76L83|ASXL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=5224	26.299	2	1682.7764	1682.7764	K	S	515	530
PSM	SGSPGSSSYEHYESR	757	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=5507	27.498	2	1708.6366	1708.6366	R	K	1093	1108
PSM	SKSDSYTLDPDTLR	758	sp|O75592-2|MYCB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=13974	65.373	2	1676.7295	1676.7295	R	K	2869	2883
PSM	SKSTAALSGEAASCSPIIMPYK	759	sp|Q14244-5|MAP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21,14-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=15671	73.758	3	2364.0742	2364.0743	R	A	94	116
PSM	SLGSSHSNSSSSSLTEK	760	sp|Q5HYJ3-3|FA76B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=3112	17.197	2	1773.7418	1773.7418	K	D	148	165
PSM	SLLDASEEAIKK	761	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=13514	63.181	2	1382.6694	1382.6694	K	D	721	733
PSM	SLLDASEEAIKK	762	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=13717	64.188	2	1382.6694	1382.6694	K	D	721	733
PSM	SLMASEEEYSTK	763	sp|P07951-2|TPM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35	ms_run[2]:scan=6047	29.843	2	1389.597	1389.5970	K	E	206	218
PSM	SLMASEEEYSTK	764	sp|P07951-2|TPM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35	ms_run[2]:scan=6269	30.873	2	1389.597	1389.5970	K	E	206	218
PSM	SNVSDAVAQSTR	765	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5190	26.165	2	1233.5949	1233.5949	K	I	195	207
PSM	SPTSDDISLLHESQSDR	766	sp|Q9Y3C5|RNF11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:21	ms_run[2]:scan=13576	63.456	2	1965.8317	1965.8317	K	A	7	24
PSM	SQGPALTASQSVHEQPTK	767	sp|Q9UKE5-8|TNIK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=6327	31.11	2	1944.8942	1944.8942	K	G	516	534
PSM	SQYEVMAEQNR	768	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35	ms_run[2]:scan=3663	19.628	2	1369.5932	1369.5932	R	K	254	265
PSM	SRPTSEGSDIESTEPQK	769	sp|Q4G0J3|LARP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=5488	27.417	2	1926.8208	1926.8208	R	Q	254	271
PSM	SRSPGSPVGEGTGSPPK	770	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=3088	17.091	2	1755.723	1755.7230	K	W	353	370
PSM	STGDIAGTVVPETNKEPR	771	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=12122	56.775	2	1949.9096	1949.9096	K	Y	438	456
PSM	SVAPASPPPPDGPLAHR	772	sp|Q2M2I3|FA83E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=10307	48.715	2	1824.7961	1824.7961	R	L	319	336
PSM	SVIDPVPAPVGDSHVDGAAK	773	sp|Q13177|PAK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=14340	67.138	2	2009.9459	2009.9459	R	S	197	217
PSM	SYSSPDITQAIQEEEKR	774	sp|P40818|UBP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=17513	83.989	2	2059.9099	2059.9099	R	K	716	733
PSM	TDMFQTVDLFEGK	775	sp|Q01995|TAGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35	ms_run[2]:scan=19745	98.356	2	1545.7021	1545.7021	K	D	109	122
PSM	TEDLEATSEHFK	776	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21	ms_run[2]:scan=7802	37.67	2	1485.6025	1485.6025	K	T	48	60
PSM	TETQEKNPLPSK	777	sp|P62328|TYB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=3440	18.68	2	1450.6705	1450.6705	K	E	21	33
PSM	THSDASDDEAFTTSK	778	sp|Q13017-2|RHG05_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=3237	17.757	2	1690.636	1690.6360	R	T	1171	1186
PSM	TIEEYAICPDLR	779	sp|Q15124|PGM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:4	ms_run[2]:scan=17249	82.432	2	1478.7075	1478.7075	K	I	158	170
PSM	TLGTMIAGDTSGDYR	780	sp|P20073-2|ANXA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:35	ms_run[2]:scan=12247	57.313	2	1572.709	1572.7090	K	R	443	458
PSM	TNSPDLDTQSLSHSSGTDR	781	sp|Q6H8Q1-4|ABLM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=8784	41.934	2	2096.8648	2096.8648	R	D	209	228
PSM	TTSREEVDEAASTLTR	782	sp|Q9UKT5-2|FBX4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=13319	62.233	3	1844.8153	1844.8153	R	L	46	62
PSM	TTSREEVDEAASTLTR	783	sp|Q9UKT5-2|FBX4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=13321	62.24	2	1844.8153	1844.8153	R	L	46	62
PSM	TYEQVLENLESK	784	sp|Q16762|THTR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=19651	97.691	2	1451.7144	1451.7144	K	R	164	176
PSM	TYSEKVEEYNLR	785	sp|Q8N4S9-2|MALD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=12178	57.031	2	1609.7025	1609.7025	R	Y	171	183
PSM	VASVFANADKGDDEK	786	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=10625	50.118	2	1644.7032	1644.7032	R	N	1097	1112
PSM	VEVTEFEDIKSGYR	787	sp|Q01105-3|SET_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=16859	80.234	2	1750.7815	1750.7815	R	I	98	112
PSM	VGSGDTNNFPYLEK	788	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15370	72.226	2	1539.7205	1539.7205	K	T	132	146
PSM	VLEEGGFFEEK	789	sp|Q9NR12-2|PDLI7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16282	76.954	2	1282.6081	1282.6081	K	G	280	291
PSM	VLYVGGLAEEVDDK	790	sp|Q9UNP9-2|PPIE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=18325	88.823	2	1505.7613	1505.7613	R	V	7	21
PSM	VNSNSLDLPSSSDTTHASK	791	sp|Q8NEY1-5|NAV1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=9385	44.558	3	2038.8845	2038.8845	K	V	413	432
PSM	VQVAALQASPPLDQDDR	792	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15319	71.988	2	1821.9221	1821.9221	K	A	99	116
PSM	VSEGGPAEIAGLQIGDK	793	sp|O14907|TX1B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17268	82.543	2	1639.8417	1639.8417	R	I	60	77
PSM	VSVVSPDHVSDSTVSAR	794	sp|Q6NV74|K121L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=10714	50.518	2	1820.8306	1820.8306	K	I	181	198
PSM	VSYLVFDEADR	795	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=18004	86.84	2	1312.6299	1312.6299	R	M	282	293
PSM	VTSRGPDEEAVVDLGK	796	sp|Q9Y6M7-14|S4A7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21	ms_run[2]:scan=13093	61.174	2	1750.8139	1750.8139	R	T	17	33
PSM	VVHASGDASYSAGDSGDAAAQPAFTGIK	797	sp|Q9Y2J2-2|E41L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=14634	68.577	3	2729.197	2729.1970	R	G	641	669
PSM	VVNTDHGSPEQLQIPVTDSGR	798	sp|Q6IQ49-3|SDE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:21	ms_run[2]:scan=14229	66.621	2	2328.0747	2328.0747	R	H	176	197
PSM	VWVLEEEGDEER	799	sp|Q0VD83-3|APOBR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16185	76.448	2	1488.6733	1488.6733	K	E	397	409
PSM	YCGDYDSFFESK	800	sp|Q9UJC5|SH3L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4	ms_run[2]:scan=17609	84.532	2	1516.5817	1516.5817	R	E	75	87
PSM	YFDSGDYNMAK	801	sp|P56211-2|ARP19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:35	ms_run[2]:scan=7629	36.932	2	1325.5234	1325.5234	K	A	43	54
PSM	YLAEVACGDDR	802	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:4	ms_run[2]:scan=7968	38.367	2	1267.5503	1267.5503	R	K	128	139
PSM	YVTKPNSDDEDDGDEK	803	sp|P51784|UBP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21	ms_run[2]:scan=1567	10.036	2	1905.7153	1905.7153	R	E	642	658
PSM	QLHEYETELEDER	804	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28	ms_run[1]:scan=17369	83.19135333333334	2	1672.7214	1672.7211	R	K	1597	1610
PSM	QNCELFEQLGEYK	805	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=21839	115.10040166666666	2	1639.7173	1639.7183	K	F	414	427
PSM	GVVDSDDLPLNVSR	806	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=24781	141.02220666666668	2	1485.749604	1484.747087	K	E	435	449
PSM	QKFNDSEGDDTEETEDYR	807	sp|Q9NYF8|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:21	ms_run[1]:scan=8706	41.57074333333333	2	2258.819049	2256.833211	K	Q	392	410
PSM	NLTSSSLNDISDKPEK	808	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:21	ms_run[1]:scan=10874	51.19446833333333	2	1827.814133	1826.829904	R	D	252	268
PSM	NLTSSSLNDISDKPEK	809	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:21	ms_run[1]:scan=12891	60.278365	2	1827.813321	1826.829904	R	D	252	268
PSM	NLTSSSLNDISDKPEK	810	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	5-UNIMOD:21	ms_run[1]:scan=10691	50.41845333333333	2	1827.814133	1826.829904	R	D	252	268
PSM	NLTSSSLNDISDKPEK	811	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:21	ms_run[1]:scan=11886	55.699940000000005	2	1826.827773	1826.829904	R	D	252	268
PSM	DSLRSTPSHGSVSSLNSTGSLSPK	812	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	22-UNIMOD:21	ms_run[1]:scan=11976	56.070393333333335	2	2481.136054	2480.154426	K	H	234	258
PSM	LDETDDPDDYGDR	813	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6625	32.40889666666667	2	1524.582346	1524.585226	R	E	401	414
PSM	EREESEDELEEANGNNPIDIEVDQNK	814	sp|Q9UKL0|RCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	5-UNIMOD:21	ms_run[1]:scan=17258	82.47693333333333	3	3095.272708	3094.288807	R	E	256	282
PSM	KNSDEENICELSEQR	815	sp|Q9NS62|THSD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:21,9-UNIMOD:4	ms_run[1]:scan=11392	53.53631333333333	2	1929.766424	1929.777551	R	G	461	476
PSM	YNLDASEEEDSNKK	816	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:21	ms_run[1]:scan=6012	29.698538333333335	2	1720.677694	1720.682906	K	K	183	197
PSM	AAAGEEETAAAGSPGRK	817	sp|Q9NS37|ZHANG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:21	ms_run[2]:scan=1200	8.369	2	1651.7203	1651.7203	R	Q	38	55
PSM	AALEDTLAETEAR	818	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13770	64.432	2	1388.6783	1388.6783	K	F	318	331
PSM	AAPEASSPPASPLQHLLPGK	819	sp|Q96TA1-2|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=19298	95.202	2	2126.9803	2126.9803	K	A	673	693
PSM	AASPPLKGSVSSEASELDK	820	sp|Q8TDB6|DTX3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=12774	59.712	2	1951.914	1951.9140	K	K	537	556
PSM	ADTLGELDLER	821	sp|Q86TX2|ACOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16279	76.938	2	1230.6092	1230.6092	R	A	54	65
PSM	AETEEAAHSVSQEMSVNSPTAQESQR	822	sp|Q9NUA8-2|ZBT40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=6602	32.313	3	2898.1975	2898.1975	K	N	126	152
PSM	AEVAAEFLNDR	823	sp|Q8TBC4-2|UBA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15497	72.888	2	1233.599	1233.5990	K	V	111	122
PSM	AGLESGAEPGDGDSDTTKK	824	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:21	ms_run[2]:scan=3558	19.178	2	1913.7892	1913.7892	K	K	481	500
PSM	AGMSAEQAQGLLEK	825	sp|Q9Y2Q3-4|GSTK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35	ms_run[2]:scan=9785	46.417	2	1447.6977	1447.6977	K	I	102	116
PSM	AGQSAAGAAPGGGVDTR	826	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2480	14.268	3	1441.691	1441.6910	R	D	8	25
PSM	ALSASHTDLAH	827	sp|Q07866-6|KLC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=5081	25.728	2	1201.5129	1201.5129	R	-	618	629
PSM	ALYESELADAR	828	sp|Q03252|LMNB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12592	58.851	2	1236.5986	1236.5986	K	R	94	105
PSM	APSHSESALNNDSK	829	sp|Q9NZB2-4|F120A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=1239	8.5347	2	1535.6253	1535.6253	R	T	1027	1041
PSM	ASSEGGTAAGAGLDSLHK	830	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21	ms_run[2]:scan=9080	43.237	2	1707.7465	1707.7465	K	N	309	327
PSM	AVEVQGPSLESGDHGK	831	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=8120	39.006	2	1688.7407	1688.7407	R	I	288	304
PSM	AVMDDFAAFVEK	832	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35	ms_run[2]:scan=18885	92.482	2	1357.6224	1357.6224	K	C	570	582
PSM	AVMDDFAAFVEK	833	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35	ms_run[2]:scan=19158	94.221	2	1357.6224	1357.6224	K	C	570	582
PSM	AVMDDFAAFVEK	834	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=21782	114.6	2	1341.6275	1341.6275	K	C	570	582
PSM	AVTAYSPEDEKK	835	sp|O60268-2|K0513_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=3259	17.854	2	1416.6174	1416.6174	R	G	274	286
PSM	CDSGFALDSEER	836	sp|P35555|FBN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:4	ms_run[2]:scan=10597	49.993	2	1384.5565	1384.5565	R	N	1055	1067
PSM	CMSDENLPYDLR	837	sp|Q14643-4|ITPR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:4,2-UNIMOD:35	ms_run[2]:scan=13939	65.205	2	1527.6334	1527.6334	R	A	753	765
PSM	DDKEEEEDGTGSPQLNNR	838	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=2748	15.499	2	2111.8281	2111.8281	K	-	393	411
PSM	DFAYGETDPLIR	839	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18114	87.534	2	1395.667	1395.6670	R	K	241	253
PSM	DGDDVIIIGVFK	840	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=22507	120.78	2	1289.6867	1289.6867	K	G	302	314
PSM	DHTVSGDEDYCPR	841	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=5305	26.642	2	1629.5767	1629.5767	K	S	939	952
PSM	DKSPSSLLEDAK	842	sp|P42684-4|ABL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=11978	56.083	2	1368.6174	1368.6174	R	E	593	605
PSM	DLAEVGEGGGHSQAR	843	sp|Q9C0C2-2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=5029	25.529	2	1561.6522	1561.6522	K	E	688	703
PSM	DMESPTKLDVTLAK	844	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=13144	61.429	2	1642.7525	1642.7525	K	D	277	291
PSM	DMESPTKLDVTLAK	845	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=14220	66.573	2	1642.7525	1642.7525	K	D	277	291
PSM	DNVESAQASEVKPLR	846	sp|Q12864|CAD17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=8888	42.362	2	1721.7985	1721.7985	K	S	817	832
PSM	DTFEHDPSESIDEFNK	847	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=15603	73.409	2	1988.7677	1988.7677	K	S	187	203
PSM	DYSTLTSVSSHDSR	848	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=9027	42.979	2	1633.6621	1633.6621	R	L	1439	1453
PSM	DYSTLTSVSSHDSR	849	sp|P16144-4|ITB4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=9340	44.373	2	1633.6621	1633.6621	R	L	1439	1453
PSM	EAGLSQSHDDLSNATATPSVR	850	sp|O14523|C2C2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=11531	54.166	2	2234.9805	2234.9805	K	K	656	677
PSM	EDSLEAGLPLQVR	851	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18455	89.709	2	1425.7464	1425.7464	R	G	400	413
PSM	EFEEDLTGIDDR	852	sp|P09455|RET1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15582	73.306	2	1437.626	1437.6260	K	K	70	82
PSM	EIENLTQQYEEK	853	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11777	55.211	2	1522.7151	1522.7151	K	A	1400	1412
PSM	EKYESFEDPAGTIDK	854	sp|Q6ZNJ1-2|NBEL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=14124	66.1	2	1807.7553	1807.7553	R	F	1955	1970
PSM	EPHSPADQPEQQAESTLTSAETR	855	sp|Q9H2Y7-2|ZN106_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=15029	70.575	3	2588.1028	2588.1028	K	G	553	576
PSM	ETNLDSLPLVDTHSK	856	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=17094	81.526	2	1747.803	1747.8030	R	R	425	440
PSM	ETPHSPGVEDAPIAK	857	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21	ms_run[2]:scan=7492	36.314	2	1626.7291	1626.7291	R	V	184	199
PSM	FAQDVSQDDLIR	858	sp|Q96H20-2|SNF8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13860	64.825	2	1405.6838	1405.6838	K	A	135	147
PSM	FDDESAEEIR	859	sp|Q5SWX8-4|ODR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8506	40.735	2	1209.515	1209.5150	K	D	330	340
PSM	FEDEDSDDVPR	860	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7087	34.41	2	1322.5263	1322.5263	K	K	698	709
PSM	FNPETDYLTGTDGK	861	sp|Q99798|ACON_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14796	69.389	2	1556.6995	1556.6995	K	K	507	521
PSM	FNQDPEAVDEDR	862	sp|O95260-2|ATE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6947	33.802	2	1433.6059	1433.6059	R	S	453	465
PSM	FSTYTSDKDENK	863	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=3183	17.501	2	1513.5974	1513.5974	R	L	355	367
PSM	GDDGIFDDNFIEER	864	sp|O60493-2|SNX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=20438	103.63	2	1640.6954	1640.6954	R	K	73	87
PSM	GEELGKSSDLEDNR	865	sp|O43166-3|SI1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=6211	30.617	2	1627.6727	1627.6727	K	S	304	318
PSM	GEGPEFDVNLSK	866	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14577	68.308	2	1290.6092	1290.6092	K	A	1013	1025
PSM	GGEYGFGAAFDADGDR	867	sp|Q15124|PGM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17310	82.823	2	1603.6539	1603.6539	K	Y	283	299
PSM	GGIDNPAITSDQELDDKK	868	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=11160	52.505	2	1994.8834	1994.8834	K	M	1209	1227
PSM	GGKPEPPAMPQPVPTA	869	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=7655	37.042	2	1668.7583	1668.7583	K	-	228	244
PSM	GKDSLSDDGVDLK	870	sp|P07948-2|LYN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=9731	46.141	2	1427.6181	1427.6181	K	T	8	21
PSM	GNSRPGTPSAEGGSTSSTLR	871	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=4906	25.045	3	1997.8804	1997.8804	R	A	383	403
PSM	GSEQESVKEFLAK	872	sp|P17612|KAPCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=13414	62.676	2	1530.6967	1530.6967	K	A	10	23
PSM	GSQTGTSIGGDAR	873	sp|O15061-2|SYNEM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1669	10.489	2	1205.5636	1205.5636	R	R	383	396
PSM	GTAMPGEEVLESSQEALHVTER	874	sp|O60565|GREM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=15204	71.424	2	2465.0781	2465.0781	R	K	65	87
PSM	GTDSQAMEEEKPEGHV	875	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=3865	20.532	2	1838.703	1838.7030	K	-	442	458
PSM	GTSPRPPEGGLGYSQLGDDDLK	876	sp|Q9UQ88-8|CD11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21	ms_run[2]:scan=16000	75.473	3	2338.0478	2338.0478	R	E	122	144
PSM	GVTFNVTTVDTK	877	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14194	66.444	2	1280.6612	1280.6612	K	R	38	50
PSM	GVVDSDDLPLNVSR	878	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13950	65.256	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	879	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=26280	154.14	2	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	880	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=19084	93.765	2	1484.7471	1484.7471	K	E	435	449
PSM	HGSGADSDYENTQSGDPLLGLEGK	881	sp|Q9Y2X7|GIT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=17887	86.13	3	2526.0548	2526.0548	R	R	590	614
PSM	HTSAEEEEPPPVK	882	sp|Q9BZ95-3|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=3221	17.688	2	1528.6447	1528.6447	R	I	455	468
PSM	IASHDFDPTDSSSK	883	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=8128	39.038	2	1585.6297	1585.6297	R	K	39	53
PSM	IDTIEIITDR	884	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17500	83.933	2	1187.6398	1187.6398	K	Q	138	148
PSM	IENLELVPVDSK	885	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16611	78.85	2	1354.7344	1354.7344	R	W	405	417
PSM	ISPDGEEGYPGELK	886	sp|Q96C23|GALM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11478	53.929	2	1489.6937	1489.6937	R	V	132	146
PSM	ITAAQHSVTGSAVSK	887	sp|Q13492-3|PICAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=3740	19.957	2	1535.7345	1535.7345	R	T	10	25
PSM	IVSSSDVGHDEYSTQSLVK	888	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:21	ms_run[2]:scan=12776	59.719	2	2129.9518	2129.9518	K	K	766	785
PSM	IVTDSDSKTEELR	889	sp|Q9H2G2-2|SLK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=6396	31.4	2	1571.708	1571.7080	K	F	812	825
PSM	KCSTQLLVSEDPK	890	sp|Q6PJW8-2|CNST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=9510	45.098	2	1583.7266	1583.7266	R	E	291	304
PSM	KDEGSYSLEEPK	891	sp|P18827|SDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=7494	36.318	2	1460.6072	1460.6072	K	Q	281	293
PSM	KSSADTEFSDECTTAER	892	sp|Q9H6S0|YTDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=7137	34.616	3	2012.767	2012.7670	R	V	1200	1217
PSM	LAEAQIEELR	893	sp|Q9NR28-2|DBLOH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13347	62.35	2	1170.6245	1170.6245	K	Q	155	165
PSM	LAQAEEQLEQETR	894	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10631	50.144	2	1543.7478	1543.7478	K	E	1840	1853
PSM	LDSDRVSSASSTAER	895	sp|P55196|AFAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=3430	18.638	3	1659.7101	1659.7101	R	G	555	570
PSM	LDSYVNADHDLYCNTR	896	sp|Q9NWZ8|GEMI8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=14069	65.831	2	2034.8143	2034.8143	R	R	168	184
PSM	LEESYDMESVLR	897	sp|P35237|SPB6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=12323	57.646	2	1485.6657	1485.6657	K	N	276	288
PSM	LENVSQLSLDKSPTEK	898	sp|Q86W56-3|PARG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=13165	61.522	3	1866.8976	1866.8976	K	S	18	34
PSM	LEQLFQDEVAK	899	sp|Q15149-6|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15511	72.962	2	1318.6769	1318.6769	K	A	2520	2531
PSM	LIQSHPESAEDLQEK	900	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=8310	39.843	2	1802.8088	1802.8088	R	C	1279	1294
PSM	LKSEDGVEGDLGETQSR	901	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=8063	38.773	3	1898.8259	1898.8259	R	T	133	150
PSM	LPIEETLEDSPQTR	902	sp|Q9UKG1|DP13A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15253	71.648	2	1626.8101	1626.8101	K	S	7	21
PSM	LTEVPVEPVLTVHPESK	903	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:21	ms_run[2]:scan=17910	86.265	2	1952.986	1952.9860	K	S	537	554
PSM	LVSDGNINSDR	904	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4231	22.138	2	1188.5735	1188.5735	R	I	1235	1246
PSM	LYPIANGNNQSPVDIK	905	sp|P00915|CAH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15533	73.074	2	1741.8999	1741.8999	K	T	20	36
PSM	MEPGEELEEEGSPGGR	906	sp|Q9H3H3|CK068_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:35	ms_run[2]:scan=8863	42.259	2	1717.7101	1717.7101	-	E	1	17
PSM	MEVEDGLGSPKPEEIK	907	sp|Q71F56|MD13L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=11255	52.929	2	1852.8166	1852.8166	K	D	915	931
PSM	NEKPTQSVSSPEATSGSTGSVEK	908	sp|Q9BZ95-3|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=4708	24.21	2	2386.0537	2386.0537	R	K	552	575
PSM	NFYESDDDQKEK	909	sp|O00203-3|AP3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=3976	20.997	2	1596.5981	1596.5981	K	T	223	235
PSM	NFYESDDDQKEK	910	sp|O00203-3|AP3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=4908	25.051	2	1596.5981	1596.5981	K	T	223	235
PSM	NLTSSSLNDISDKPEK	911	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=10349	48.903	2	1826.8299	1826.8299	R	D	252	268
PSM	NPDVDTSFLPDR	912	sp|Q9Y247|FA50B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15607	73.428	2	1374.6416	1374.6416	K	D	145	157
PSM	NQALQTTKTPVEK	913	sp|Q86YS7|C2CD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=2756	15.539	2	1536.7549	1536.7549	K	S	799	812
PSM	NQVALNPQNTVFDAK	914	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15596	73.375	2	1657.8424	1657.8424	K	R	57	72
PSM	NSLEPQTTVVHNATDGIK	915	sp|Q13555-9|KCC2G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=11715	54.941	2	2002.9361	2002.9361	K	G	337	355
PSM	NVDGVNYASITR	916	sp|Q9UBR2|CATZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12186	57.064	2	1307.647	1307.6470	R	N	70	82
PSM	PALNSPVERPSSDQEEGETSAQTER	917	sp|Q9UKV5|AMFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=8699	41.538	3	2793.209	2793.2090	R	V	512	537
PSM	PLYETIEDNDVK	918	sp|Q9NP92|RT30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13850	64.783	2	1434.6878	1434.6878	K	G	400	412
PSM	PQEAAVAPEKPPASDETK	919	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:21	ms_run[2]:scan=5117	25.857	3	1943.8878	1943.8878	K	A	239	257
PSM	PQPAPADGADPPPAEEPEARPDGEGSPGK	920	sp|P11274-2|BCR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	26-UNIMOD:21	ms_run[2]:scan=7987	38.445	3	2915.2611	2915.2611	R	A	97	126
PSM	PSENEVPQQAIDSHSVK	921	sp|O75410-7|TACC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:21	ms_run[2]:scan=8770	41.869	2	1943.8626	1943.8626	K	N	72	89
PSM	RLEISPDSSPER	922	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=8345	40.004	2	1544.6273	1544.6273	R	A	147	159
PSM	RLEISPDSSPER	923	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=8578	41.038	2	1544.6273	1544.6273	R	A	147	159
PSM	RTSTPVIMEGVQEETDTR	924	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=10640	50.181	3	2143.9457	2143.9457	R	D	657	675
PSM	SAEDVSTVPTQPDNPFSHPDK	925	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=15088	70.853	2	2347.0006	2347.0006	R	L	393	414
PSM	SDGSLEDGDDVHR	926	sp|Q9NRX5|SERC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=3291	17.983	2	1480.5467	1480.5467	R	A	361	374
PSM	SDLVNEEATGQFR	927	sp|P06731-2|CEAM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12457	58.256	2	1464.6845	1464.6845	K	V	127	140
PSM	SEAGHASSPDSEVTSLCQK	928	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=9934	47.094	2	2068.8409	2068.8409	K	E	353	372
PSM	SEEKISDSEGFK	929	sp|P23246-2|SFPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=6531	31.996	2	1434.5916	1434.5916	R	A	268	280
PSM	SELSQSQHEVNEDSR	930	sp|P23508|CRCM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=3706	19.8	2	1823.7323	1823.7323	R	S	115	130
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	931	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=16119	76.108	3	2927.271	2927.2710	K	K	226	252
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	932	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=16668	79.161	3	2927.271	2927.2710	K	K	226	252
PSM	SKETAGLVEGEPTGAGGGSLSASR	933	sp|Q8TF65|GIPC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=11544	54.218	3	2297.0536	2297.0536	K	A	13	37
PSM	SKSEMSYIDGEK	934	sp|Q9BX66-12|SRBS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=4611	23.792	2	1468.5793	1468.5793	R	V	268	280
PSM	SKTPTGPELDTSYK	935	sp|Q8NF91-4|SYNE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=8640	41.29	2	1602.7178	1602.7178	R	G	8310	8324
PSM	SLSIPEDSVAADPQKEDR	936	sp|Q96N96-6|SPT13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=13460	62.915	2	2035.9099	2035.9099	R	V	600	618
PSM	SMSVDETDKSPCEAGR	937	sp|Q53SF7-4|COBL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21,2-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=2509	14.381	2	1863.7016	1863.7016	K	V	324	340
PSM	SMVDASEEKTPEQIMQEK	938	sp|Q9H3R5|CENPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:35,10-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=6065	29.927	3	2190.9062	2190.9062	K	Q	59	77
PSM	SPMSTNSSVHTGSDVEQDAEK	939	sp|Q9ULU4-4|PKCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=5546	27.662	3	2300.9104	2300.9104	R	K	56	77
PSM	SSDAKPLPASYPAEPR	940	sp|Q9P266|JCAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21	ms_run[2]:scan=9802	46.491	2	1764.8084	1764.8084	R	E	982	998
PSM	SSEPVQHEESIR	941	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21	ms_run[2]:scan=3975	20.993	2	1476.6246	1476.6246	R	K	929	941
PSM	SSFNVSDVARPEAAGSPPEEGGCTEGTPAK	942	sp|Q92619|HMHA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=14516	68.001	3	3083.3179	3083.3179	K	D	577	607
PSM	SSGESSPSEHSSSGVSTPCLK	943	sp|Q9Y3M8-5|STA13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=7221	34.975	3	2185.8835	2185.8835	K	E	321	342
PSM	SSLPLDHGSPAQENPESEK	944	sp|Q5VZ89-7|DEN4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=10154	48.055	3	2100.9001	2100.9001	R	S	1326	1345
PSM	SSQHGGSSTSLASTK	945	sp|O15075-3|DCLK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=1139	8.1214	2	1513.641	1513.6410	R	V	39	54
PSM	SSSLGSTPHEELER	946	sp|Q9NRA8-2|4ET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=8488	40.658	2	1607.6828	1607.6828	R	L	188	202
PSM	SSTLETTKSPLIIDK	947	sp|Q15652-2|JHD2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=12881	60.229	2	1711.8645	1711.8645	R	N	474	489
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTSQVTR	948	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=17252	82.45	3	3856.8619	3856.8619	R	G	889	925
PSM	STEAESVLHSEGSR	949	sp|Q9H792|PEAK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=8887	42.359	2	1567.6515	1567.6515	R	R	902	916
PSM	STNMASVDKGESAPVR	950	sp|Q15047-3|SETB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=3170	17.439	2	1743.7499	1743.7499	K	K	1179	1195
PSM	STPSHGSVSSLNSTGSLSPK	951	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=9728	46.125	3	2008.9103	2008.9103	R	H	238	258
PSM	STSSAMSGSHQDLSVIQPIVK	952	sp|Q96QF0-8|RAB3I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=16096	75.984	2	2267.0505	2267.0505	K	D	66	87
PSM	STSSAMSGSHQDLSVIQPIVK	953	sp|Q96QF0-8|RAB3I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=16137	76.207	3	2267.0505	2267.0505	K	D	66	87
PSM	STVSETYLSKPSIAK	954	sp|Q7Z6B7-2|SRGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=12701	59.373	2	1689.8226	1689.8226	K	R	413	428
PSM	SYIGSNHSSLGSMSPSNMEGYSK	955	sp|P78310-7|CXAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21,13-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=9701	45.971	3	2530.9982	2530.9982	R	T	252	275
PSM	TALINSTGEEVAMR	956	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:35	ms_run[2]:scan=10601	50.013	2	1506.7348	1506.7348	R	K	528	542
PSM	TDCSSGDASRPSSDNADSPK	957	sp|Q9NZN5|ARHGC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=657	5.9896	2	2132.7954	2132.7954	R	S	292	312
PSM	TEDLEATSEHFK	958	sp|Q9BV40|VAMP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=8561	40.968	2	1485.6025	1485.6025	K	T	48	60
PSM	TEEDETSEDANCLALSGHDK	959	sp|P51003|PAPOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9988	47.341	3	2299.8788	2299.8788	K	T	666	686
PSM	TGLFQTSKEDELSESK	960	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=14734	69.088	2	1877.8296	1877.8296	R	E	44	60
PSM	TTSLGDSLNAHSAAEK	961	sp|Q13796|SHRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=8155	39.153	2	1680.7356	1680.7356	R	A	845	861
PSM	TVDNFVALATGEK	962	sp|P23284|PPIB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18835	92.153	2	1363.6983	1363.6983	K	G	72	85
PSM	TVTAMDVVYALK	963	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=18215	88.174	2	1325.6901	1325.6901	K	R	81	93
PSM	VAAIEALNDGELQK	964	sp|Q8IZP2|ST134_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15352	72.138	2	1469.7726	1469.7726	K	A	115	129
PSM	VAASGAQDPEKSPDR	965	sp|Q1MSJ5-2|CSPP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=1030	7.6773	2	1606.6988	1606.6988	R	L	119	134
PSM	VAEQAANDLR	966	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3814	20.318	2	1085.5465	1085.5465	R	A	1553	1563
PSM	VEEEDGKTATQPLLK	967	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=8522	40.804	2	1736.8234	1736.8234	K	K	977	992
PSM	VEMYSGSDDDDDFNKLPK	968	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=13662	63.897	2	2169.845	2169.8450	K	K	131	149
PSM	VEPGLGADNSVVR	969	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10020	47.475	2	1311.6783	1311.6783	K	F	1020	1033
PSM	VESDLKGPEVDIEGPEGK	970	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=14866	69.739	2	1976.898	1976.8980	K	L	4484	4502
PSM	VHSPSGALEECYVTEIDQDK	971	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=18070	87.282	3	2355.993	2355.9930	K	Y	2360	2380
PSM	VIENADGSEEETDTR	972	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=3810	20.298	2	1743.6836	1743.6836	R	D	1947	1962
PSM	VLCELADLQDK	973	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4	ms_run[2]:scan=15619	73.484	2	1302.649	1302.6490	K	E	74	85
PSM	VNVDAVGGEALGR	974	sp|P02042|HBD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12353	57.776	2	1255.6521	1255.6521	K	L	19	32
PSM	VNVDEVGGEALGR	975	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14179	66.368	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	976	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16906	80.49	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	977	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17091	81.511	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	978	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17449	83.633	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	979	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17630	84.663	2	1313.6575	1313.6575	K	L	19	32
PSM	VSQGQLVVMQPEK	980	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:35	ms_run[2]:scan=7965	38.352	2	1457.7548	1457.7548	K	F	350	363
PSM	VSTLAGPSSDDENEEESKPEK	981	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=6212	30.62	2	2326.969	2326.9690	K	E	624	645
PSM	VVVDGSGQCHSTDTVK	982	sp|Q9HAU4|SMUF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3600	19.359	2	1767.7499	1767.7499	K	N	39	55
PSM	YGLQDSDEEEEEHPSK	983	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=7064	34.313	2	1970.7419	1970.7419	K	T	866	882
PSM	YGLQDSDEEEEEHPSK	984	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=7326	35.439	2	1970.7419	1970.7419	K	T	866	882
PSM	YLAEVAAGDDKK	985	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=4544	23.547	2	1358.6119	1358.6119	R	G	128	140
PSM	YNILGTNTIMDK	986	sp|Q00839-2|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:35	ms_run[2]:scan=15096	70.892	2	1397.6861	1397.6861	K	M	506	518
PSM	YNLDASEEEDSNKK	987	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=6096	30.072	2	1720.6829	1720.6829	K	K	183	197
PSM	YQSHDYAFSSVEK	988	sp|Q9UHG3-2|PCYOX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=11138	52.411	2	1639.6556	1639.6556	R	L	92	105
PSM	YSQVLANGLDNK	989	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10842	51.057	2	1320.6674	1320.6674	K	L	95	107
PSM	YVMLPVADQDQCIR	990	sp|P00738-2|HPT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=15363	72.195	2	1722.8069	1722.8069	K	H	239	253
PSM	EEEVERPVSSPGD	991	sp|O43149|ZZEF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	10-UNIMOD:21	ms_run[1]:scan=5039	25.56648	2	1508.6000	1508.6027	R	P	2435	2448
PSM	QEASTGQSPEDHASLAPPLSPDHSSLEAK	992	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=15499	72.90017166666667	3	3048.3332	3048.3344	R	D	452	481
PSM	ILDSVGIEADDDR	993	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=12412	58.057435	2	1416.674797	1416.673253	K	L	26	39
PSM	KTLDELSQGTTTVK	994	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	2-UNIMOD:21	ms_run[1]:scan=9355	44.440785	2	1599.774958	1599.775684	R	E	1542	1556
PSM	SLSSSLQAPVVSTVGMQR	995	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:21,16-UNIMOD:35	ms_run[1]:scan=18134	87.657595	2	1942.932737	1941.923093	R	L	11	29
PSM	RSSSDTAAYPAGTTAVGTPGNGTPCSQDTSFSSSR	996	sp|O15047|SET1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	2-UNIMOD:21,25-UNIMOD:4	ms_run[1]:scan=13264	61.98009666666667	3	3558.480409	3557.500214	R	Q	219	254
PSM	QTALLDADDPVSQLHK	997	sp|Q06330|SUH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=19070	93.66163333333334	2	1732.8620	1732.8627	K	C	270	286
PSM	LIDEVIEDTR	998	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=14956	70.18496333333333	2	1201.609622	1201.619033	K	Y	694	704
PSM	KGSSTDISEDWEK	999	sp|Q9NW68|BSDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:21	ms_run[1]:scan=10363	48.961715000000005	2	1562.654730	1560.634499	K	D	385	398
PSM	VALVITDGQTDSR	1000	sp|Q2UY09|COSA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=11706	54.904968333333336	2	1373.714723	1373.715058	K	D	898	911
PSM	CDSSPDSAEDVRK	1001	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=4481	23.283408333333334	2	1527.5526	1527.5543	K	V	132	145
PSM	DHSPTPSVFNSDEER	1002	sp|Q6UN15|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:21	ms_run[1]:scan=10074	47.706873333333334	2	1796.704989	1795.705038	R	Y	490	505
PSM	KGGSYSQAASSDSAQGSDMSLTACK	1003	sp|P18462|1A25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	17-UNIMOD:21,19-UNIMOD:35,20-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=6166	30.410986666666663	3	2670.009051	2669.002359	R	V	340	365
PSM	AGMSAEQAQGLLEK	1004	sp|Q9Y2Q3|GSTK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:35	ms_run[1]:scan=9795	46.46219	2	1447.697473	1447.697694	K	I	145	159
PSM	KGGSYTQAASSDSAQGSDVSLTACK	1005	sp|P30443|1A01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=9849	46.706401666666665	3	2556.076918	2555.084692	R	V	340	365
PSM	MFTEDQGVDDR	1006	sp|P23497|SP100_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:35	ms_run[1]:scan=5341	26.795704999999998	2	1326.533731	1327.535045	R	L	37	48
PSM	CDSGFALDSEER	1007	sp|P35555|FBN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	1-UNIMOD:4	ms_run[1]:scan=10713	50.514518333333335	2	1386.582639	1384.556509	R	N	1055	1067
PSM	FASEASGYQDNIAR	1008	sp|P17661|DESM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9705	45.99475	2	1527.692070	1527.695386	R	L	356	370
PSM	LEEKSEDQDLQGLK	1009	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:21	ms_run[1]:scan=9134	43.49382666666666	2	1712.784554	1710.771327	R	D	21	35
PSM	AATSDLEHYDK	1010	sp|P80303-2|NUCB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=4396	22.879	2	1328.5286	1328.5286	K	T	161	172
PSM	ADKASDTSSETVFGK	1011	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=7100	34.466	2	1621.6873	1621.6873	R	R	527	542
PSM	AEQSLHDLQER	1012	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=6710	32.771	2	1404.6035	1404.6035	R	L	254	265
PSM	AGALNSNDAFVLK	1013	sp|P06396-2|GELS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15763	74.218	2	1318.6881	1318.6881	K	T	534	547
PSM	ALEDMFDALEGK	1014	sp|P23786|CPT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35	ms_run[2]:scan=17600	84.484	2	1353.6122	1353.6122	K	S	643	655
PSM	ALPSEDEEGQDDKDFYLR	1015	sp|Q8NF91-4|SYNE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=15817	74.514	2	2205.9103	2205.9103	R	G	8231	8249
PSM	ALSQLAEVEEK	1016	sp|O60749-2|SNX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12205	57.14	2	1215.6347	1215.6347	R	I	246	257
PSM	APPGLTPAPASPPVLPR	1017	sp|C9J069|AJM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=16949	80.722	2	1716.8964	1716.8964	R	R	99	116
PSM	ASLEAAIADAEQR	1018	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17501	83.936	3	1343.6681	1343.6681	R	G	329	342
PSM	ASQSRPNSSALETLGGEK	1019	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=11356	53.387	2	1910.8735	1910.8735	K	L	447	465
PSM	ASSEDTLNKPGSTAASGVVR	1020	sp|Q5M775-2|CYTSB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=8455	40.492	2	2025.9368	2025.9368	R	L	53	73
PSM	AVMDDFAAFVEK	1021	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35	ms_run[2]:scan=18732	91.468	2	1357.6224	1357.6224	K	C	570	582
PSM	AVSPQSTKPMAESITYAAVAR	1022	sp|Q6GTX8-3|LAIR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=13772	64.439	3	2273.0763	2273.0763	R	H	248	269
PSM	AVTPVPTKTEEVSNLK	1023	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=10571	49.87	2	1791.9019	1791.9019	R	T	447	463
PSM	AYAALAALEK	1024	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15727	74.053	2	1019.5651	1019.5651	K	L	578	588
PSM	CDGDFDCEDR	1025	sp|P98160|PGBM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=3846	20.455	2	1287.4132	1287.4132	R	T	344	354
PSM	CDLELETNGR	1026	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:4	ms_run[2]:scan=8361	40.075	2	1205.5347	1205.5347	R	D	10	20
PSM	CTLPEHESPSQDISDACEAESTER	1027	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:4,8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13801	64.563	3	2827.095	2827.0950	R	C	670	694
PSM	CTVDGSPHELESR	1028	sp|Q9NRL3|STRN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=6316	31.069	2	1565.6181	1565.6181	R	R	337	350
PSM	CVSVQTDPTDEIPTKK	1029	sp|P18583-2|SON_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10710	50.504	3	1896.854	1896.8540	R	S	92	108
PSM	DAGTIAGLNVLR	1030	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18328	88.839	2	1198.667	1198.6670	K	I	160	172
PSM	DDISEIQSLASDHSGR	1031	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=17889	86.142	2	1808.7578	1808.7578	R	S	287	303
PSM	DDISEIQSLASDHSGR	1032	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=17892	86.162	2	1808.7578	1808.7578	R	S	287	303
PSM	DEVLEVLEDGR	1033	sp|Q9H6S3-2|ES8L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=19371	95.724	2	1272.6198	1272.6198	K	Q	128	139
PSM	DGKSPTVPCLQEEAGEPLGGK	1034	sp|A1L390-2|PKHG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=15618	73.481	3	2248.0083	2248.0083	R	G	492	513
PSM	DKSPSSLLEDAK	1035	sp|P42684-4|ABL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=12196	57.104	2	1368.6174	1368.6174	R	E	593	605
PSM	DMESPTKLDVTLAK	1036	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=13585	63.504	2	1642.7525	1642.7525	K	D	277	291
PSM	DNPSPEPQLDDIKR	1037	sp|Q96JC9-2|EAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=10659	50.269	2	1702.7563	1702.7563	K	E	61	75
PSM	DSLEASPVLEDNSSHK	1038	sp|Q01484|ANK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=9660	45.766	2	1806.7673	1806.7673	K	T	2435	2451
PSM	DTDDVPMILVGNK	1039	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18669	91.068	2	1415.6966	1415.6966	K	C	86	99
PSM	DVEDGAFLLR	1040	sp|Q5T5P2-3|SKT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18202	88.09	2	1133.5717	1133.5717	K	Q	433	443
PSM	DYELLCLDGTR	1041	sp|P02787|TRFE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4	ms_run[2]:scan=19019	93.317	2	1353.6235	1353.6235	K	K	577	588
PSM	DYEPPSPSPAPGAPPPPPQR	1042	sp|P55196|AFAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=10501	49.56	3	2132.9568	2132.9568	R	N	1691	1711
PSM	EALGLGPPAAQLTPPPAPVGLR	1043	sp|Q8IY67|RAVR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:21	ms_run[2]:scan=21047	108.57	2	2201.161	2201.1610	R	G	451	473
PSM	EERSPQTLAPVGEDAMK	1044	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=8107	38.955	2	1952.8551	1952.8551	K	T	1240	1257
PSM	EGEEPTVYSDEEEPKDESAR	1045	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=8177	39.252	2	2374.9326	2374.9326	K	K	121	141
PSM	ENQEPLRSLEDENK	1046	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=10840	51.051	2	1779.7676	1779.7676	K	E	695	709
PSM	FAIQDISVEETSAK	1047	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17452	83.648	2	1536.7672	1536.7672	R	E	134	148
PSM	FDDGAGGDNEVQR	1048	sp|P35998|PRS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3148	17.348	2	1378.5749	1378.5749	R	T	285	298
PSM	FDELDMSPGDPK	1049	sp|Q9BXI6|TB10A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=9116	43.414	2	1365.5758	1365.5758	K	W	138	150
PSM	FDMELDDLPK	1050	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35	ms_run[2]:scan=15188	71.352	2	1237.5537	1237.5537	K	E	287	297
PSM	FGDLDEQEFVYK	1051	sp|Q8NF50-4|DOCK8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18254	88.409	2	1488.6773	1488.6773	K	E	1704	1716
PSM	FLEESVSMSPEER	1052	sp|P15374|UCHL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=10487	49.502	2	1554.6872	1554.6872	K	A	122	135
PSM	GASSPLITVFTDDK	1053	sp|Q5JPE7-3|NOMO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=20356	103	2	1449.7351	1449.7351	K	G	655	669
PSM	GATTSPGVYELSSR	1054	sp|Q9Y6R7|FCGBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10913	51.358	2	1423.6943	1423.6943	R	C	5251	5265
PSM	GDQPAASGDSDDDEPPPLPR	1055	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10762	50.741	3	2034.8767	2034.8767	R	L	48	68
PSM	GGSPIIQEPEEPSEHR	1056	sp|Q01484|ANK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=9463	44.894	2	1840.7993	1840.7993	R	E	3821	3837
PSM	GKLSAEENPDDSEVPSSSGINSTK	1057	sp|Q9Y5Q9-2|TF3C3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=10230	48.397	3	2527.0963	2527.0963	K	S	40	64
PSM	GLAFTDVDVDSIK	1058	sp|P02751-4|FINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=19542	96.932	2	1378.698	1378.6980	K	I	1637	1650
PSM	GPSAAGEQEPDKESGASVDEVAR	1059	sp|P50579-3|MAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=7727	37.342	3	2365.0071	2365.0071	K	Q	47	70
PSM	GVVDSDDLPLNVSR	1060	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16313	77.092	3	1484.7471	1484.7471	K	E	435	449
PSM	GVVDSDDLPLNVSR	1061	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16836	80.115	3	1484.7471	1484.7471	K	E	435	449
PSM	GYTSDSEVYTDHGR	1062	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=8047	38.705	2	1665.6308	1665.6308	R	P	1315	1329
PSM	HLGGSGSVVPGSPCLDR	1063	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21,12-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13638	63.772	2	1853.7533	1853.7533	R	H	1303	1320
PSM	IANLQTDLSDGLR	1064	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15675	73.782	2	1414.7416	1414.7416	R	L	64	77
PSM	IAQLEEQVEQEAR	1065	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13931	65.171	3	1541.7686	1541.7686	K	E	1823	1836
PSM	IEDVGSDEEDDSGKDK	1066	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=2985	16.606	2	1816.6888	1816.6888	K	K	250	266
PSM	IEESTPVHDSPGK	1067	sp|Q4FZB7|KMT5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:21	ms_run[2]:scan=3102	17.155	2	1474.6341	1474.6341	K	D	626	639
PSM	IEEVLSPEGSPSKSPSK	1068	sp|Q9UEY8-2|ADDG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=9684	45.876	2	1849.871	1849.8710	K	K	636	653
PSM	IEIDNKVSDEEDK	1069	sp|Q03188-2|CENPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=7093	34.436	2	1612.6869	1612.6869	K	T	218	231
PSM	IESGELDPER	1070	sp|P20338|RAB4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6896	33.591	2	1143.5408	1143.5408	K	M	178	188
PSM	IGSTVEDNPLYVLK	1071	sp|P15088|CBPA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=19652	97.695	2	1546.8243	1546.8243	K	I	145	159
PSM	IIEGLQDLDDDVR	1072	sp|O14981|BTAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18665	91.049	2	1499.7468	1499.7468	R	A	435	448
PSM	IPSKEEEADMSSPTQR	1073	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3669	19.649	2	1899.7921	1899.7921	K	T	345	361
PSM	IYISNTFSPSKAEGDSAGTAGTPGGTPAGDK	1074	sp|Q92925-3|SMRD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=15592	73.352	3	3033.3605	3033.3605	R	V	148	179
PSM	KCSLPAEEDSVLEK	1075	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=10916	51.369	2	1683.7427	1683.7427	K	L	634	648
PSM	KDASSSPASTASSASSTSLK	1076	sp|Q04724|TLE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=5323	26.722	2	1948.8627	1948.8627	K	S	281	301
PSM	KDASSSPASTASSASSTSLK	1077	sp|Q04724|TLE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=5337	26.781	3	1948.8627	1948.8627	K	S	281	301
PSM	KDSISEDEMVLR	1078	sp|Q8N5D0-5|WDTC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=10727	50.574	2	1516.648	1516.6480	R	E	508	520
PSM	KEASDPQPEEADGGLK	1079	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=5164	26.057	2	1749.7458	1749.7458	R	S	103	119
PSM	KGGSYSQAASSDSAQGSDVSLTACK	1080	sp|Q09160|1A80_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=9819	46.574	3	2541.069	2541.0690	R	V	340	365
PSM	KGSELTCPEDNK	1081	sp|Q7Z7B0-3|FLIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2646	15.036	2	1456.5905	1456.5905	R	I	369	381
PSM	KGSLSSVTPSPTPENEK	1082	sp|Q92870|APBB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=7570	36.662	2	1836.8506	1836.8506	R	Q	332	349
PSM	KMSGADTVGDDDEASR	1083	sp|P49796-2|RGS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=1386	9.1786	2	1748.656	1748.6560	R	K	13	29
PSM	KQSFDDNDSEELEDK	1084	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=7912	38.117	3	1877.7204	1877.7204	K	D	105	120
PSM	KSEDDSAVPLAK	1085	sp|Q9Y2W2|WBP11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=5007	25.445	2	1338.6068	1338.6068	R	A	599	611
PSM	KSSLDSNSSEMAIMMGADAK	1086	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,11-UNIMOD:35,14-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=8569	41.001	3	2199.8735	2199.8735	K	I	1108	1128
PSM	KSYESSEDCSEAAGSPAR	1087	sp|Q6P6C2-3|ALKB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2941	16.403	2	2009.7674	2009.7674	R	K	359	377
PSM	LDDCGLTEAR	1088	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4	ms_run[2]:scan=7791	37.623	2	1148.5132	1148.5132	R	C	35	45
PSM	LDSSEMDHSENEDYTMSSPLPGK	1089	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=10350	48.907	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LDSSEMDHSENEDYTMSSPLPGK	1090	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=10203	48.28	2	2680.0194	2680.0194	R	K	1174	1197
PSM	LNTFGDEVFNDPK	1091	sp|P11047|LAMC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16704	79.342	2	1494.6991	1494.6991	R	V	256	269
PSM	LPPNTNDEVDEDPTGNK	1092	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7669	37.097	2	1853.8279	1853.8279	R	A	1058	1075
PSM	LSELEAALQR	1093	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15169	71.256	2	1128.6139	1128.6139	K	A	353	363
PSM	LSNSSLCSIEEEHR	1094	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=11506	54.055	2	1739.7186	1739.7186	R	M	372	386
PSM	LSSSDRYSDASDDSFSEPR	1095	sp|Q9NRF8|PYRG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=10507	49.586	3	2199.8594	2199.8594	K	I	561	580
PSM	LVIIESDLER	1096	sp|P09493-8|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16348	77.269	2	1185.6605	1185.6605	K	A	169	179
PSM	LVNCLTGEGEDTR	1097	sp|Q99828|CIB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4	ms_run[2]:scan=8879	42.328	2	1462.6722	1462.6722	R	L	131	144
PSM	MIETAQVDER	1098	sp|Q9UL25|RAB21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35	ms_run[2]:scan=4119	21.645	2	1206.5551	1206.5551	R	A	180	190
PSM	MINLSEPDTIDER	1099	sp|Q14651|PLSI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35	ms_run[2]:scan=13947	65.239	2	1547.7137	1547.7137	K	A	168	181
PSM	NASASFQELEDKK	1100	sp|Q99543-2|DNJC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=11814	55.378	2	1545.6712	1545.6712	R	E	45	58
PSM	NFGEDMDDER	1101	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=2944	16.421	2	1242.4459	1242.4459	K	L	197	207
PSM	PFPTGTPPPLPPK	1102	sp|Q9BQI5-4|SGIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=15730	74.068	2	1424.7105	1424.7105	R	N	210	223
PSM	PGDEDFSIVLEK	1103	sp|Q9Y6R7|FCGBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18080	87.34	2	1347.6558	1347.6558	K	N	4890	4902
PSM	PSENEVPQQAIDSHSVK	1104	sp|O75410-7|TACC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:21	ms_run[2]:scan=8722	41.653	3	1943.8626	1943.8626	K	N	72	89
PSM	PVVEMDGDEMTR	1105	sp|P48735|IDHP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=2489	14.305	2	1409.5803	1409.5803	K	I	49	61
PSM	PYQYPALTPEQK	1106	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12754	59.613	2	1433.7191	1433.7191	M	K	2	14
PSM	QPITSHLSSDTTTSGTSDLK	1107	sp|O75167-5|PHAR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=10832	51.018	2	2154.9682	2154.9682	K	G	193	213
PSM	QSFDDNDSEELEDKDSK	1108	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=8101	38.928	2	2079.7794	2079.7794	K	S	106	123
PSM	QVEKEETNEIQVVNEEPQR	1109	sp|Q8NBJ4-2|GOLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=10516	49.622	2	2377.0799	2377.0799	R	D	239	258
PSM	RSTDSSSVSGSLQQETK	1110	sp|Q9H8G2|CAAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=6168	30.418	2	1875.8211	1875.8211	R	Y	88	105
PSM	RVSVCAETYNPDEEEEDTDPR	1111	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11362	53.409	3	2590.0167	2590.0167	R	V	97	118
PSM	SAGELPAAHTAAAPGTPGEAAETPAR	1112	sp|Q9UQQ2|SH2B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=10907	51.332	3	2480.1333	2480.1333	R	P	150	176
PSM	SASQAEEEPSVEPVKK	1113	sp|Q08289-6|CACB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=5650	28.078	2	1793.8084	1793.8084	R	S	419	435
PSM	SASQSSLDKLDQELK	1114	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=14298	66.955	2	1727.7979	1727.7979	R	E	714	729
PSM	SCWVCFATDEDDR	1115	sp|Q9NX47|MARH5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=17662	84.844	2	1659.6294	1659.6294	R	T	13	26
PSM	SDDEVDDPAVELK	1116	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11928	55.871	2	1430.6413	1430.6413	K	Q	741	754
PSM	SDSRAQAVSEDAGGNEGR	1117	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=2892	16.143	3	1884.7599	1884.7599	R	A	117	135
PSM	SGPPAPEEEEEEER	1118	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4866	24.875	2	1583.6587	1583.6587	K	Q	1319	1333
PSM	SLLDIISDPDAGTPEDK	1119	sp|Q8WVM8-2|SCFD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=21310	110.72	2	1784.868	1784.8680	K	M	345	362
PSM	SLSKSDSDLLTCSPTEDATMGSR	1120	sp|Q92625|ANS1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=14775	69.278	3	2553.0612	2553.0612	R	S	622	645
PSM	SRSTTELDDYSTNK	1121	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=6308	31.037	2	1695.6989	1695.6989	K	N	1087	1101
PSM	SRTSVQTEDDQLIAGQSAR	1122	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21,3-UNIMOD:21	ms_run[2]:scan=11659	54.709	3	2220.9413	2220.9413	R	A	282	301
PSM	SSGESSPSEHSSSGVSTPCLK	1123	sp|Q9Y3M8-5|STA13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=7310	35.37	2	2185.8835	2185.8835	K	E	321	342
PSM	STGDIAGTVVPETNKEPR	1124	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=11908	55.79	2	1949.9096	1949.9096	K	Y	438	456
PSM	STPSHGSVSSLNSTGSLSPK	1125	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=9479	44.958	2	2008.9103	2008.9103	R	H	238	258
PSM	TADAPSEPAASPHQR	1126	sp|Q5VUB5|F1711_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=1828	11.166	2	1613.6835	1613.6835	R	R	839	854
PSM	TASNPKVENEDEPVR	1127	sp|Q9UBF8-2|PI4KB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=4440	23.1	3	1763.7727	1763.7727	R	L	292	307
PSM	TGGADQSLQQGEGSKK	1128	sp|P09132|SRP19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=1129	8.0805	3	1669.7309	1669.7309	K	G	122	138
PSM	TGMMDTDDFR	1129	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=3738	19.949	2	1219.4485	1219.4485	K	A	763	773
PSM	TQEISRPNSPSEGEGESSDSR	1130	sp|Q9P2R6-2|RERE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=4029	21.242	3	2327.9503	2327.9503	K	S	117	138
PSM	TSQVGAASAPAKESPR	1131	sp|Q13428-6|TCOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=1853	11.281	2	1635.7618	1635.7618	K	K	368	384
PSM	TSSKESSPIPSPTSDR	1132	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=7445	36.062	2	1754.7724	1754.7724	R	K	2159	2175
PSM	TTRTPEEGGYSYDISEK	1133	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=10264	48.536	3	2011.8412	2011.8412	K	T	1946	1963
PSM	VADAKGDSESEEDEDLEVPVPSR	1134	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=14095	65.964	3	2552.0803	2552.0803	R	F	71	94
PSM	VALENDDRSEEEK	1135	sp|Q99700-2|ATX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=2845	15.962	2	1612.6618	1612.6618	R	Y	458	471
PSM	VEMYSGSDDDDDFNKLPK	1136	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=13753	64.351	3	2169.845	2169.8450	K	K	131	149
PSM	VESDLKGPEVDIEGPEGK	1137	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=15042	70.64	3	1976.898	1976.8980	K	L	4484	4502
PSM	VGSGDTNNFPYLEK	1138	sp|Q9NR45|SIAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15348	72.118	2	1539.7205	1539.7205	K	T	132	146
PSM	VIDPATATSVDLR	1139	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14673	68.793	2	1356.7249	1356.7249	K	D	164	177
PSM	VKEEPPSPPQSPR	1140	sp|Q00613-2|HSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=4873	24.905	2	1606.6794	1606.6794	R	V	297	310
PSM	VLCGGDIYVPEDPK	1141	sp|P49189-2|AL9A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4	ms_run[2]:scan=15035	70.6	2	1560.7494	1560.7494	K	L	283	297
PSM	VNVDEVGGEALGR	1142	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15228	71.536	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1143	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18658	91.008	2	1313.6575	1313.6575	K	L	19	32
PSM	VSDGVTKSPEK	1144	sp|P11137-3|MTAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=985	7.4826	2	1225.5591	1225.5591	K	R	1523	1534
PSM	VSDSPSHIATK	1145	sp|Q9P2D3|HTR5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=2199	12.953	2	1220.5438	1220.5438	K	T	1734	1745
PSM	VSPAGGTLDDKPK	1146	sp|Q8WY36-2|BBX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=3922	20.757	2	1363.6385	1363.6385	R	E	813	826
PSM	WDVDDWDNENSSAR	1147	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16879	80.342	2	1707.6761	1707.6761	R	L	25	39
PSM	YAATSQVLLPSK	1148	sp|P01871|IGHM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12157	56.941	2	1276.7027	1276.7027	K	D	65	77
PSM	YEELFPAFSDSR	1149	sp|P54920|SNAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=20177	101.58	2	1459.662	1459.6620	K	E	228	240
PSM	YIAPTVLTDVDPK	1150	sp|P51648|AL3A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17640	84.719	2	1430.7657	1430.7657	R	T	312	325
PSM	YNLDASEEEDSNKK	1151	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=5944	29.407	2	1720.6829	1720.6829	K	K	183	197
PSM	YNLDASEEEDSNKK	1152	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=6170	30.43	2	1720.6829	1720.6829	K	K	183	197
PSM	IEGEMQVPDVDIR	1153	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:35	ms_run[1]:scan=13562	63.38758666666667	2	1515.723970	1515.723909	K	G	1092	1105
PSM	FDDAVVQSDMK	1154	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:35	ms_run[1]:scan=6827	33.31781333333333	2	1269.555636	1269.554718	R	H	78	89
PSM	SETAPAAPAAPAPAEK	1155	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=6317	31.07258	2	1519.7497	1519.7513	M	T	2	18
PSM	FSGDLDDQTCR	1156	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:4	ms_run[1]:scan=6748	32.96467833333333	2	1312.534854	1312.535380	K	E	236	247
PSM	QLEYQQLEDDKLSQK	1157	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,13-UNIMOD:21	ms_run[1]:scan=17737	85.28073833333333	2	1926.8596	1926.8607	K	S	76	91
PSM	NLTSSSLNDISDKPEK	1158	sp|Q9Y6R1|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:21	ms_run[1]:scan=10973	51.640055	2	1827.827807	1826.829904	R	D	252	268
PSM	SKSYDEGLDDYR	1159	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:21	ms_run[1]:scan=9330	44.33656666666667	2	1527.589350	1526.592634	R	E	878	890
PSM	DSLRSTPSHGSVSSLNSTGSLSPK	1160	sp|Q9UBC2|EP15R_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	22-UNIMOD:21	ms_run[1]:scan=11917	55.83223	3	2481.137588	2480.154426	K	H	234	258
PSM	EKPDSDDDLDIASLVTAK	1161	sp|Q86V48|LUZP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:21	ms_run[1]:scan=20403	103.37037666666667	2	2010.902556	2010.903463	R	L	655	673
PSM	QKGSYLTHEASGLDEQGEAR	1162	sp|Q8NFZ8|CADM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=13773	64.442835	3	2237.9609	2237.9585	R	E	351	371
PSM	FFVADTANEALEAAK	1163	sp|Q96I99|SUCB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=19610	97.43223833333333	2	1596.795006	1595.783138	R	R	59	74
PSM	IDTIEIITDR	1164	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=17582	84.38594333333333	2	1187.639228	1187.639768	K	Q	138	148
PSM	LIDEVIEDTR	1165	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=14925	70.02217333333333	2	1201.609622	1201.619033	K	Y	694	704
PSM	QSLSSADNLESDAQGHQVAAR	1166	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=14782	69.31290166666668	2	2245.9582	2245.9596	R	F	345	366
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	1167	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:35,3-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=11457	53.83296333333333	3	3061.249983	3061.252957	R	V	320	347
PSM	NPDEEDNTFYQR	1168	sp|Q9BS40|LXN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8138	39.07686666666667	2	1527.633588	1526.627366	K	L	98	110
PSM	LGCQDAFPEVYDK	1169	sp|Q15392|DHC24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:4	ms_run[1]:scan=15647	73.62134833333333	2	1540.702730	1540.686795	K	I	497	510
PSM	SSDAKPLPASYPAEPR	1170	sp|Q9P266|JCAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:21	ms_run[1]:scan=9745	46.20937166666667	3	1765.816764	1764.808381	R	E	982	998
PSM	CDSSPDSAEDVRK	1171	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1866	11.333856666666666	2	1544.585532	1544.581418	K	V	132	145
PSM	VLEVDEKSPEAK	1172	sp|P0C851|PIRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	8-UNIMOD:21	ms_run[1]:scan=4975	25.316191666666665	2	1422.655093	1422.664342	K	D	9	21
PSM	SNSDSARLPISSGSTSSSR	1173	sp|Q9Y653|AGRG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:21	ms_run[1]:scan=8003	38.51402	3	1974.871961	1974.864392	K	I	674	693
PSM	EIQNGNLHESDSESVPR	1174	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:21	ms_run[1]:scan=8314	39.861005	2	1991.829028	1989.842928	K	D	66	83
PSM	VEVKEEEESSSNGTASQSTSPSQPR	1175	sp|Q92793|CBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	20-UNIMOD:21	ms_run[1]:scan=4169	21.856785000000002	3	2730.149216	2729.166507	K	K	1057	1082
PSM	ADELSEKQVYDAHTK	1176	sp|Q03135-2|CAV1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,5-UNIMOD:21	ms_run[1]:scan=10971	51.63388333333333	3	1854.8023	1854.8032	M	E	2	17
PSM	GGGGGQDNGLEGLGNDSR	1177	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8548	40.91049833333334	2	1659.706766	1658.724454	R	D	394	412
PSM	EELNGAMEHTNSNESDSSPGR	1178	sp|Q9H334|FOXP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=2471	14.230581666666668	3	2356.874547	2355.891078	R	S	604	625
PSM	LYPIANGNNQSPVDIK	1179	sp|P00915|CAH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=16302	77.05031666666666	2	1742.883141	1741.899899	K	T	20	36
PSM	LLDPEDISVDHPDEK	1180	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	8-UNIMOD:21	ms_run[1]:scan=15172	71.27093833333333	2	1799.774401	1800.781891	K	S	250	265
PSM	VSEDEEKLPASPK	1181	sp|Q7RTP6|MICA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	11-UNIMOD:21	ms_run[1]:scan=6026	29.758476666666667	2	1507.679478	1507.680721	R	H	1133	1146
PSM	KESAPQVLLPEEEK	1182	sp|Q14155-1|ARHG7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:21	ms_run[1]:scan=13384	62.53624	2	1675.805146	1675.806984	R	I	558	572
PSM	AALADDFDTPR	1183	sp|Q9HA77|SYCM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12493	58.415	2	1190.5568	1190.5568	K	V	408	419
PSM	AASPHQVTPQADEK	1184	sp|Q96L73-2|NSD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=1867	11.337	2	1557.6825	1557.6825	R	M	2200	2214
PSM	AATSGVPSIYAPSTYAHLSPAK	1185	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	19-UNIMOD:21	ms_run[2]:scan=18357	89.026	2	2268.0828	2268.0828	K	T	158	180
PSM	AAYEAELGDAR	1186	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8579	41.04	2	1164.5411	1164.5411	K	K	79	90
PSM	AETNSRVSGVDGYETEGIR	1187	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=11643	54.648	3	2118.9219	2118.9219	R	G	264	283
PSM	AGAGSATLSMAYAGAR	1188	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=9599	45.486	2	1469.6933	1469.6933	K	F	242	258
PSM	AGDLLEDSPK	1189	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8654	41.35	2	1043.5135	1043.5135	R	R	151	161
PSM	AKSQEEVLPSSTTPSPGGALSPSGQPSSSATEVVLR	1190	sp|Q9UBW5-2|BIN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=18353	89.002	3	3617.7462	3617.7462	R	T	323	359
PSM	ALYETELADAR	1191	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13189	61.63	2	1250.6143	1250.6143	K	R	80	91
PSM	ASSEDTLNKPGSTAASGVVR	1192	sp|Q5M775-2|CYTSB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=8454	40.49	3	2025.9368	2025.9368	R	L	53	73
PSM	ASSVSTKESPAR	1193	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=591	5.6081	2	1298.5868	1298.5868	K	K	225	237
PSM	AVEFSSGAKSPSK	1194	sp|P25054-2|APC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=3603	19.375	2	1373.6228	1373.6228	K	S	1250	1263
PSM	CTYLVLDEADR	1195	sp|Q92841-1|DDX17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:4	ms_run[2]:scan=15726	74.05	2	1353.6235	1353.6235	R	M	240	251
PSM	DDGTGQLLLPLSDAR	1196	sp|Q15149-6|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=19975	100.07	2	1569.7999	1569.7999	R	K	3871	3886
PSM	DEASEQSDEEDSVQSLHGVR	1197	sp|Q6WN34|CRDL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=11465	53.871	2	2295.9129	2295.9129	K	H	176	196
PSM	DEGPAAAGDGLGR	1198	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5568	27.75	2	1184.5422	1184.5422	R	P	58	71
PSM	DELHIVEAEAMNYEGSPIK	1199	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=20088	100.88	3	2239.9708	2239.9708	K	V	55	74
PSM	DGDDVIIIGVFK	1200	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=22140	117.64	2	1289.6867	1289.6867	K	G	302	314
PSM	DHSDSDDQMLVAK	1201	sp|Q9NW75-2|GPTC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=3191	17.54	2	1555.5862	1555.5862	K	R	113	126
PSM	DMESPTKLDVTLAK	1202	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=14471	67.772	2	1642.7525	1642.7525	K	D	277	291
PSM	DNVESAQASEVKPLR	1203	sp|Q12864|CAD17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=8626	41.238	2	1721.7985	1721.7985	K	S	817	832
PSM	DSDDYAQLCNIPVTGR	1204	sp|Q14766-3|LTBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:4	ms_run[2]:scan=16688	79.266	2	1822.8156	1822.8156	K	R	1190	1206
PSM	DSGLEDGRESPSFDTPSQR	1205	sp|Q6U841-4|S4A10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=10611	50.059	3	2158.8804	2158.8804	R	V	80	99
PSM	DSGRGDSVSDSGSDALR	1206	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=4542	23.539	3	1759.701	1759.7010	R	S	59	76
PSM	DSSFTEVPRSPK	1207	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=8236	39.527	2	1428.6286	1428.6286	R	H	236	248
PSM	DVTTPGHSTPVPDGK	1208	sp|Q71F56|MD13L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=5487	27.414	2	1586.6978	1586.6978	K	N	755	770
PSM	DYSHYYTTIQDLR	1209	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=16913	80.525	2	1753.7349	1753.7349	R	D	126	139
PSM	EASRSSPVEFECINEK	1210	sp|O75131|CPNE3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=12024	56.304	2	1960.8238	1960.8238	K	K	238	254
PSM	EDKSLSEAPEDTSTR	1211	sp|P41214|EIF2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=3839	20.427	2	1743.72	1743.7200	R	G	234	249
PSM	EDSRGSLIPEGATGFPDQGNTGENTR	1212	sp|Q5JSL3|DOC11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=16653	79.078	3	2784.1988	2784.1988	R	Q	1235	1261
PSM	EELEELQEAFNK	1213	sp|Q14651|PLSI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=18943	92.835	2	1477.6937	1477.6937	R	I	11	23
PSM	EGDLIAAQAR	1214	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6599	32.303	2	1042.5407	1042.5407	K	L	124	134
PSM	EIAIVHSDAEK	1215	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=6089	30.038	2	1290.5857	1290.5857	K	E	341	352
PSM	EIFEQPESVVNTMR	1216	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:35	ms_run[2]:scan=15003	70.443	2	1693.7981	1693.7981	K	G	328	342
PSM	ELVEFAQDDDR	1217	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12507	58.482	2	1335.5943	1335.5943	K	L	116	127
PSM	EMNDAAMFYTNR	1218	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=9366	44.484	2	1493.5915	1493.5915	K	V	155	167
PSM	ESEKSLENETLNK	1219	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=9380	44.538	2	1599.7029	1599.7029	R	E	402	415
PSM	ESPSTRPSTPSLEGSQSSAEGR	1220	sp|Q3KR16-3|PKHG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=7971	38.378	3	2326.0074	2326.0074	R	T	66	88
PSM	ETKSEETLDEGPPK	1221	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=4868	24.882	2	1638.7026	1638.7026	K	Y	97	111
PSM	EVDIGIPDATGR	1222	sp|P55072|TERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14611	68.473	2	1241.6252	1241.6252	R	L	366	378
PSM	EVPISLEVSQDR	1223	sp|O15061-2|SYNEM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14905	69.922	2	1370.7042	1370.7042	R	R	576	588
PSM	EYIEHCNTPTTDSDSSIAVK	1224	sp|Q9NVR5-2|KTU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=10284	48.614	3	2345.9723	2345.9723	K	A	648	668
PSM	FAMEPEEFDSDTLR	1225	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35	ms_run[2]:scan=15591	73.348	2	1701.7192	1701.7192	K	E	486	500
PSM	FDMELDDLPK	1226	sp|P28482-2|MK01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35	ms_run[2]:scan=14984	70.341	2	1237.5537	1237.5537	K	E	287	297
PSM	FDTDDELSYR	1227	sp|Q9HD67-3|MYO10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12140	56.86	2	1259.5306	1259.5306	R	R	513	523
PSM	FEDGVLDPDYPR	1228	sp|P04004|VTNC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15574	73.272	2	1421.6463	1421.6463	R	N	230	242
PSM	FIYVDVLSEDEEKPK	1229	sp|O94885|SASH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=19162	94.251	2	1889.87	1889.8700	K	R	607	622
PSM	FPDEDEILEK	1230	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15744	74.132	2	1233.5765	1233.5765	K	D	133	143
PSM	FTDEEVDEMYR	1231	sp|P24844|MYL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=9795	46.462	2	1448.5766	1448.5766	R	E	134	145
PSM	GCSEDHSGLDAK	1232	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=1317	8.8563	2	1354.4861	1354.4861	K	S	1183	1195
PSM	GEALEDFTGPDCR	1233	sp|Q5JRA6-2|TGO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:4	ms_run[2]:scan=13719	64.194	2	1465.6144	1465.6144	R	F	50	63
PSM	GEGPDVDVNLPK	1234	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13077	61.103	2	1238.6143	1238.6143	K	A	2781	2793
PSM	GEIDASVPELEGDLR	1235	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=18999	93.187	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GFMTNGADIDECK	1236	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=8438	40.421	2	1472.5912	1472.5912	R	V	2395	2408
PSM	GGHSSVSTESESSSFHSS	1237	sp|P61073|CXCR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=4153	21.781	2	1874.6956	1874.6956	R	-	335	353
PSM	GICEALEDSDGR	1238	sp|O00339-4|MATN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4	ms_run[2]:scan=10564	49.835	2	1320.5616	1320.5616	K	Q	549	561
PSM	GMTTVDDFFQGTK	1239	sp|Q14195|DPYL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=16684	79.247	2	1461.6446	1461.6446	K	A	82	95
PSM	GSGHPAYAEVEPVGEK	1240	sp|Q6UX71-3|PXDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=9232	43.921	2	1705.7349	1705.7349	R	E	127	143
PSM	GSLASLDSLRK	1241	sp|O60716-32|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=14620	68.51	2	1305.5731	1305.5731	R	G	22	33
PSM	GSSTANLIFEDCR	1242	sp|P16219|ACADS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:4	ms_run[2]:scan=15438	72.597	2	1468.6616	1468.6616	R	I	235	248
PSM	GSVILDSGHLSTASSSDDLK	1243	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:21	ms_run[2]:scan=14721	69.027	2	2067.9362	2067.9362	R	G	88	108
PSM	GVVDSDDLPLNVSR	1244	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16659	79.109	3	1484.7471	1484.7471	K	E	435	449
PSM	GYGYGQGAGTLSTDKGESLGIK	1245	sp|P21291|CSRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=15154	71.183	2	2238.0206	2238.0206	K	H	70	92
PSM	HAPSPEPAVQGTGVAGVPEESGDAAAIPAK	1246	sp|P13051|UNG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=14604	68.438	3	2889.3546	2889.3546	R	K	20	50
PSM	HTSAEEEEPPPVK	1247	sp|Q9BZ95-3|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=3453	18.732	2	1528.6447	1528.6447	R	I	455	468
PSM	IACKSPPPESVDTPTSTK	1248	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=5874	29.117	2	1993.9068	1993.9068	K	Q	767	785
PSM	IAVAAQNCYK	1249	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:4	ms_run[2]:scan=5439	27.225	2	1136.5648	1136.5648	K	V	60	70
PSM	IDEPLEGSEDR	1250	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7258	35.142	2	1258.5677	1258.5677	K	I	399	410
PSM	IDESSLTGESDHVK	1251	sp|P20020-6|AT2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=8859	42.245	2	1595.6716	1595.6716	K	K	238	252
PSM	IELLGSYDPQK	1252	sp|P24666-3|PPAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16320	77.12	2	1261.6554	1261.6554	K	Q	80	91
PSM	IETIEVMEDR	1253	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14206	66.501	2	1233.5911	1233.5911	K	Q	130	140
PSM	IFTSIGEDYDER	1254	sp|P35232|PHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14261	66.78	2	1443.6518	1443.6518	R	V	106	118
PSM	IICDNTGITTVSR	1255	sp|P11678|PERE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4	ms_run[2]:scan=10365	48.969	2	1448.7293	1448.7293	R	D	674	687
PSM	ILEDHGSPAGEIDDEDK	1256	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=9977	47.292	2	1918.7833	1918.7833	R	D	1670	1687
PSM	ILELEEENDR	1257	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11169	52.539	2	1258.6041	1258.6041	K	L	1614	1624
PSM	ILEVVNQIQDEER	1258	sp|O94919|ENDD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17371	83.205	2	1583.8155	1583.8155	K	M	282	295
PSM	ILIANTGMDTDK	1259	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:35	ms_run[2]:scan=7503	36.361	2	1306.6439	1306.6439	K	I	190	202
PSM	IPSAVSTVSMQNIHPK	1260	sp|P19634|SL9A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=12552	58.675	2	1883.8254	1883.8254	K	S	597	613
PSM	IQLVEEELDR	1261	sp|P09493-8|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15945	75.174	2	1242.6456	1242.6456	R	A	92	102
PSM	IRTQSFSLQER	1262	sp|P29474|NOS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=11571	54.324	2	1523.6535	1523.6535	R	Q	1173	1184
PSM	ISFVEEDVHPK	1263	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=12941	60.499	3	1378.617	1378.6170	R	W	1231	1242
PSM	ISGLIYEETR	1264	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13308	62.185	2	1179.6136	1179.6136	R	G	47	57
PSM	IVTDSDSKTEELR	1265	sp|Q9H2G2-2|SLK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=4836	24.759	2	1571.708	1571.7080	K	F	812	825
PSM	IYEFPETDDEEENK	1266	sp|Q16181-2|SEPT7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13329	62.274	2	1756.7316	1756.7316	K	L	221	235
PSM	KCSLPAEEDSVLEK	1267	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=12996	60.73	2	1683.7427	1683.7427	K	L	634	648
PSM	KDSIPQVLLPEEEK	1268	sp|Q15052-2|ARHG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=17802	85.666	2	1703.8383	1703.8383	R	L	528	542
PSM	KESEFDDEPK	1269	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=3874	20.568	2	1302.5017	1302.5017	R	F	442	452
PSM	KETESEAEDNLDDLEK	1270	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=12626	59.015	3	1943.7885	1943.7885	K	H	868	884
PSM	KETESEAEDNLDDLEK	1271	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=13298	62.148	3	1943.7885	1943.7885	K	H	868	884
PSM	KSSELDASDSSSSSNLSLAK	1272	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=9929	47.072	3	2091.9209	2091.9209	R	V	288	308
PSM	KSVSSPTSSNTPTPTK	1273	sp|Q5M775-2|CYTSB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=2161	12.752	2	1697.7873	1697.7873	R	H	130	146
PSM	KYSASSGGLCEEATAAK	1274	sp|Q9UHV7|MED13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=8581	41.046	3	1808.7652	1808.7652	R	V	393	410
PSM	LDSSACLHAVGDK	1275	sp|O94808|GFPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=7179	34.784	2	1451.6116	1451.6116	R	A	242	255
PSM	LEAPDADELPK	1276	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12424	58.114	2	1196.5925	1196.5925	R	G	524	535
PSM	LEASDCDHQQNSPTLER	1277	sp|Q9HAN9|NMNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=5251	26.404	2	2078.8365	2078.8365	K	P	106	123
PSM	LEKSIDDLEEK	1278	sp|P09493-8|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=9982	47.316	2	1397.6327	1397.6327	K	V	249	260
PSM	LESDYEILER	1279	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15166	71.241	2	1265.6139	1265.6139	K	F	269	279
PSM	LFVDTDSDVR	1280	sp|Q9HA47-2|UCK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11296	53.11	2	1165.5615	1165.5615	R	L	156	166
PSM	LGDLQADSEESQR	1281	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6366	31.28	2	1446.6587	1446.6587	R	A	1411	1424
PSM	LGFYGLDESDLDK	1282	sp|Q02218|ODO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=19842	99.085	2	1470.6878	1470.6878	K	V	172	185
PSM	LIDDMVAQVLK	1283	sp|P48735|IDHP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35	ms_run[2]:scan=16892	80.411	2	1259.6795	1259.6795	R	S	289	300
PSM	LIQSHPESAEDLQEK	1284	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=8318	39.879	3	1802.8088	1802.8088	R	C	1279	1294
PSM	LKSEDGVEGDLGETQSR	1285	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=7247	35.094	3	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	1286	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=8553	40.934	3	1898.8259	1898.8259	R	T	133	150
PSM	LKSEDGVEGDLGETQSR	1287	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=8802	42.01	2	1898.8259	1898.8259	R	T	133	150
PSM	LQEELAASDR	1288	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5528	27.59	2	1130.5568	1130.5568	R	A	1709	1719
PSM	LQQEPDGAGAKSPTCQK	1289	sp|Q13574-6|DGKZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=1592	10.143	2	1893.8292	1893.8292	R	L	672	689
PSM	LSEGSQPAEEEEDQETPSR	1290	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5830	28.892	2	2116.9033	2116.9033	K	N	239	258
PSM	LSQTFLQLSDGDKK	1291	sp|Q92608|DOCK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=16392	77.574	2	1658.7917	1658.7917	R	T	1783	1797
PSM	LSSSKENLDASK	1292	sp|Q8NFA0|UBP32_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=2333	13.623	2	1357.6126	1357.6126	K	E	1420	1432
PSM	LTVSDGESGEEKK	1293	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=2864	16.038	2	1457.6287	1457.6287	K	T	1277	1290
PSM	LVNEVTEFAK	1294	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13839	64.74	2	1148.6077	1148.6077	K	T	66	76
PSM	LVQSPNSYFMDVK	1295	sp|Q71UM5|RS27L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=15922	75.063	2	1542.7388	1542.7388	R	C	24	37
PSM	LYGSAGPPPTGEEDTAEKDEL	1296	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13944	65.228	3	2174.9855	2174.9855	K	-	634	655
PSM	MADEQGDMDLQISPDRK	1297	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7890	38.022	2	2059.8228	2059.8228	K	T	2115	2132
PSM	MQVDQEEPHVEEQQQQTPAENK	1298	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=5717	28.353	3	2717.1276	2717.1276	K	A	522	544
PSM	NASASFQELEDKK	1299	sp|Q99543-2|DNJC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=9881	46.854	2	1545.6712	1545.6712	R	E	45	58
PSM	NCMDIDECQR	1300	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4,3-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=2099	12.47	2	1355.4904	1355.4904	K	D	1110	1120
PSM	NFGEDMDDER	1301	sp|P11940-2|PABP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35	ms_run[2]:scan=3632	19.5	2	1242.4459	1242.4459	K	L	197	207
PSM	NFYESDDDQKEK	1302	sp|O00203-3|AP3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=4668	24.032	2	1596.5981	1596.5981	K	T	223	235
PSM	NSLEPQTTVVHNATDGIK	1303	sp|Q13555-9|KCC2G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=14275	66.842	2	2002.9361	2002.9361	K	G	337	355
PSM	NTDVAQSPEAPKQEAPAK	1304	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=3436	18.66	2	1959.8939	1959.8939	R	K	179	197
PSM	NVTELNEPLSNEER	1305	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11896	55.74	2	1642.7798	1642.7798	K	N	29	43
PSM	NYDFGSSTETSDSHLTK	1306	sp|P49685|GPR15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=11175	52.565	2	1967.7786	1967.7786	K	A	323	340
PSM	PEFLEDPSVLTK	1307	sp|P42167-2|LAP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=18423	89.461	2	1373.7078	1373.7078	M	D	2	14
PSM	QQIAEDPELTHSSSNK	1308	sp|Q9ULC3|RAB23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=6965	33.875	2	1862.8048	1862.8048	K	I	175	191
PSM	QSLSSADNLESDAQGHQVAAR	1309	sp|Q9Y6D5|BIG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=12006	56.219	2	2262.9866	2262.9866	R	F	345	366
PSM	RSLSEQPVMDTATATEQAK	1310	sp|P18615-4|NELFE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=8272	39.681	3	2157.9613	2157.9613	K	Q	48	67
PSM	SDLSHTSLLENEK	1311	sp|Q8TEP8|CE192_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=11912	55.809	2	1551.6818	1551.6818	K	L	190	203
PSM	SDPYHATSGALSPAK	1312	sp|P17302|CXA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:21	ms_run[2]:scan=7008	34.059	2	1580.6872	1580.6872	K	D	244	259
PSM	SDSASSPSGGADKPLKG	1313	sp|P98198|AT8B2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=2356	13.724	2	1639.7091	1639.7091	K	-	1193	1210
PSM	SEAPAEVTHFSPK	1314	sp|Q6PID6|TTC33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=9657	45.749	2	1478.6443	1478.6443	K	S	187	200
PSM	SEDFSLPAYMDR	1315	sp|P13073|COX41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=16041	75.689	2	1445.6133	1445.6133	K	R	30	42
PSM	SEGSSQSLEEAHLVK	1316	sp|Q9NYF0-2|DACT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=9566	45.348	2	1679.7404	1679.7404	K	A	505	520
PSM	SFDDEESVDGNRPSSAASAFK	1317	sp|O75122-2|CLAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:21	ms_run[2]:scan=13840	64.743	3	2294.9329	2294.9329	K	V	14	35
PSM	SGDLGDMEPLK	1318	sp|O60716-32|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=7115	34.53	2	1176.5333	1176.5333	R	G	570	581
PSM	SGSSQELDVKPSASPQER	1319	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=7208	34.916	2	1980.879	1980.8790	R	S	1539	1557
PSM	SKSSEVTDAYTK	1320	sp|Q6UB98-2|ANR12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=3633	19.503	2	1394.5967	1394.5967	R	E	1118	1130
PSM	SLAEDFAEQPIK	1321	sp|Q9Y4L1-2|HYOU1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16291	77	2	1346.6718	1346.6718	R	D	72	84
PSM	SLDEISQPAQELK	1322	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13652	63.843	2	1456.7409	1456.7409	K	R	154	167
PSM	SLDMDSIIAEVK	1323	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35	ms_run[2]:scan=16718	79.418	2	1335.6592	1335.6592	R	A	253	265
PSM	SLMDSDDDALLK	1324	sp|O75911|DHRS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35	ms_run[2]:scan=12274	57.441	2	1337.6021	1337.6021	K	S	131	143
PSM	SLQEQADAAEER	1325	sp|P09493-5|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5798	28.721	2	1345.611	1345.6110	R	A	16	28
PSM	SLYYYIQQDTK	1326	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16687	79.262	2	1420.6874	1420.6874	K	G	314	325
PSM	SMYEEEINETR	1327	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=7400	35.812	2	1415.5875	1415.5875	K	R	210	221
PSM	SNSLPHSAVSNAGSK	1328	sp|Q8TBZ3-4|WDR20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=4163	21.824	2	1534.6777	1534.6777	R	S	362	377
PSM	SNTISKPYISNTLPSDAPK	1329	sp|Q53SF7-4|COBL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=14662	68.731	2	2112.014	2112.0140	R	K	273	292
PSM	SPTTSADLKSDK	1330	sp|O75363-2|BCAS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=1610	10.228	2	1328.5861	1328.5861	K	A	359	371
PSM	SQSSHSYDDSTLPLIDR	1331	sp|O60716-32|CTND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=15755	74.18	3	1999.8524	1999.8524	R	N	530	547
PSM	SRTASLTSAASVDGNR	1332	sp|Q9UN36-4|NDRG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=8449	40.466	2	1751.7241	1751.7241	R	S	285	301
PSM	SSEPVKETVQTTQSPTPVEK	1333	sp|Q9UPN6|SCAF8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:21	ms_run[2]:scan=6877	33.509	2	2251.0621	2251.0621	K	E	604	624
PSM	SSESKPEFFYSEEQR	1334	sp|A6ND36|FA83G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=14231	66.629	2	1928.783	1928.7830	R	L	18	33
PSM	SSGGSYRDSYDSYATHNE	1335	sp|Q14011|CIRBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=7896	38.049	2	2074.7542	2074.7542	R	-	155	173
PSM	SSPPAPPLPPGSGSPGTPQALPR	1336	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=15894	74.9	2	2244.094	2244.0940	R	R	585	608
PSM	SSSPGAGGGHSTSTSTSPATTLQR	1337	sp|Q5JU85|IQEC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=5594	27.857	3	2311.0078	2311.0078	R	K	212	236
PSM	SSVKTPEPVVPTAPELQPSTSTDQPVTSEPTYQATR	1338	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=17641	84.723	3	3904.8619	3904.8619	R	G	971	1007
PSM	SVIPSDGPSVACVK	1339	sp|P02787|TRFE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:4	ms_run[2]:scan=12685	59.296	2	1414.7126	1414.7126	K	K	47	61
PSM	SWEQEEEEEEVR	1340	sp|Q0VD83-3|APOBR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11135	52.401	2	1577.6482	1577.6482	R	A	175	187
PSM	TDGSISGDRQPVTVADYISR	1341	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=16814	79.994	3	2216.0111	2216.0111	R	A	598	618
PSM	TESEMHTLSSSAK	1342	sp|Q9UHX3-5|AGRE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=1072	7.845	2	1502.596	1502.5960	K	A	659	672
PSM	TFNTSTGGLLLPSDTK	1343	sp|P12956-2|XRCC6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17525	84.049	2	1650.8465	1650.8465	R	R	261	277
PSM	TGRDTPENGETAIGAENSEK	1344	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=5058	25.639	3	2154.9066	2154.9067	K	I	475	495
PSM	TPAQYDASELK	1345	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7401	35.815	2	1221.5877	1221.5877	K	A	105	116
PSM	TPVASTHSISSAATPDR	1346	sp|P27448-8|MARK3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=7934	38.219	3	1776.8044	1776.8044	R	I	457	474
PSM	VASGSDLHLTDIDSDSNR	1347	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=14250	66.724	2	1980.8426	1980.8426	K	G	70	88
PSM	VAVIQFSDDPK	1348	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13885	64.949	2	1217.6292	1217.6292	R	V	664	675
PSM	VDINAPDVDVR	1349	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12990	60.71	2	1211.6146	1211.6146	K	G	3914	3925
PSM	VELKSEANDAVNSSTK	1350	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=10001	47.402	3	1770.8037	1770.8037	K	E	113	129
PSM	VELSESEEDKGGK	1351	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=3034	16.835	2	1485.6236	1485.6236	K	M	458	471
PSM	VGAENVAIVEPSER	1352	sp|Q9Y6N5|SQOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11617	54.529	2	1468.7522	1468.7522	K	H	66	80
PSM	VHTPSGAVEECYVSELDSDK	1353	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=17201	82.185	3	2300.9508	2300.9508	R	H	2411	2431
PSM	VLETAEDIQER	1354	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8598	41.123	2	1301.6463	1301.6463	K	R	8	19
PSM	VNVDEVGGEALGR	1355	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=20165	101.49	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1356	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17979	86.695	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1357	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=21398	111.43	2	1313.6575	1313.6575	K	L	19	32
PSM	VSYLVFDEADR	1358	sp|Q86XP3-2|DDX42_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=18033	87.02	2	1312.6299	1312.6299	R	M	282	293
PSM	VTDAIVLLDR	1359	sp|P11172-3|UMPS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17607	84.521	2	1113.6394	1113.6394	K	E	54	64
PSM	VTSRGPDEEAVVDLGK	1360	sp|Q9Y6M7-14|S4A7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=13097	61.19	3	1750.8139	1750.8139	R	T	17	33
PSM	YDEIFYNLAPADGKLSGSK	1361	sp|Q9NZN4-2|EHD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:21	ms_run[2]:scan=20059	100.67	2	2166.9875	2166.9875	K	A	317	336
PSM	YDSYEEYQHER	1362	sp|Q9UBK2-9|PRGC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=6574	32.181	2	1597.5722	1597.5722	R	L	507	518
PSM	YEELQSLAGK	1363	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11569	54.318	2	1136.5714	1136.5714	K	H	286	296
PSM	YLAEVAAGDDK	1364	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7334	35.474	2	1150.5506	1150.5506	R	K	128	139
PSM	YQSSPAKPDSSFYK	1365	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=8693	41.514	2	1683.7182	1683.7182	R	G	282	296
PSM	CECEIGYELDR	1366	sp|P35555|FBN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:4	ms_run[1]:scan=18880	92.44767333333333	2	1425.5535	1425.5535	R	S	1470	1481
PSM	ETNLDSLPLVDTHSK	1367	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:27,6-UNIMOD:21	ms_run[1]:scan=19701	98.04756166666667	2	1729.7918	1729.7919	R	R	425	440
PSM	QSFDDNDSEELEDKDSK	1368	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=10984	51.69269666666667	2	2062.7498	2062.7523	K	S	106	123
PSM	LDSSEMDHSENEDYTMSSPLPGK	1369	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[1]:scan=10752	50.68568166666667	3	2681.019466	2680.019375	R	K	1174	1197
PSM	QLEYQQLEDDKLSQK	1370	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,13-UNIMOD:21	ms_run[1]:scan=17004	81.02533833333332	2	1926.8596	1926.8607	K	S	76	91
PSM	QDKPLSPAGSSQEAADTPDTR	1371	sp|P13994|CC130_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,6-UNIMOD:21	ms_run[1]:scan=9105	43.36225833333333	3	2232.9509	2232.9531	R	H	357	378
PSM	YNILGTNTIMDK	1372	sp|Q00839|HNRPU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:35	ms_run[1]:scan=15127	71.03896166666667	2	1397.688903	1397.686067	K	M	525	537
PSM	ETPHSPGVEDAPIAK	1373	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:21	ms_run[1]:scan=8898	42.402235	2	1626.728237	1626.729068	R	V	486	501
PSM	GGPVQVLEDEELK	1374	sp|Q13228|SBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=18034	87.023005	2	1411.719568	1411.719475	K	S	358	371
PSM	FFVADTANEALEAAK	1375	sp|Q96I99|SUCB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=19597	97.33670500000001	2	1596.795006	1595.783138	R	R	59	74
PSM	FTDEEVDEMYR	1376	sp|P24844|MYL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:35	ms_run[1]:scan=9785	46.41749166666667	2	1448.575765	1448.576576	R	E	134	145
PSM	FGESEEVEMEVESDEEDDKQEK	1377	sp|Q15459|SF3A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:35,13-UNIMOD:21	ms_run[1]:scan=13552	63.34708333333334	3	2714.017421	2712.015729	K	A	317	339
PSM	FEDEDSDDVPR	1378	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7023	34.12745833333333	2	1322.526851	1322.526254	K	K	698	709
PSM	AILILDNDGDR	1379	sp|P61923|COPZ1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=15351	72.13508833333333	2	1213.630442	1213.630266	K	L	15	26
PSM	YELQQLEGSSDR	1380	sp|Q92878|RAD50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=12709	59.406498333333325	2	1424.642199	1423.657937	K	I	462	474
PSM	DADDAVYELNGK	1381	sp|Q08170|SRSF4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=11533	54.17346833333333	2	1308.583765	1308.583375	R	D	47	59
PSM	QRDEDDEAYGK	1382	sp|Q53GD3|CTL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1874	11.368101666666666	2	1307.5227	1307.5261	K	P	5	16
PSM	CDSSPDSAEDVRK	1383	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1698	10.608839999999999	2	1545.571984	1544.581418	K	V	132	145
PSM	CDSSPDSAEDVRK	1384	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1631	10.324243333333333	2	1544.585532	1544.581418	K	V	132	145
PSM	SNSLPHSAVSNAGSK	1385	sp|Q8TBZ3|WDR20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21	ms_run[1]:scan=4326	22.57629	2	1534.676380	1534.677701	R	S	432	447
PSM	EIQNGNLHESDSESVPR	1386	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:21	ms_run[1]:scan=9339	44.369725	2	1990.824827	1989.842928	K	D	66	83
PSM	EIQNGNLHESDSESVPR	1387	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:21	ms_run[1]:scan=8544	40.89615666666666	2	1990.827868	1989.842928	K	D	66	83
PSM	IDYIAGLDSR	1388	sp|P07741|APT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=15383	72.29589333333334	2	1121.571573	1121.571688	R	G	58	68
PSM	TEIKEEEDQPSTSATQSSPAPGQSK	1389	sp|Q09472|EP300_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	18-UNIMOD:21	ms_run[1]:scan=5215	26.26258	3	2712.169315	2711.181095	K	K	1021	1046
PSM	EELSHSPEPCTK	1390	sp|P41229|KDM5C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	6-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=2323	13.577423333333334	2	1492.5885	1492.5900	K	M	296	308
PSM	AQLSSPEDQDDQDDIK	1391	sp|Q86US8|EST1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=7532	36.496401666666664	2	1803.779883	1802.780631	K	V	996	1012
PSM	TVEAEAAHGTVTR	1392	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:21	ms_run[1]:scan=3444	18.69365	2	1419.634914	1420.634773	K	H	302	315
PSM	GVVTNGLDLSPADEKK	1393	sp|P07197|NFM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:21	ms_run[1]:scan=14148	66.21861333333334	2	1722.806745	1721.823697	K	G	828	844
PSM	ASQSRPNSSALETLGGEK	1394	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	8-UNIMOD:21	ms_run[1]:scan=11479	53.93210833333334	2	1911.854787	1910.873500	K	L	447	465
PSM	SEQSNGSVLHDAAAAADSPAGTR	1395	sp|Q9HDC5|JPH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	18-UNIMOD:21	ms_run[1]:scan=12059	56.47042166666667	3	2291.970084	2290.981547	R	G	168	191
PSM	SPSPGPNHTSNSSNASNATVVPQNSSAR	1396	sp|Q9BTA9|WAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:21	ms_run[1]:scan=6028	29.764163333333336	3	2845.223930	2844.242407	R	S	523	551
PSM	AADAVEDLR	1397	sp|Q9UNF0-2|PACN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6844	33.38	2	958.47197	958.4720	R	W	276	285
PSM	AAPEASSPPASPLQHLLPGK	1398	sp|Q96TA1-2|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=19440	96.21	2	2126.9803	2126.9803	K	A	673	693
PSM	ADSDGAKPEPVAMAR	1399	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=2257	13.245	3	1609.6807	1609.6807	K	S	238	253
PSM	ADSDGAKPEPVAMAR	1400	sp|Q7Z4V5|HDGR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=2398	13.908	2	1609.6807	1609.6807	K	S	238	253
PSM	AEAAAAPTVAPGPAQPGHVSPTPATTSPGEK	1401	sp|Q9Y6R0|NUMBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	26-UNIMOD:21	ms_run[2]:scan=10680	50.368	3	2944.3968	2944.3968	K	G	244	275
PSM	AEADVASLNR	1402	sp|P09493-8|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5403	27.075	2	1044.52	1044.5200	K	R	81	91
PSM	AEIDMLDIR	1403	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=13959	65.298	2	1090.5329	1090.5329	R	A	194	203
PSM	AEPLETFPFDQSK	1404	sp|Q9Y6N5|SQOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=18970	93.003	2	1507.7195	1507.7195	K	E	397	410
PSM	AESPAEKVPEESVLPLVQK	1405	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=18337	88.895	3	2129.0657	2129.0657	K	S	488	507
PSM	AFALNDLDDYEK	1406	sp|Q14166|TTL12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=18787	91.837	2	1412.646	1412.6460	R	H	499	511
PSM	AGDLLEDSPK	1407	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=8546	40.903	2	1123.4798	1123.4798	R	R	151	161
PSM	ALADENEFVR	1408	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11807	55.347	2	1162.5619	1162.5619	K	D	1785	1795
PSM	ALASEKSPTADAK	1409	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=1667	10.482	2	1367.6334	1367.6334	K	P	266	279
PSM	ALQPLEEGEDEEK	1410	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9610	45.539	2	1485.6835	1485.6835	R	V	336	349
PSM	AMDEIQPDLR	1411	sp|Q9UK41|VPS28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35	ms_run[2]:scan=8671	41.418	2	1202.5601	1202.5601	R	E	149	159
PSM	AQGEPVAGHESPK	1412	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=1221	8.4587	2	1385.5977	1385.5977	R	I	522	535
PSM	AQPFVAAANIDDK	1413	sp|Q53GG5-3|PDLI3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13040	60.931	2	1358.683	1358.6830	R	R	123	136
PSM	ASPDQNASTHTPQSSVK	1414	sp|Q14677-2|EPN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=1426	9.3611	2	1833.7894	1833.7894	K	T	280	297
PSM	ASQSRPNSSALETLGGEK	1415	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=10953	51.545	3	1910.8735	1910.8735	K	L	447	465
PSM	ATEDEGSEQKIPEATNR	1416	sp|P01008|ANT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21	ms_run[2]:scan=4914	25.073	2	1953.8317	1953.8317	K	R	62	79
PSM	AVEFSSGAKSPSK	1417	sp|P25054-2|APC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=3544	19.112	2	1373.6228	1373.6228	K	S	1250	1263
PSM	AVPSPPPPPIVK	1418	sp|Q96JP2|MY15B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=12998	60.742	2	1277.6785	1277.6785	R	K	1022	1034
PSM	AVSPPHLDGPPSPR	1419	sp|P29590-2|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=12078	56.562	2	1585.6691	1585.6691	K	S	516	530
PSM	AVVVSPKEENK	1420	sp|O75909-1|CCNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=2417	13.991	2	1278.6221	1278.6221	R	A	336	347
PSM	CFEGCECDDR	1421	sp|Q9Y6R7|FCGBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:4,5-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=3197	17.567	2	1346.4326	1346.4326	R	F	5151	5161
PSM	CMMDTDDEVR	1422	sp|Q9UBF2-2|COPG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:4,2-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=1207	8.4017	2	1302.4526	1302.4526	R	D	516	526
PSM	DADDAVYELDGK	1423	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11274	53.008	2	1309.5674	1309.5674	R	E	49	61
PSM	DADSSISVLEIHSQK	1424	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=15364	72.199	2	1707.7717	1707.7717	K	A	260	275
PSM	DAGQISGLNVLR	1425	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16768	79.735	2	1241.6728	1241.6728	K	V	207	219
PSM	DAHDVSPTSTDTEAQLTVER	1426	sp|Q8IVF2-3|AHNK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=12080	56.569	3	2250.9642	2250.9642	R	Q	189	209
PSM	DAQRLSPIPEEVPK	1427	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=13533	63.267	2	1657.8077	1657.8077	K	S	347	361
PSM	DDKEEEEDGTGSPQLNNR	1428	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=3385	18.419	3	2111.8281	2111.8281	K	-	393	411
PSM	DESKEPIVEVR	1429	sp|P13591-1|NCAM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=8622	41.225	2	1379.6334	1379.6334	K	T	772	783
PSM	DFHATESQTVLNVSK	1430	sp|Q96HH9-4|GRM2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=13530	63.251	2	1754.7876	1754.7876	R	G	267	282
PSM	DGDKSPMSSLQISNEK	1431	sp|Q9UER7-3|DAXX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=7218	34.959	2	1830.7707	1830.7707	K	N	416	432
PSM	DGEEAGAYDGPR	1432	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4724	24.279	2	1235.5055	1235.5055	R	T	108	120
PSM	DGLAPEKTSPDR	1433	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=2809	15.803	2	1364.5973	1364.5973	R	D	9	21
PSM	DGSKEPIVEMR	1434	sp|O15394|NCAM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=4015	21.18	2	1355.5792	1355.5792	K	T	763	774
PSM	DHSPTPSVFNSDEER	1435	sp|Q6UN15-3|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=10073	47.704	3	1795.705	1795.7050	R	Y	416	431
PSM	DKEVSDDEAEEK	1436	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=841	6.8658	2	1472.5556	1472.5556	R	E	227	239
PSM	DLEVVEGSAAR	1437	sp|Q15746-9|MYLK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9001	42.868	2	1144.5724	1144.5724	R	F	617	628
PSM	DMAECSTPLPEDCSPTHSPR	1438	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,5-UNIMOD:4,13-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=8919	42.486	2	2381.8964	2381.8964	R	V	2365	2385
PSM	DMESPTKLDVTLAK	1439	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=14015	65.563	2	1642.7525	1642.7525	K	D	277	291
PSM	DPDAQPGGELMLGGTDSK	1440	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14038	65.68	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSGPAGQPEKPASQEVSTPSQAR	1441	sp|Q5T0Z8|CF132_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	18-UNIMOD:21	ms_run[2]:scan=5463	27.325	3	2403.0704	2403.0704	K	G	710	733
PSM	DSGRGDSVSDSGSDALR	1442	sp|Q53EL6-2|PDCD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=5070	25.684	3	1759.701	1759.7010	R	S	59	76
PSM	DSTSQHDDDNISTTSGFSSR	1443	sp|P49790-2|NU153_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=8798	41.995	3	2235.8553	2235.8553	K	A	171	191
PSM	DVLTGQEFDVR	1444	sp|P43304-2|GPDM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16075	75.876	2	1277.6252	1277.6252	K	A	146	157
PSM	EAFEQPQTSSTPPRDLDSK	1445	sp|P52564|MP2K6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=10652	50.234	2	2211.9685	2211.9685	K	A	18	37
PSM	EALGLGPPAAQLTPPPAPVGLR	1446	sp|Q8IY67|RAVR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=21062	108.68	3	2201.161	2201.1610	R	G	451	473
PSM	EEDEEPESPPEKK	1447	sp|Q9H1E3-2|NUCKS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=1285	8.7208	2	1621.6396	1621.6396	K	T	167	180
PSM	EEEEEMAVVPQGLFR	1448	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35	ms_run[2]:scan=18539	90.243	2	1777.8193	1777.8193	K	G	304	319
PSM	EELAEELASSLSGR	1449	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=21592	113.03	2	1489.726	1489.7260	K	N	1711	1725
PSM	EELGEAAAAFR	1450	sp|Q96DE0-3|NUD16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14260	66.777	2	1162.5619	1162.5619	R	V	33	44
PSM	EFLVAGGEDFK	1451	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16619	78.89	2	1210.587	1210.5870	K	L	236	247
PSM	EGKPSTPESCVSSSSAIIAK	1452	sp|Q7Z3E5|ARMC9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=11324	53.239	3	2113.9603	2113.9603	R	P	697	717
PSM	ENEFSFEDNAIR	1453	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16685	79.251	2	1469.6423	1469.6423	R	G	818	830
PSM	ESPSTRPSTPSLEGSQSSAEGR	1454	sp|Q3KR16-3|PKHG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=7059	34.289	3	2326.0074	2326.0074	R	T	66	88
PSM	ETNLDSLPLVDTHSK	1455	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=16912	80.521	2	1747.803	1747.8030	R	R	425	440
PSM	ETNLDSLPLVDTHSK	1456	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=17485	83.845	2	1747.803	1747.8030	R	R	425	440
PSM	ETNLDSLPLVDTHSK	1457	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=17665	84.86	2	1747.803	1747.8030	R	R	425	440
PSM	ETPHSPGVEDAPIAK	1458	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=8663	41.386	2	1626.7291	1626.7291	R	V	184	199
PSM	EVGEAFTILSDPK	1459	sp|Q99615-2|DNJC7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=18918	92.672	2	1404.7137	1404.7137	K	K	374	387
PSM	FEDYLNAESR	1460	sp|Q16181-2|SEPT7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12879	60.218	2	1242.5517	1242.5517	K	V	137	147
PSM	FFQTACDVPELQDK	1461	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4	ms_run[2]:scan=16967	80.819	2	1696.7767	1696.7767	R	F	1265	1279
PSM	FGYDEIDNGYLK	1462	sp|Q15067-3|ACOX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=17857	85.942	2	1432.6511	1432.6511	K	M	192	204
PSM	FLDELEDEAK	1463	sp|Q9Y2R0|COA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15562	73.215	2	1207.5608	1207.5608	R	A	84	94
PSM	GASKEILSEVER	1464	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=15008	70.466	2	1396.6599	1396.6599	R	N	340	352
PSM	GCVLDVCMGGGDR	1465	sp|Q9Y6R7|FCGBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4,7-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=9649	45.71	2	1410.569	1410.5690	K	D	1904	1917
PSM	GESPVDYDGGR	1466	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4411	22.95	2	1150.4891	1150.4891	K	T	243	254
PSM	GGSTGGGGGFDPPPAYHEVVDAEK	1467	sp|Q9UPU5|UBP24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=16788	79.856	2	2380.0009	2380.0009	R	N	86	110
PSM	GGSTGGGGGFDPPPAYHEVVDAEK	1468	sp|Q9UPU5|UBP24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=16877	80.334	3	2380.0009	2380.0009	R	N	86	110
PSM	GICEALEDSDGR	1469	sp|O00339-4|MATN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4	ms_run[2]:scan=11280	53.03	2	1320.5616	1320.5616	K	Q	549	561
PSM	GISQTNLITTVTPEKK	1470	sp|Q9Y2J2-2|E41L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=16711	79.377	2	1808.9285	1808.9285	K	A	476	492
PSM	GISSSNEGVEEPSKK	1471	sp|Q9NXV6|CARF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=3638	19.521	2	1626.7138	1626.7138	R	R	129	144
PSM	GLVVDMDGFEEER	1472	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35	ms_run[2]:scan=13800	64.559	2	1510.661	1510.6610	K	K	433	446
PSM	GLVVDMDGFEEER	1473	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35	ms_run[2]:scan=14924	70.019	2	1510.661	1510.6610	K	K	433	446
PSM	GPATVEDLPSAFEEK	1474	sp|O14908-2|GIPC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=17784	85.555	2	1588.7621	1588.7621	R	A	152	167
PSM	GSYGSTAHASEPGGQQAAACR	1475	sp|Q6IWH7-2|ANO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=4171	21.864	3	2141.8586	2141.8586	R	A	80	101
PSM	GTSPRPPEGGLGYSQLGDDDLK	1476	sp|Q9UQ88-8|CD11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=16275	76.919	3	2338.0478	2338.0478	R	E	122	144
PSM	GYSFVTTAER	1477	sp|P63267|ACTH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11615	54.522	2	1129.5404	1129.5404	R	E	198	208
PSM	GYTSDSEVYTDHGR	1478	sp|Q92538-3|GBF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=6855	33.423	2	1665.6308	1665.6308	R	P	1315	1329
PSM	HSSISPSTLTLK	1479	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=13976	65.38	2	1429.6255	1429.6255	R	S	435	447
PSM	HSTSDLSDATFSDIR	1480	sp|Q9P227-2|RHG23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21	ms_run[2]:scan=15220	71.502	3	1730.7149	1730.7149	R	R	676	691
PSM	HSTSLTQDESTLTEVK	1481	sp|Q8TF47|ZFP90_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21	ms_run[2]:scan=12983	60.681	3	1854.8248	1854.8248	K	S	433	449
PSM	IDDMTAAPMDVR	1482	sp|P15927|RFA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=5061	25.649	2	1365.5905	1365.5905	K	Q	94	106
PSM	IDYIAGLDSR	1483	sp|P07741-2|APT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15388	72.33	2	1121.5717	1121.5717	R	G	58	68
PSM	IEVIEIMTDR	1484	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=14444	67.642	2	1233.6275	1233.6275	K	G	131	141
PSM	IEVLEEELR	1485	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16246	76.763	2	1128.6027	1128.6027	K	L	1034	1043
PSM	IFVDTDSDIR	1486	sp|Q9NWZ5-4|UCKL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11946	55.95	2	1179.5772	1179.5772	K	L	209	219
PSM	IGPECVDIDECR	1487	sp|O95967|FBLN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=12600	58.884	2	1461.6228	1461.6228	K	Y	158	170
PSM	IISNASCTTNCLAPLAK	1488	sp|P04406-2|G3P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=14224	66.593	2	1832.9125	1832.9125	K	V	104	121
PSM	ILEDHGSPAGEIDDEDK	1489	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=10059	47.648	3	1918.7833	1918.7833	R	D	1670	1687
PSM	IMVDMLDSDGSGK	1490	sp|P17655-2|CAN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=8720	41.642	2	1398.6007	1398.6007	K	L	501	514
PSM	IPSKEEEADMSSPTQR	1491	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3642	19.54	3	1899.7921	1899.7921	K	T	345	361
PSM	IQLVEEELDR	1492	sp|P09493-8|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15542	73.123	2	1242.6456	1242.6456	R	A	92	102
PSM	ITDLYTDLR	1493	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15442	72.618	2	1108.5764	1108.5764	R	D	75	84
PSM	IVTDSDSKTEELR	1494	sp|Q9H2G2-2|SLK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=5627	27.988	2	1571.708	1571.7080	K	F	812	825
PSM	IYVVDVGSEPR	1495	sp|Q13228-2|SBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13245	61.888	2	1232.6401	1232.6401	R	A	40	51
PSM	KETESEAEDNLDDLEK	1496	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=13516	63.188	2	1943.7885	1943.7885	K	H	868	884
PSM	KLPSDSGDLEALEGK	1497	sp|O60524-2|NEMF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=15878	74.814	2	1637.7549	1637.7549	K	D	28	43
PSM	KSELPQDVYTIK	1498	sp|Q14738-3|2A5D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21	ms_run[2]:scan=13229	61.818	3	1499.7273	1499.7273	R	A	466	478
PSM	KSPVSLDDSDIEAR	1499	sp|Q8N8E3|CE112_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21	ms_run[2]:scan=10846	51.071	2	1610.7189	1610.7189	K	L	194	208
PSM	KSSDASACSSSEISVK	1500	sp|P22694-10|KAPCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=4459	23.182	2	1721.7179	1721.7179	R	E	5	21
PSM	KSSTVESEIASEEK	1501	sp|Q9Y2K1-2|ZBTB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=9995	47.376	3	1602.7026	1602.7026	R	S	303	317
PSM	KTSLVIVESADNQPETCER	1502	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=11948	55.957	3	2255.0141	2255.0141	R	L	3843	3862
PSM	LCSSSDTLVSEGEENQKPK	1503	sp|Q5T0W9|FA83B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=9735	46.161	2	2186.9403	2186.9403	R	K	800	819
PSM	LDQDESFSQR	1504	sp|O14727-6|APAF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5145	25.973	2	1223.5418	1223.5418	R	L	206	216
PSM	LDSSEMDHSENEDYTMSSPLPGK	1505	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=12356	57.792	3	2664.0245	2664.0245	R	K	1174	1197
PSM	LEAALGEAK	1506	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5500	27.47	2	900.49165	900.4916	K	K	172	181
PSM	LEAEIATYR	1507	sp|P05783|K1C18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10660	50.273	2	1064.5502	1064.5502	K	R	373	382
PSM	LEQEIATYR	1508	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8623	41.228	2	1121.5717	1121.5717	R	S	373	382
PSM	LFQEDDEIPLYLK	1509	sp|P14406|CX7A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=21435	111.7	2	1621.8239	1621.8239	K	G	34	47
PSM	LGEEDAGAR	1510	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1252	8.5873	2	916.42502	916.4250	R	A	1818	1827
PSM	LGFYGLDESDLDK	1511	sp|Q02218|ODO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=19515	96.764	2	1470.6878	1470.6878	K	V	172	185
PSM	LLEEYGSDDTR	1512	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8018	38.579	2	1296.5834	1296.5834	K	N	2401	2412
PSM	LNTFGDEVFNDPK	1513	sp|P11047|LAMC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16886	80.38	2	1494.6991	1494.6991	R	V	256	269
PSM	LPETNLFETEETR	1514	sp|Q15046|SYK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=17092	81.514	2	1577.7573	1577.7573	K	K	408	421
PSM	LSELEPGTGDLR	1515	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12169	56.993	2	1285.6514	1285.6514	K	F	188	200
PSM	LSPIMTEQDDLGEGDVHSMVYPPSAAK	1516	sp|Q12778|FOXO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21,5-UNIMOD:35,19-UNIMOD:35	ms_run[2]:scan=16625	78.923	3	2998.2977	2998.2977	R	M	328	355
PSM	LSVEGFAVDK	1517	sp|P55786-2|PSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15991	75.43	2	1063.555	1063.5550	K	M	774	784
PSM	LTVSSLQESGLK	1518	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14000	65.489	2	1260.6925	1260.6925	R	V	2327	2339
PSM	LVFNPDQEDLDGDGR	1519	sp|P35442|TSP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16254	76.803	2	1688.7642	1688.7642	R	G	914	929
PSM	MADEQGDMDLQISPDRK	1520	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35,8-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7882	37.99	3	2059.8228	2059.8228	K	T	2115	2132
PSM	MGLTEDEDVR	1521	sp|Q8N3E9|PLCD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=5440	27.228	2	1179.5078	1179.5078	K	A	54	64
PSM	MIAAVDTDSPR	1522	sp|Q07812-6|BAX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=5191	26.168	2	1190.5601	1190.5601	-	E	1	12
PSM	MKSSSSVTTSETQPCTPSSSDYSDLQR	1523	sp|P50552|VASP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11669	54.747	3	3045.258	3045.2580	R	V	320	347
PSM	MLDQSTDFEER	1524	sp|P53814-2|SMTN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=8283	39.729	2	1385.5769	1385.5769	K	K	139	150
PSM	MMEVAAADVK	1525	sp|Q96KP4-2|CNDP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=3014	16.736	2	1095.494	1095.4940	R	Q	44	54
PSM	MMEVAAADVK	1526	sp|Q96KP4-2|CNDP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35,2-UNIMOD:35	ms_run[2]:scan=3093	17.118	2	1095.494	1095.4940	R	Q	44	54
PSM	MTGLVDEAIDTK	1527	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=12470	58.31	2	1307.6279	1307.6279	K	S	709	721
PSM	NCSEEKSPQTSILK	1528	sp|Q8ND24|RN214_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=7913	38.12	2	1699.7488	1699.7488	R	E	148	162
PSM	NDLAVVDVR	1529	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11761	55.145	2	999.53491	999.5349	K	I	334	343
PSM	NENEEILER	1530	sp|Q9UHB6-3|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6989	33.979	2	1144.536	1144.5360	K	P	167	176
PSM	NFDDEDSVDGNRPSSASSTSSK	1531	sp|Q7Z460-2|CLAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=5966	29.504	2	2380.9292	2380.9292	K	A	240	262
PSM	NFSDNQLQEGK	1532	sp|P37802|TAGL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6576	32.193	2	1278.584	1278.5840	R	N	161	172
PSM	NFYESDDDQKEK	1533	sp|O00203-3|AP3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=5202	26.212	2	1596.5981	1596.5981	K	T	223	235
PSM	NLLIDDDDDFSTIR	1534	sp|Q9NVE5|UBP40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=20155	101.42	2	1650.7737	1650.7737	K	D	1168	1182
PSM	NSTGSQDGPVSNPSSSNSSQDSLHK	1535	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=5026	25.513	3	2596.0675	2596.0675	R	A	772	797
PSM	PFPSEETTENDDDVYR	1536	sp|P52735-3|VAV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12436	58.168	3	1912.7963	1912.7963	R	S	128	144
PSM	PSQVVAETR	1537	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1693	10.586	2	985.51926	985.5193	R	K	831	840
PSM	QLEYQQLEDDKLSQK	1538	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=14438	67.615	2	1943.8878	1943.8878	K	S	76	91
PSM	QPASAQSTPSTTPHSSPK	1539	sp|Q96A73-2|P33MX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	16-UNIMOD:21	ms_run[2]:scan=1099	7.9564	2	1887.8364	1887.8364	R	Q	149	167
PSM	RASVCAEAYNPDEEEDDAESR	1540	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=10521	49.645	3	2491.9435	2491.9435	R	I	112	133
PSM	RDSDGVDGFEAEGK	1541	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=7796	37.644	3	1560.6093	1560.6093	R	K	1052	1066
PSM	RLSPSASPPR	1542	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=4205	22.032	2	1226.521	1226.5210	R	R	386	396
PSM	RLSPSASPPR	1543	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=4427	23.043	2	1226.521	1226.5210	R	R	386	396
PSM	RNSVDTATSSSLSTPSEPLSPTSSLGEER	1544	sp|P13807-2|GYS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=16253	76.799	3	3071.3932	3071.3932	K	N	644	673
PSM	RVSGEPQQSGDGSLSPQAEAIEVAAGESAGR	1545	sp|Q96NY7-2|CLIC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=18579	90.496	3	3119.4157	3119.4157	R	S	291	322
PSM	SASMKLPDNTVK	1546	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=4160	21.814	2	1385.6262	1385.6262	R	L	392	404
PSM	SDGSLEDGDDVHR	1547	sp|Q9NRX5|SERC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=3294	17.998	3	1480.5467	1480.5467	R	A	361	374
PSM	SDNLSDSSHSEISSR	1548	sp|Q8TEU7-5|RPGF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=4509	23.402	2	1699.6687	1699.6687	K	S	1266	1281
PSM	SEAGHASSPDSEVTSLCQK	1549	sp|Q6NZY4-2|ZCHC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=7278	35.234	3	2068.8409	2068.8409	K	E	353	372
PSM	SEHPESSLSSEEETAGVENVK	1550	sp|Q92932-2|PTPR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=11540	54.203	3	2323.9693	2323.9693	K	S	428	449
PSM	SESIAFIEESKK	1551	sp|P29475-3|NOS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=13020	60.844	2	1446.6643	1446.6643	R	D	1079	1091
PSM	SETDLLDIR	1552	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16358	77.343	2	1060.5401	1060.5401	R	S	429	438
PSM	SFDDEESVDGNRPSSAASAFK	1553	sp|O75122-2|CLAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=13859	64.821	2	2294.9329	2294.9329	K	V	14	35
PSM	SGDETPGSEVPGDK	1554	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3603	19.375	2	1373.5947	1373.5947	R	A	161	175
PSM	SGEFHAEPTVIEK	1555	sp|O15061-2|SYNEM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=11047	52	2	1522.6705	1522.6705	R	E	913	926
PSM	SGSPAPETTNESVPFAQHSSLDSR	1556	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=13877	64.915	3	2580.113	2580.1130	R	I	468	492
PSM	SGSSQELDVKPSASPQER	1557	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=6714	32.789	3	1980.879	1980.8790	R	S	1539	1557
PSM	SHSQASLAGPGPVDPSNR	1558	sp|Q9P2M7-2|CING_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=8491	40.668	2	1935.7877	1935.7877	R	S	129	147
PSM	SKSEMSYIDGEK	1559	sp|Q9BX66-12|SRBS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=4375	22.785	2	1468.5793	1468.5793	R	V	268	280
PSM	SKSPLPPEEEAK	1560	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=2672	15.156	2	1390.6381	1390.6381	R	D	226	238
PSM	SKSQDADSPGSSGAPENLTFK	1561	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=12156	56.937	3	2201.9478	2201.9478	R	E	1772	1793
PSM	SLEDVTAEYIHK	1562	sp|Q9P0K7-4|RAI14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=15957	75.237	2	1483.6596	1483.6596	K	A	638	650
PSM	SLGDDISSETSGDFR	1563	sp|P12429|ANXA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15573	73.269	3	1584.6904	1584.6904	K	K	139	154
PSM	SLMDSDDDALLK	1564	sp|O75911|DHRS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35	ms_run[2]:scan=12046	56.409	2	1337.6021	1337.6021	K	S	131	143
PSM	SLQATESELRASQEK	1565	sp|Q5TZA2-2|CROCC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=8652	41.338	2	1755.804	1755.8040	R	I	911	926
PSM	SLSSSLDDTEVKK	1566	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=7341	35.501	2	1487.6756	1487.6756	K	V	156	169
PSM	SLSSSLDDTEVKK	1567	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=10550	49.766	3	1487.6756	1487.6756	K	V	156	169
PSM	SMYEEEINETR	1568	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35	ms_run[2]:scan=7611	36.856	2	1415.5875	1415.5875	K	R	210	221
PSM	SPSAIPEQNHSLNDQAK	1569	sp|Q13129|RLF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=6800	33.214	2	1914.8473	1914.8473	K	G	632	649
PSM	SPSKPLPEVTDEYK	1570	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=11762	55.148	2	1668.7648	1668.7648	R	N	92	106
PSM	SPSSPIHEEDEEK	1571	sp|O60291-4|MGRN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=2750	15.511	2	1562.6138	1562.6138	R	L	435	448
PSM	SQSSHSYDDSTLPLIDR	1572	sp|O60716-32|CTND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=16009	75.52	2	1999.8524	1999.8524	R	N	530	547
PSM	SQSSHSYDDSTLPLIDR	1573	sp|O60716-32|CTND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=16147	76.259	3	1999.8524	1999.8524	R	N	530	547
PSM	SRSTTELDDYSTNK	1574	sp|Q8WWI1-3|LMO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=6324	31.1	3	1695.6989	1695.6989	K	N	1087	1101
PSM	SSESDHFSYVQLR	1575	sp|Q96JQ2|CLMN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=14952	70.161	2	1633.6774	1633.6774	R	N	920	933
PSM	SSFASSSASDASKPSSPR	1576	sp|Q96IF1|AJUBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=3649	19.566	2	1834.7735	1834.7735	R	G	122	140
PSM	SSSSSSQPEHSAMLVSTAASPSLIK	1577	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:35,20-UNIMOD:21	ms_run[2]:scan=14889	69.852	3	2584.1728	2584.1728	K	E	291	316
PSM	SSSSSSQPEHSAMLVSTAASPSLIK	1578	sp|P42166|LAP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=16180	76.431	3	2584.1728	2584.1728	K	E	291	316
PSM	SSTVATLQGTPDHGDPR	1579	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=6275	30.894	2	1817.7945	1817.7945	K	T	155	172
PSM	SSVKTPETVVPTAPELQPSTSTDQPVTPEPTSQATR	1580	sp|Q14676-2|MDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=16934	80.639	3	3842.8463	3842.8463	R	G	1176	1212
PSM	STAGDTHLGGEDFDNR	1581	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=8302	39.806	3	1770.6846	1770.6846	K	M	221	237
PSM	STESLQANVQR	1582	sp|P26373|RL13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4869	24.886	2	1231.6157	1231.6157	K	L	106	117
PSM	STGDGTLGRASEVEVK	1583	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=9220	43.871	2	1684.7669	1684.7669	K	N	234	250
PSM	STQIENQHQGAQDTSDLMSPSK	1584	sp|Q9NVR2|INT10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	18-UNIMOD:35,21-UNIMOD:21	ms_run[2]:scan=5311	26.669	3	2497.0428	2497.0428	R	R	213	235
PSM	SYELPDGQVITIGNER	1585	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=19892	99.467	2	1789.8846	1789.8846	K	F	239	255
PSM	SYIGSNHSSLGSMSPSNMEGYSK	1586	sp|P78310-7|CXAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,13-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=9474	44.942	3	2530.9982	2530.9982	R	T	252	275
PSM	SYSCQVTHEGSTVEK	1587	sp|P0DOY3|IGLC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=6563	32.13	2	1790.7182	1790.7182	K	T	84	99
PSM	TASNPKVENEDEPVR	1588	sp|Q9UBF8-2|PI4KB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=4442	23.107	2	1763.7727	1763.7727	R	L	292	307
PSM	TEEPLGSPHPSGTVESPGEGPQDTR	1589	sp|Q9NWS9-2|ZN446_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=10886	51.247	3	2640.1341	2640.1341	K	I	131	156
PSM	TELQTITNDPR	1590	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9405	44.649	2	1286.6466	1286.6466	R	L	974	985
PSM	TELSQSDMFDQR	1591	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:35	ms_run[2]:scan=8256	39.611	2	1471.6249	1471.6249	K	L	201	213
PSM	TGMMDTDDFR	1592	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=3500	18.924	2	1219.4485	1219.4485	K	A	763	773
PSM	TKSPTDDEVTPSAVVR	1593	sp|Q9Y2H5|PKHA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=8755	41.808	2	1780.8244	1780.8244	R	R	775	791
PSM	TLEQSNSKLEVQIK	1594	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=12312	57.603	2	1695.8444	1695.8444	R	Q	90	104
PSM	TLSQGESQTSEHELFLDTK	1595	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=15462	72.722	2	2228.9838	2228.9838	K	I	973	992
PSM	TSKVELTLASPYMK	1596	sp|Q9HCH5-12|SYTL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=14908	69.932	2	1662.794	1662.7940	K	Q	401	415
PSM	TSSAFVGKTPEASPEPK	1597	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=7662	37.072	2	1811.8343	1811.8343	K	D	303	320
PSM	TTKSPSDSGYSYETIGK	1598	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=9848	46.704	3	1899.8139	1899.8139	R	T	1912	1929
PSM	TTTTNTQVEGDDEAAFLER	1599	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15467	72.745	3	2096.9498	2096.9498	K	L	75	94
PSM	TWNDPSVQQDIK	1600	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12090	56.615	2	1429.6838	1429.6838	R	F	102	114
PSM	VAAAAGSGPSPPGSPGHDR	1601	sp|Q9BTU6|P4K2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3715	19.839	2	1846.7401	1846.7401	R	E	38	57
PSM	VASGSDLHLTDIDSDSNR	1602	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=13825	64.667	2	1980.8426	1980.8426	K	G	70	88
PSM	VDDFLANEAK	1603	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11848	55.534	2	1120.5401	1120.5401	K	G	26	36
PSM	VDEEPTTLPSGEAKPR	1604	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=7991	38.46	2	1804.8244	1804.8244	R	K	305	321
PSM	VEGDMQVPDLDIK	1605	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=14488	67.85	2	1473.7021	1473.7021	K	G	3898	3911
PSM	VELQELNDR	1606	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10025	47.497	2	1114.5619	1114.5619	K	F	105	114
PSM	VELQELNDR	1607	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10262	48.53	2	1114.5619	1114.5619	K	F	105	114
PSM	VGEEFDEDNR	1608	sp|Q96R05|RET7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5430	27.187	2	1208.4946	1208.4946	K	G	67	77
PSM	VISDSESDIGGSDVEFKPDTK	1609	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=14360	67.225	3	2304.0046	2304.0046	R	E	250	271
PSM	VLEVDEKSPEAK	1610	sp|P0C851|PIRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=5230	26.327	2	1422.6643	1422.6643	K	D	9	21
PSM	VLIGGDETPEGQR	1611	sp|O60701-3|UGDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8636	41.278	2	1369.6838	1369.6838	R	A	81	94
PSM	VLVDSLVEDDR	1612	sp|Q92621|NU205_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15375	72.25	2	1258.6405	1258.6405	K	T	1524	1535
PSM	VNVDEVGGEALGR	1613	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10678	50.355	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1614	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12826	59.983	3	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1615	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14393	67.38	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1616	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14600	68.419	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1617	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15016	70.509	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1618	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15527	73.043	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1619	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14804	69.432	2	1313.6575	1313.6575	K	L	19	32
PSM	VSVVSPDHVSDSTVSAR	1620	sp|Q6NV74|K121L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=10734	50.604	3	1820.8306	1820.8306	K	I	181	198
PSM	VVDVLDSIK	1621	sp|P00918|CAH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16743	79.584	2	986.56481	986.5648	K	T	159	168
PSM	VVNTDHGSPEQLQIPVTDSGR	1622	sp|Q6IQ49-3|SDE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=13732	64.25	3	2328.0747	2328.0747	R	H	176	197
PSM	YGLQDSDEEEEEHPSK	1623	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=6371	31.298	2	1970.7419	1970.7419	K	T	866	882
PSM	YGLQDSDEEEEEHPSK	1624	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=7013	34.082	3	1970.7419	1970.7419	K	T	866	882
PSM	YKSTTSVSEEDVSSR	1625	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=5001	25.419	3	1753.7408	1753.7408	R	Y	226	241
PSM	YQSSPAKPDSSFYK	1626	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=8976	42.76	2	1683.7182	1683.7182	R	G	282	296
PSM	YSQLVVETIR	1627	sp|Q92522|H1X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14862	69.72	2	1206.6608	1206.6608	K	R	48	58
PSM	YYRPTEVDFLQGDCTK	1628	sp|O60547-2|GMDS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=17281	82.631	2	2070.8758	2070.8758	K	A	293	309
PSM	YYSPCEEHPAETNQNEGAESGTIR	1629	sp|A5YM69|ARG35_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=9642	45.679	3	2818.1178	2818.1178	R	Q	182	206
PSM	CDSGFALDSEER	1630	sp|P35555|FBN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=15716	73.995565	2	1367.5297	1367.5294	R	N	1055	1067
PSM	SGAQASSTPLSPTR	1631	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4544	23.54676166666667	2	1358.677677	1358.679007	R	I	12	26
PSM	VAELYEEELR	1632	sp|P17661|DESM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=14129	66.12327166666667	2	1248.599045	1249.619033	R	E	151	161
PSM	TSSKESSPIPSPTSDR	1633	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:21	ms_run[1]:scan=6508	31.894658333333332	2	1754.7707	1754.7719	R	K	2159	2175
PSM	SKSQDADSPGSSGAPENLTFK	1634	sp|P55196|AFAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=11938	55.91714666666667	3	2201.947308	2201.947788	R	E	1772	1793
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1635	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=5317	26.69448	3	3007.3275	3007.3290	K	S	145	174
PSM	MPEDGLSDDK	1636	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:35	ms_run[1]:scan=2195	12.93346	2	1121.450875	1121.454670	K	K	622	632
PSM	QSVDKVTSPTKV	1637	sp|Q05682|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=9561	45.33276666666667	2	1350.6409	1350.6427	K	-	782	794
PSM	ESTQLSPADLTEGKPTD	1638	sp|Q08J23|NSUN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	6-UNIMOD:21	ms_run[1]:scan=14079	65.88221166666666	2	1867.8057	1867.8083	R	P	451	468
PSM	ENSREALAEAALESPR	1639	sp|O14745|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	3-UNIMOD:21	ms_run[1]:scan=15333	72.05422666666668	2	1822.8072	1821.8252	K	P	267	283
PSM	TSQVGAASAPAKESPR	1640	sp|Q13428|TCOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	14-UNIMOD:21	ms_run[1]:scan=2458	14.174598333333334	2	1635.749568	1635.761765	K	K	368	384
PSM	IESALLDGSER	1641	sp|Q14112|NID2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=11108	52.282203333333335	2	1188.582280	1188.598632	K	K	1210	1221
PSM	NDQCYDDIR	1642	sp|Q9ULV4|COR1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4	ms_run[1]:scan=5592	27.850173333333334	2	1198.494321	1197.472051	K	V	20	29
PSM	LLLSEEEIEK	1643	sp|Q9HAB8|PPCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=14925	70.02217333333333	2	1201.653709	1201.644185	K	G	278	288
PSM	EMEHNTVCAAGTSPVGEIGEEK	1644	sp|P18583|SON_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:35,8-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=11112	52.301406666666665	3	2440.974870	2439.992372	K	I	1544	1566
PSM	KSSPQSTDTAMDLLK	1645	sp|Q9UGU5|HMGX4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=10843	51.06035	3	1716.751959	1716.764133	K	A	100	115
PSM	SSAEVIAQAR	1646	sp|Q16555|DPYL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=4465	23.208526666666668	2	1030.539610	1030.540723	K	K	259	269
PSM	VDDFLANEAK	1647	sp|P52209|6PGD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=11811	55.363838333333334	2	1120.538684	1120.540054	K	G	39	49
PSM	CDSSPDSAEDVRK	1648	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=1326	8.896239999999999	2	1528.5532	1527.5542	K	V	132	145
PSM	QQLELLEEDKK	1649	sp|A0MZ66|SHOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=15989	75.41677666666668	2	1354.6973	1354.6975	K	E	308	319
PSM	GSGHPAYAEVEPVGEK	1650	sp|Q6UX71|PXDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:21	ms_run[1]:scan=9226	43.89692	2	1707.745540	1705.734881	R	E	505	521
PSM	QFEDELHPDLK	1651	sp|Q9Y3C6|PPIL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=17502	83.939865	2	1352.6247	1352.6243	K	F	81	92
PSM	ASHSAVDITK	1652	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:21	ms_run[1]:scan=2295	13.433320000000002	2	1107.495146	1107.496155	R	V	302	312
PSM	GGGGGQDNGLEGLGNDSR	1653	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9433	44.75933166666667	2	1659.706079	1658.724454	R	D	394	412
PSM	SPDTNYLFMGDYVDR	1654	sp|P67775|PP2AA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:35	ms_run[1]:scan=18270	88.49985833333334	2	1807.803196	1807.772316	K	G	75	90
PSM	AEQSLHDLQER	1655	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:21	ms_run[1]:scan=6119	30.180835	2	1404.602801	1404.603473	R	L	254	265
PSM	SDSYVLLEHSVK	1656	sp|Q9UJX4|APC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=14922	70.00618833333333	2	1455.663568	1455.664677	R	K	355	367
PSM	KSEDDSAVPLAK	1657	sp|Q9Y2W2|WBP11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:21	ms_run[1]:scan=5476	27.37449	2	1338.606001	1338.606827	R	A	599	611
PSM	RQSFASLALR	1658	sp|Q12955|ANK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21,6-UNIMOD:21	ms_run[1]:scan=15879	74.81812666666667	2	1307.579312	1307.578853	R	K	1457	1467
PSM	FEDGGYVVCNTR	1659	sp|Q3B8N2|LEG9B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=10427	49.252876666666666	2	1414.638198	1415.613964	R	Q	66	78
PSM	GFGFVDFNSEEDAK	1660	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=19644	97.64621666666666	2	1561.656497	1560.673253	K	A	611	625
PSM	ETPHSPGVEDAPIAK	1661	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:21	ms_run[1]:scan=11307	53.158683333333336	2	1625.695553	1626.729068	R	V	486	501
PSM	YVPPSSTDRSPYEK	1662	sp|P15941|MUC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:21	ms_run[1]:scan=5636	28.02566	2	1704.738924	1704.739633	R	V	1218	1232
PSM	GVVTNGLDLSPADEKK	1663	sp|P07197|NFM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:21	ms_run[1]:scan=14367	67.26121166666667	2	1720.795623	1721.823697	K	G	828	844
PSM	KTSASDVTNIYPGDAGK	1664	sp|Q15042|RB3GP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=10701	50.46080333333333	2	1802.803508	1802.808775	K	A	535	552
PSM	FDMELDDLPK	1665	sp|P28482|MK01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:35	ms_run[1]:scan=15100	70.91051333333333	2	1237.553271	1237.553656	K	E	331	341
PSM	TTKSPSDSGYSYETIGK	1666	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:21	ms_run[1]:scan=9965	47.24379666666667	2	1901.784371	1899.813920	R	T	1912	1929
PSM	TGRDTPENGETAIGAENSEK	1667	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:21	ms_run[1]:scan=6109	30.133948333333333	2	2155.889517	2154.906651	K	I	475	495
PSM	RDSLGAYASQDANEQGQDLGK	1668	sp|Q9C0C2|TB182_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=11156	52.48946166666667	3	2302.965246	2301.986298	K	R	891	912
PSM	SYIGSNHSSLGSMSPSNMEGYSK	1669	sp|P78310|CXAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:21,13-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=10159	48.078125	3	2531.977953	2530.998186	R	T	293	316
PSM	AALSEEELEKK	1670	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=7390	35.755	2	1325.6116	1325.6116	K	S	1039	1050
PSM	AAYFGVYDTAK	1671	sp|P12236|ADT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14349	67.175	2	1204.5764	1204.5764	R	G	189	200
PSM	ADGATSDDLDLHDDR	1672	sp|Q07157-2|ZO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=8194	39.328	3	1694.6421	1694.6421	K	L	805	820
PSM	AEEKSPISINVK	1673	sp|Q9UK58-6|CCNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=9159	43.593	2	1393.6854	1393.6854	K	T	348	360
PSM	AEGDVAALNR	1674	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5052	25.614	2	1014.5094	1014.5094	K	R	45	55
PSM	AEGPEVDVNLPK	1675	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=13498	63.105	2	1266.6456	1266.6456	K	A	764	776
PSM	AEIDMLDIR	1676	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35	ms_run[2]:scan=13738	64.276	2	1090.5329	1090.5329	R	A	194	203
PSM	AEQSLHDLQER	1677	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=5882	29.158	2	1404.6035	1404.6035	R	L	254	265
PSM	AEQSLHDLQER	1678	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=6948	33.805	2	1404.6035	1404.6035	R	L	254	265
PSM	ALSASHTDLAH	1679	sp|Q07866-6|KLC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=4622	23.831	2	1201.5129	1201.5129	R	-	618	629
PSM	AQGEPVAGHESPK	1680	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=1138	8.1179	2	1385.5977	1385.5977	R	I	522	535
PSM	ASTLLRDEELEEIK	1681	sp|Q99653|CHP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=16710	79.373	2	1724.8234	1724.8234	R	K	5	19
PSM	ATGSAGLLGDPECEGSPPEHSPEQGR	1682	sp|Q5TH69|BIG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12531	58.588	3	2714.128	2714.1280	K	S	1046	1072
PSM	ATQQQHDFTLTQTADGR	1683	sp|P78527-2|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=9974	47.281	3	1996.864	1996.8640	R	S	2637	2654
PSM	AVFDETYPDPVR	1684	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15842	74.638	2	1407.667	1407.6670	R	V	684	696
PSM	CGDLEEELK	1685	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:4	ms_run[2]:scan=10165	48.105	2	1091.4805	1091.4805	K	N	154	163
PSM	CLDENNYDR	1686	sp|Q9BUK0|CHCH7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:4	ms_run[2]:scan=3757	20.03	2	1197.4721	1197.4721	R	E	26	35
PSM	DDKEEEEDGTGSPQLNNR	1687	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=2751	15.515	3	2111.8281	2111.8281	K	-	393	411
PSM	DENESPFPDIPK	1688	sp|Q9UKK3|PARP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16616	78.875	2	1386.6303	1386.6303	R	V	1182	1194
PSM	DFTPVCTTELGR	1689	sp|P30041|PRDX6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=14899	69.897	2	1394.65	1394.6500	R	A	42	54
PSM	DGDKSPMSSLQISNEK	1690	sp|Q9UER7-3|DAXX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=6981	33.946	2	1830.7707	1830.7707	K	N	416	432
PSM	DPDAQPGGELMLGGTDSK	1691	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=11582	54.373	3	1802.7993	1802.7993	R	Y	236	254
PSM	DQGTYEDYVEGLR	1692	sp|P60660-2|MYL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17480	83.804	2	1543.6791	1543.6791	K	V	82	95
PSM	DSGLEDGRESPSFDTPSQR	1693	sp|Q6U841-4|S4A10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=10085	47.757	3	2158.8804	2158.8804	R	V	80	99
PSM	DSGLEDGRESPSFDTPSQR	1694	sp|Q6U841-4|S4A10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=10548	49.754	2	2158.8804	2158.8804	R	V	80	99
PSM	DSLGDSGYASQHK	1695	sp|O00409-2|FOXN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=3417	18.581	2	1443.5668	1443.5668	K	K	385	398
PSM	DSPPPHEDYEDEVFVR	1696	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=15835	74.603	3	2009.8044	2009.8044	R	D	1496	1512
PSM	DTDDVPMILVGNK	1697	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=16057	75.771	2	1431.6915	1431.6915	K	C	86	99
PSM	DVLLPLKSGSDSSQADQEAK	1698	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=13972	65.361	3	2167.0046	2167.0046	K	E	158	178
PSM	DVPESPQHAADTPK	1699	sp|P13994|CC130_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=3856	20.496	2	1570.6665	1570.6665	R	S	302	316
PSM	EALTYDGALLGDR	1700	sp|Q15056-2|IF4H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16883	80.365	2	1392.6885	1392.6885	K	S	97	110
PSM	EARESPDTQALLTCAEK	1701	sp|Q2T9K0-2|TMM44_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13605	63.603	3	1997.8765	1997.8765	K	E	282	299
PSM	EDALDDSVSSSSVHASPLASSPVR	1702	sp|Q7Z3J3|RGPD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	21-UNIMOD:21	ms_run[2]:scan=15235	71.57	3	2492.1068	2492.1068	R	K	1256	1280
PSM	EELIGQISDIR	1703	sp|Q96JQ2|CLMN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17744	85.315	2	1271.6721	1271.6721	R	V	12	23
PSM	EESDDELSLGHGR	1704	sp|Q9H5I5-3|PIEZ2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=7903	38.077	2	1522.5937	1522.5937	R	R	9	22
PSM	EETETFPSKYESDTGNLSPSK	1705	sp|Q9HCH5-12|SYTL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	18-UNIMOD:21	ms_run[2]:scan=12514	58.512	3	2425.021	2425.0210	K	L	177	198
PSM	EFGDGSDENEMEEHELK	1706	sp|Q5F1R6|DJC21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=8987	42.814	2	2089.746	2089.7460	K	D	278	295
PSM	EHSLEDNSSPNSLEPLK	1707	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12539	58.623	2	1974.8572	1974.8572	K	H	172	189
PSM	EKGSTLDLSDLEAEK	1708	sp|O00767|ACOD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=16250	76.783	2	1713.771	1713.7710	K	L	195	210
PSM	EMDTARTPLSEAEFEEIMNR	1709	sp|Q16630-3|CPSF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35,4-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=17365	83.16	3	2480.0237	2480.0237	R	N	328	348
PSM	EMEKSFDEQNVPK	1710	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=6553	32.087	2	1675.6801	1675.6801	R	R	309	322
PSM	ENPPVEDSSDEDDKR	1711	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=1730	10.744	2	1810.6894	1810.6894	R	N	491	506
PSM	ENSDSDEAHLSPQAGR	1712	sp|O94988-6|FA13A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=3890	20.632	2	1791.7061	1791.7061	R	L	233	249
PSM	ENSREALAEAALESPR	1713	sp|O14745-2|NHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=14759	69.205	3	1821.8258	1821.8258	K	P	111	127
PSM	EPALNEANLSNLK	1714	sp|Q06323-3|PSME1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15073	70.789	2	1411.7307	1411.7307	K	A	46	59
PSM	ESTPSEEPSPPHNSK	1715	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=2428	14.039	2	1701.6883	1701.6883	K	H	1495	1510
PSM	ESVSTASDQPSHSLER	1716	sp|Q8TEW0-8|PARD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=5927	29.344	2	1808.7578	1808.7578	R	Q	958	974
PSM	ETKSEETLDEGPPK	1717	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=4875	24.912	2	1638.7026	1638.7026	K	Y	97	111
PSM	ETPHSPGVEDAPIAK	1718	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=9124	43.452	2	1626.7291	1626.7291	R	V	184	199
PSM	ETPRPEGGSPSPAGTPPQPK	1719	sp|Q9BR39|JPH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=5093	25.768	2	2145.9133	2145.9133	R	R	476	496
PSM	ETTCSKESNEELTESCETK	1720	sp|P01042-3|KNG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=4114	21.618	2	2340.8975	2340.8975	R	K	289	308
PSM	EYINECDSDYHEER	1721	sp|Q93008-1|USP9X_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=7845	37.841	2	1937.6775	1937.6775	R	T	859	873
PSM	FADQDDIGNVSFDR	1722	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15928	75.094	2	1597.7009	1597.7009	K	V	489	503
PSM	FADQDDIGNVSFDR	1723	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16082	75.92	3	1597.7009	1597.7009	K	V	489	503
PSM	FDYEGLDPK	1724	sp|Q15124|PGM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=13782	64.486	2	1082.492	1082.4920	R	T	433	442
PSM	FGDPVVQSDMK	1725	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=7456	36.129	2	1237.5649	1237.5649	K	H	78	89
PSM	FYQASTSELYGK	1726	sp|O60547-2|GMDS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12480	58.355	2	1392.6561	1392.6561	K	V	120	132
PSM	GAKLTPEEEEILNK	1727	sp|P62241|RS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=13923	65.133	3	1649.7913	1649.7913	K	K	126	140
PSM	GATQQILDEAER	1728	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12947	60.522	2	1329.6525	1329.6525	R	S	330	342
PSM	GDEELDSLIK	1729	sp|Q71UI9-3|H2AV_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16151	76.283	2	1117.5503	1117.5503	R	A	55	65
PSM	GDLGIEIPAEK	1730	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15532	73.071	2	1140.6027	1140.6027	R	V	280	291
PSM	GDYDAFFEAR	1731	sp|O75368|SH3L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17582	84.386	2	1189.504	1189.5040	R	E	77	87
PSM	GEGPDVDVSLPK	1732	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=13694	64.068	2	1211.6034	1211.6034	K	A	4795	4807
PSM	GGKSGELEQEEER	1733	sp|P10645|CMGA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=3058	16.958	2	1526.625	1526.6250	R	L	319	332
PSM	GKDSLSDDGVDLK	1734	sp|P07948-2|LYN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=9748	46.225	3	1427.6181	1427.6181	K	T	8	21
PSM	GLESTTLADK	1735	sp|P21291|CSRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6607	32.336	2	1033.5292	1033.5292	K	D	152	162
PSM	GLVVDMDGFEEER	1736	sp|P49588|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=14693	68.896	2	1510.661	1510.6610	K	K	433	446
PSM	GMKDDDYDDQLC	1737	sp|P32121-5|ARRB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6152	30.336	2	1489.5337	1489.5337	K	-	383	395
PSM	GPEVDIEGPEGK	1738	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9257	44.038	2	1225.5826	1225.5826	K	L	4490	4502
PSM	GQLSDDEKFLFVDK	1739	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=18812	91.999	2	1719.7757	1719.7757	K	N	5	19
PSM	GSMPAYSGNNMDKSDSELNSEVAAR	1740	sp|Q53TN4-3|CYBR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=9490	45.008	3	2741.0946	2741.0946	R	K	189	214
PSM	GSSPSIRPIQGSQGSSSPVEK	1741	sp|Q92560|BAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=8868	42.282	3	2164.0161	2164.0161	K	E	581	602
PSM	GVQVETISPGDGR	1742	sp|P62942|FKB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8857	42.237	2	1313.6575	1313.6575	M	T	2	15
PSM	GVVDSDDLPLNVSR	1743	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14869	69.75	3	1484.7471	1484.7471	K	E	435	449
PSM	HSSEDSDITSLIEAMDK	1744	sp|Q92545|TM131_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=18063	87.235	3	1972.7973	1972.7973	R	D	1340	1357
PSM	IAELCDDPK	1745	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:4	ms_run[2]:scan=5801	28.738	2	1059.4907	1059.4907	K	E	418	427
PSM	IDATSASVLASR	1746	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10988	51.711	2	1189.6303	1189.6303	K	F	120	132
PSM	IETDEEESCDNAHGDANQPAR	1747	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=3506	18.95	3	2436.9125	2436.9125	R	D	1051	1072
PSM	IETIEVMEDR	1748	sp|P51991-2|ROA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=9096	43.318	2	1249.586	1249.5860	K	Q	130	140
PSM	ISAEGGEQVER	1749	sp|Q9BQE5|APOL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3180	17.485	2	1173.5626	1173.5626	R	V	249	260
PSM	ISLNSLCYGDMDK	1750	sp|O75131|CPNE3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=15821	74.533	2	1530.6694	1530.6694	K	T	196	209
PSM	ITAEEMYDIFGK	1751	sp|Q9Y3B4|SF3B6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=17453	83.652	2	1431.6592	1431.6592	K	Y	30	42
PSM	ITESSLVEITEHK	1752	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=17116	81.671	2	1564.7386	1564.7386	K	D	269	282
PSM	KASVVDPSTESSPAPQEGSEQPASPASPLSSR	1753	sp|Q66K14-2|TBC9B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12632	59.042	3	3259.4882	3259.4882	R	Q	409	441
PSM	KDSIPQVLLPEEEK	1754	sp|Q15052-2|ARHG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=18141	87.702	2	1703.8383	1703.8383	R	L	528	542
PSM	KGDSEAEALSEIK	1755	sp|Q5T1M5-2|FKB15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=11954	55.983	3	1455.6494	1455.6494	R	D	999	1012
PSM	KGESQTDIEITR	1756	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=7047	34.233	2	1455.6607	1455.6607	K	E	211	223
PSM	KNSSTDQGSDEEGSLQK	1757	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=1662	10.459	2	1888.7688	1888.7688	R	E	1060	1077
PSM	KNSTDLDSAPEDPTSPK	1758	sp|Q96RK0|CIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=6536	32.019	3	1880.8041	1880.8041	R	R	1395	1412
PSM	KPSEDEVLNK	1759	sp|Q8NDI1-3|EHBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3885	20.611	2	1237.5591	1237.5591	R	G	985	995
PSM	KPSVGVPPPASPSYPR	1760	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=11300	53.128	2	1794.8107	1794.8107	R	A	969	985
PSM	KSSTGSPTSPLNAEK	1761	sp|Q15746-9|MYLK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4965	25.278	2	1662.6903	1662.6903	R	L	571	586
PSM	KTGSQYDIQDAIDK	1762	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=12838	60.032	3	1660.7345	1660.7345	R	G	2523	2537
PSM	KTLDELSQGTTTVK	1763	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=9151	43.561	2	1599.7757	1599.7757	R	E	1542	1556
PSM	KTLDELSQGTTTVK	1764	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=9456	44.86	2	1599.7757	1599.7757	R	E	1542	1556
PSM	KTSLVIVESADNQPETCER	1765	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=12375	57.881	3	2255.0141	2255.0141	R	L	3843	3862
PSM	KVSQSTSSLVDTSVSATSR	1766	sp|Q8IY17-5|PLPL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=11939	55.92	3	2018.9521	2018.9521	R	P	66	85
PSM	LAVEALSSLDGDLAGR	1767	sp|P12277|KCRB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=19613	97.443	2	1585.8312	1585.8312	K	Y	157	173
PSM	LCSSSDTLVSEGEENQKPK	1768	sp|Q5T0W9|FA83B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:4,4-UNIMOD:21	ms_run[2]:scan=9049	43.068	3	2186.9403	2186.9403	R	K	800	819
PSM	LEAPDADELPK	1769	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12194	57.098	2	1196.5925	1196.5925	R	G	524	535
PSM	LEEISPTSDSHEK	1770	sp|Q96BN6-2|F149B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=5261	26.448	2	1550.6501	1550.6501	K	D	33	46
PSM	LEESYDLEPFLR	1771	sp|P50452-3|SPB8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=21078	108.8	2	1509.7351	1509.7351	K	R	91	103
PSM	LGSEEPSKEPSSPSAQLR	1772	sp|Q8NFW9-5|MYRIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9087	43.274	2	1977.9045	1977.9045	R	D	532	550
PSM	LKFSDDEEEEEVVK	1773	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=14009	65.537	3	1774.755	1774.7550	K	D	385	399
PSM	LKSEDGVEGDLGETQSR	1774	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=6934	33.747	3	1898.8259	1898.8259	R	T	133	150
PSM	LLEEENQESLR	1775	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8996	42.848	2	1358.6678	1358.6678	R	S	883	894
PSM	LPNLSSPSAEGPPGPPSGPAPR	1776	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=15012	70.485	3	2161.0205	2161.0205	R	K	412	434
PSM	LPSSETHPEESMYK	1777	sp|Q8TBP0-3|TBC16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=5885	29.169	2	1729.6906	1729.6906	K	R	19	33
PSM	LQAANAEDIK	1778	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5269	26.482	2	1071.556	1071.5560	K	S	72	82
PSM	LQDEIQNMK	1779	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=3132	17.285	2	1133.5387	1133.5387	R	E	365	374
PSM	LQEIEGPSVSIMEK	1780	sp|Q05707-2|COEA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:35	ms_run[2]:scan=13911	65.08	2	1574.7862	1574.7862	K	T	991	1005
PSM	LQEVEVPEDFGPVR	1781	sp|O95834|EMAL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=18421	89.447	2	1612.8097	1612.8097	K	T	328	342
PSM	LRLSPSPTSQR	1782	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=7633	36.952	2	1400.6214	1400.6214	R	S	387	398
PSM	LSKSDEQLSSLDR	1783	sp|Q13905-2|RPGF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=10248	48.475	3	1556.7083	1556.7083	K	D	318	331
PSM	LTVSSLQESGLK	1784	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14075	65.862	2	1260.6925	1260.6925	R	V	2327	2339
PSM	LYDLDNDGYITR	1785	sp|P62166-2|NCS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16043	75.696	2	1456.6834	1456.6834	K	N	89	101
PSM	LYTDFDEIR	1786	sp|O00429-4|DNM1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16304	77.057	2	1170.5557	1170.5557	K	Q	100	109
PSM	MESEELADR	1787	sp|P49961-3|ENTP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=2361	13.748	2	1094.455	1094.4550	R	V	146	155
PSM	MESSFGSPSKQESSESLPK	1788	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=9570	45.366	2	2136.8922	2136.8922	K	E	471	490
PSM	MGESDDSILR	1789	sp|P63220|RS21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=6790	33.17	2	1137.4972	1137.4972	R	L	62	72
PSM	MLIEFYESPDPER	1790	sp|Q9NUQ2|PLCE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=17999	86.812	2	1640.7392	1640.7392	K	R	291	304
PSM	MPSDSDDSLTK	1791	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=1899	11.48	2	1210.5023	1210.5023	R	K	1725	1736
PSM	MSPEEVSAHDALISK	1792	sp|A6NLC5|CC070_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35,2-UNIMOD:21	ms_run[2]:scan=10467	49.416	2	1708.7379	1708.7379	R	E	157	172
PSM	NCEDMDECSIR	1793	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:4,5-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=2849	15.977	2	1443.5065	1443.5065	K	N	569	580
PSM	NFYESDDDQKEK	1794	sp|O00203-3|AP3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=4939	25.178	2	1596.5981	1596.5981	K	T	223	235
PSM	NIGENEGGIDK	1795	sp|Q04446|GLGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3888	20.626	2	1144.536	1144.5360	K	F	58	69
PSM	NLTSSSLNDISDKPEK	1796	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=11662	54.725	3	1826.8299	1826.8299	R	D	252	268
PSM	NQRPSSMVSETSTAGTASTLEAK	1797	sp|Q6IQ23|PKHA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=9179	43.684	3	2448.084	2448.0840	R	P	113	136
PSM	NSVERPAEPVAGAATPSLVEQQK	1798	sp|Q9BTC0|DIDO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=13561	63.385	3	2457.1901	2457.1901	R	M	1455	1478
PSM	NTDEMVELR	1799	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35	ms_run[2]:scan=5418	27.139	2	1121.5023	1121.5023	R	I	38	47
PSM	PSVPSADSETPLTQDRPGSPSGSEDK	1800	sp|Q96FS4|SIPA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	19-UNIMOD:21	ms_run[2]:scan=11678	54.784	3	2720.1814	2720.1814	K	G	866	892
PSM	PYQYPALTPEQK	1801	sp|P04075|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12526	58.566	2	1433.7191	1433.7191	M	K	2	14
PSM	QDAMLVDELR	1802	sp|P11678|PERE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=13388	62.549	2	1204.5758	1204.5758	R	D	532	542
PSM	QKSDAEEDGGTVSQEEEDR	1803	sp|P27824-3|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3610	19.406	3	2187.8441	2187.8441	K	K	444	463
PSM	QLEEAEEESQR	1804	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2870	16.06	2	1346.595	1346.5950	R	I	1885	1896
PSM	QQIAEDPELTHSSSNK	1805	sp|Q9ULC3|RAB23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=6715	32.793	2	1862.8048	1862.8048	K	I	175	191
PSM	RLEISPDSSPER	1806	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=8810	42.044	2	1544.6273	1544.6273	R	A	147	159
PSM	RVSGEPQQSGDGSLSPQAEAIEVAAGESAGR	1807	sp|Q96NY7-2|CLIC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=18564	90.411	3	3119.4157	3119.4157	R	S	291	322
PSM	RVSVCAETYNPDEEEEDTDPR	1808	sp|P13861-2|KAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11126	52.363	3	2590.0167	2590.0167	R	V	97	118
PSM	SASQSSLDKLDQELK	1809	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=11085	52.179	2	1727.7979	1727.7979	R	E	714	729
PSM	SASTEKLEQGTSALIR	1810	sp|Q8IWC1-2|MA7D3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=15080	70.818	3	1769.8561	1769.8561	R	Q	183	199
PSM	SDNKDDDIDIDAI	1811	sp|P55010|IF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16222	76.644	2	1447.6314	1447.6314	K	-	419	432
PSM	SDYLNTFEFMDK	1812	sp|O75874|IDHC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:35	ms_run[2]:scan=18900	92.573	2	1524.6443	1524.6443	R	L	389	401
PSM	SELSQSQHEVNEDSR	1813	sp|P23508|CRCM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=6594	32.274	2	1823.7323	1823.7323	R	S	115	130
PSM	SESPKEPEQLR	1814	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=4713	24.235	2	1378.613	1378.6130	K	K	4	15
PSM	SESQKEDPFNIAEPR	1815	sp|Q9Y2X9-2|ZN281_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=15604	73.413	2	1825.7884	1825.7884	K	V	582	597
PSM	SFHSSSSSSSSSTSSSASR	1816	sp|Q9UBY9-3|HSPB7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=680	6.1056	3	1928.7385	1928.7385	R	A	14	33
PSM	SFSASQADPLSDPDQMNEDKR	1817	sp|P01275|GLUC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=13148	61.445	3	2432.9792	2432.9792	R	H	32	53
PSM	SGAQASSTPLSPTR	1818	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4510	23.406	2	1358.679	1358.6790	R	I	12	26
PSM	SGDEEFKGEDELCDSGR	1819	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=11561	54.286	3	2008.7357	2008.7357	R	Q	339	356
PSM	SGEATDGARPQALPEPMQESK	1820	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=8524	40.816	3	2293.9886	2293.9886	K	A	142	163
PSM	SGSGEIGSETSDKK	1821	sp|A0JNW5|UH1BL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=1160	8.2059	2	1460.6032	1460.6032	K	D	987	1001
PSM	SGYLLPDTK	1822	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11111	52.299	2	992.51786	992.5179	R	A	725	734
PSM	SLDGASVNENHEIYMK	1823	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=9965	47.244	2	1901.7867	1901.7867	R	D	443	459
PSM	SLDGASVNENHEIYMK	1824	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=10375	49.02	2	1901.7867	1901.7867	R	D	443	459
PSM	SLIGVEYKPVSATGAEDK	1825	sp|P07814|SYEP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=15094	70.885	3	1942.9289	1942.9289	K	D	944	962
PSM	SLKESEALPEK	1826	sp|Q6NZI2|CAVN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=6917	33.675	2	1309.6167	1309.6167	K	E	171	182
PSM	SLLDASEEAIKK	1827	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=11256	52.932	2	1382.6694	1382.6694	K	D	721	733
PSM	SMDDIDYKPTNK	1828	sp|Q6P3S1|DEN1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21,2-UNIMOD:35	ms_run[2]:scan=4999	25.411	2	1521.6058	1521.6058	R	S	596	608
PSM	SNDFEELVER	1829	sp|Q15306-2|IRF4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16700	79.323	2	1236.5622	1236.5622	K	S	104	114
PSM	SNSDSARLPISSGSTSSSR	1830	sp|Q9Y653-5|AGRG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=7894	38.042	3	1974.8644	1974.8644	K	I	499	518
PSM	SQMEEVQDELIHR	1831	sp|Q12929|EPS8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21,3-UNIMOD:35	ms_run[2]:scan=11997	56.165	2	1708.7128	1708.7128	K	L	685	698
PSM	SSECLSQAPESHESR	1832	sp|Q9ULL8-2|SHRM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=3742	19.964	2	1782.688	1782.6880	R	T	548	563
PSM	SSGGSYRDSYDSYATHNE	1833	sp|Q14011|CIRBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=7883	37.992	3	2074.7542	2074.7542	R	-	155	173
PSM	SSGREEDDEELLR	1834	sp|O14639-3|ABLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=9473	44.94	2	1613.657	1613.6570	R	R	235	248
PSM	SSLEGPTILDIEK	1835	sp|Q7L576-2|CYFP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=18721	91.4	2	1400.7399	1400.7399	R	F	151	164
PSM	SSLYEGLEKPESR	1836	sp|P20020-6|AT2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=11642	54.644	2	1573.7025	1573.7025	R	S	1090	1103
PSM	STGKYSLATEEIER	1837	sp|Q66K14-2|TBC9B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=12438	58.179	3	1662.7502	1662.7502	K	D	542	556
PSM	SYEDDDDMDLQPNK	1838	sp|Q9BTE3-2|MCMBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=6282	30.924	2	1699.6519	1699.6519	R	Q	167	181
PSM	SYNDELQFLEK	1839	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=18699	91.26	2	1384.6511	1384.6511	R	I	4	15
PSM	TDLEMQIEGLK	1840	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35	ms_run[2]:scan=17864	85.976	2	1291.633	1291.6330	R	E	198	209
PSM	TEPHDSDCSVDLGISK	1841	sp|Q96RT1-7|ERBIN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=10820	50.971	3	1838.7394	1838.7394	R	S	836	852
PSM	TESSLSLDIHSK	1842	sp|O43166-3|SI1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=11141	52.422	2	1395.6283	1395.6283	K	S	1367	1379
PSM	TFEMSDFIVDTR	1843	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=16789	79.86	2	1475.6602	1475.6602	R	D	2017	2029
PSM	TIQEVLEEQSEDEDR	1844	sp|P18858-2|DNLI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16038	75.672	3	1818.8119	1818.8119	R	E	132	147
PSM	TPAQYDASELKASMK	1845	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=7177	34.778	3	1734.7536	1734.7536	K	G	105	120
PSM	TPAQYDASELKASMK	1846	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=7199	34.87	2	1734.7536	1734.7536	K	G	105	120
PSM	TPPGALLGAPPPLVPAPR	1847	sp|Q9HAH7|FBRS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=20886	107.21	2	1799.9699	1799.9699	K	P	428	446
PSM	TSGPLSPPTGPPGPAPAGPAVR	1848	sp|P49815-7|TSC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=15192	71.371	3	2060.0092	2060.0092	K	L	610	632
PSM	TSSKESSPIPSPTSDR	1849	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=7226	34.997	2	1754.7724	1754.7724	R	K	2159	2175
PSM	TVESITDIR	1850	sp|P11279|LAMP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11290	53.08	2	1032.5451	1032.5451	K	A	138	147
PSM	VAAGVLCELAQDK	1851	sp|P14923|PLAK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4	ms_run[2]:scan=17191	82.113	2	1372.7021	1372.7021	R	E	603	616
PSM	VASGSDLHLTDIDSDSNR	1852	sp|Q92614-3|MY18A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=13841	64.746	3	1980.8426	1980.8426	K	G	70	88
PSM	VDSLLENLEK	1853	sp|P07910-4|HNRPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17720	85.168	2	1158.6132	1158.6132	K	I	151	161
PSM	VEFMDDTSR	1854	sp|P62857|RS28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35	ms_run[2]:scan=4537	23.517	2	1114.4601	1114.4601	R	S	32	41
PSM	VEILANDQGNR	1855	sp|P17066|HSP76_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5846	28.979	2	1227.6208	1227.6208	R	T	28	39
PSM	VELQELNDR	1856	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10499	49.553	2	1114.5619	1114.5619	K	F	105	114
PSM	VILAEFDYK	1857	sp|Q9Y6N5|SQOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17658	84.826	2	1096.5805	1096.5805	R	A	388	397
PSM	VKEPSVQEATSTSDILK	1858	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=14311	67.014	3	1910.9238	1910.9238	K	V	230	247
PSM	VNVDEVGGEALGR	1859	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16120	76.111	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	1860	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17279	82.619	2	1313.6575	1313.6575	K	L	19	32
PSM	VSQDAAPGSPLDK	1861	sp|P54868-3|HMCS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5679	28.19	2	1283.6357	1283.6357	R	L	370	383
PSM	YEPAAVSEQGDKK	1862	sp|P05023-4|AT1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=2655	15.079	2	1500.6498	1500.6498	K	G	10	23
PSM	YGLQDSDEEEEEHPSK	1863	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=6439	31.591	3	1970.7419	1970.7419	K	T	866	882
PSM	YSGAYGASVSDEELKR	1864	sp|Q9NX63|MIC19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=11360	53.402	2	1810.7775	1810.7775	R	R	49	65
PSM	EILLQVEDER	1865	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=14531	68.07388166666667	2	1241.626699	1242.645582	K	K	1853	1863
PSM	ETNLDSLPLVDTHSK	1866	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:21	ms_run[1]:scan=17742	85.30749666666667	2	1748.786705	1747.802961	R	R	425	440
PSM	FNVANGGPAPDVVSDK	1867	sp|Q15124|PGM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=13087	61.145880000000005	2	1586.759855	1585.773636	K	I	136	152
PSM	AAKLSEGSQPAEEEEDQETPSR	1868	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:21	ms_run[1]:scan=7014	34.084921666666666	3	2468.038196	2467.038787	R	N	236	258
PSM	VQVAALQASPPLDQDDR	1869	sp|Q9UDY2|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=15106	70.93969166666666	3	1822.924635	1821.922091	K	A	122	139
PSM	QESDPEDDDVKKPALQSSVVATSK	1870	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=11680	54.79125833333334	3	2635.1897	2635.1897	R	E	98	122
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1871	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=5781	28.63929166666667	3	3007.3270	3007.3290	K	S	145	174
PSM	KNGSTAVAESVASPQK	1872	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	13-UNIMOD:21	ms_run[1]:scan=4321	22.552436666666665	2	1653.7582	1652.7762	R	T	1016	1032
PSM	VNVDEVGGEALGR	1873	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=19576	97.19296	2	1314.660698	1313.657543	K	L	19	32
PSM	KEESEESDDDMGFGLFD	1874	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=19925	99.706285	2	2045.715310	2044.713279	K	-	98	115
PSM	AASDTERDGLAPEKTSPDR	1875	sp|Q7L4I2|RSRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,16-UNIMOD:21	ms_run[1]:scan=6242	30.75787	3	2136.9309	2136.9319	M	D	2	21
PSM	PEDTGAEKSPTTSADLK	1876	sp|O75363|BCAS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	9-UNIMOD:21	ms_run[1]:scan=3909	20.706403333333334	3	1825.7970	1825.7977	D	S	306	323
PSM	LSKSDEQLSSLDR	1877	sp|Q13905|RPGF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:21	ms_run[1]:scan=10378	49.036028333333334	2	1556.707497	1556.708332	K	D	357	370
PSM	KSSTVATLQGTPDHGD	1878	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	2-UNIMOD:21	ms_run[1]:scan=5897	29.222690000000004	2	1692.7334	1692.7351	R	P	154	170
PSM	SPIIIHDDNSSDK	1879	sp|Q2LD37|K1109_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:21	ms_run[1]:scan=5749	28.488153333333333	2	1521.681694	1519.655569	K	D	4894	4907
PSM	ETPHSPGVEDAPIAK	1880	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:27,5-UNIMOD:21	ms_run[1]:scan=10107	47.836954999999996	2	1608.7181	1608.7180	R	V	486	501
PSM	CGSSEDLHDSVR	1881	sp|Q7Z4V5|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=7612	36.85957166666667	2	1423.5052	1423.5070	R	E	631	643
PSM	DSPSKSSAEAQTPEDTPNK	1882	sp|O43493|TGON2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:21	ms_run[1]:scan=1893	11.45348	2	2068.865179	2067.863389	K	S	65	84
PSM	TGRDTPENGETAIGAENSEK	1883	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:21	ms_run[1]:scan=5549	27.671425	2	2155.890012	2154.906651	K	I	475	495
PSM	TGRDTPENGETAIGAENSEK	1884	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:21	ms_run[1]:scan=5495	27.447221666666668	3	2155.890031	2154.906651	K	I	475	495
PSM	DEGNYLDDALVR	1885	sp|P09525|ANXA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=17539	84.12558666666666	2	1379.643291	1378.636474	R	Q	161	173
PSM	VNVDAVGGEALGR	1886	sp|P02042|HBD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=12521	58.54284333333334	2	1255.651691	1255.652064	K	L	19	32
PSM	VNSNSLDLPSSSDTTHASK	1887	sp|Q8NEY1|NAV1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=9678	45.849293333333335	3	2039.867596	2038.884459	K	V	804	823
PSM	TVVQLEGDNK	1888	sp|P07148|FABPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5796	28.713881666666666	2	1101.559503	1101.566603	K	L	81	91
PSM	LLLSEEEIEK	1889	sp|Q9HAB8|PPCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=14956	70.18496333333333	2	1201.653709	1201.644185	K	G	278	288
PSM	QKSDHGAYSQSPAIK	1890	sp|Q9Y4B6|DCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=4998	25.408065	3	1678.7355	1678.7347	R	K	977	992
PSM	EIDDSVLGQTGPYR	1891	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=15250	71.63745833333334	2	1548.741754	1548.742001	K	R	189	203
PSM	GTRDDEYDYLFK	1892	sp|P62491|RB11A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=18693	91.22308666666667	2	1562.6878	1562.6884	M	V	2	14
PSM	IQFENNEDQDVNPLK	1893	sp|O95163|ELP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=15483	72.82246666666666	2	1801.849713	1801.848257	K	L	488	503
PSM	GPPSPGPAAQPPAPPR	1894	sp|Q9NZV5|SELN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:21	ms_run[1]:scan=8359	40.063181666666665	2	1573.746882	1572.744993	R	R	10	26
PSM	GTSPRPPEGGLGYSQLGDDDLK	1895	sp|Q9UQ88|CD11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=16166	76.36153333333334	3	2338.044604	2338.047836	R	E	738	760
PSM	YGLQDSDEEEEEHPSK	1896	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:21	ms_run[1]:scan=7557	36.60685833333333	2	1971.729218	1970.741877	K	T	883	899
PSM	YGLQDSDEEEEEHPSK	1897	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:21	ms_run[1]:scan=7588	36.749401666666664	2	1971.729218	1970.741877	K	T	883	899
PSM	CDSSPDSAEDVRK	1898	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=2539	14.521476666666667	2	1544.587866	1544.581418	K	V	132	145
PSM	CDSSPDSAEDVRK	1899	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=2043	12.212478333333333	2	1543.548674	1544.581418	K	V	132	145
PSM	CDSSPDSAEDVRK	1900	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:21	ms_run[1]:scan=4258	22.266571666666668	2	1527.5535	1527.5543	K	V	132	145
PSM	QIITDKDDLVK	1901	sp|Q8NEZ2|VP37A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=14886	69.835555	2	1269.6810	1269.6811	K	S	264	275
PSM	EIQNGNLHESDSESVPR	1902	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:21	ms_run[1]:scan=10057	47.63624166666667	2	1990.815264	1989.842928	K	D	66	83
PSM	EIQNGNLHESDSESVPR	1903	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:21	ms_run[1]:scan=8082	38.850273333333334	2	1991.828080	1989.842928	K	D	66	83
PSM	EIQNGNLHESDSESVPR	1904	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:27,10-UNIMOD:21	ms_run[1]:scan=9629	45.621453333333335	2	1972.8152	1971.8322	K	D	66	83
PSM	DLAEITTLDR	1905	sp|Q9BS26|ERP44_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=16468	78.08557833333333	2	1146.596230	1145.592818	R	S	149	159
PSM	NHSDSSTSESEVSSVSPLK	1906	sp|Q9NY27|PP4R2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	16-UNIMOD:21	ms_run[1]:scan=9185	43.71580833333333	2	2056.847759	2055.863389	K	N	211	230
PSM	QESEGSDLLENHIK	1907	sp|Q709C8|VP13C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=16726	79.46656	2	1660.6957	1660.6976	R	K	3612	3626
PSM	ADKPDMGEIASFDK	1908	sp|P63313|TYB10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,6-UNIMOD:35	ms_run[1]:scan=12191	57.08226666666666	2	1580.7030	1580.7023	M	A	2	16
PSM	DNDLISLPK	1909	sp|Q15404|RSU1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=15861	74.73874166666667	2	1013.541299	1013.539326	R	E	166	175
PSM	LAEAQIEELR	1910	sp|Q9NR28|DBLOH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=13366	62.440041666666666	2	1170.624421	1170.624452	K	Q	208	218
PSM	ENDPLRTPEALPEEK	1911	sp|O60293|ZC3H1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:21	ms_run[1]:scan=12563	58.72373	2	1816.806571	1816.824425	K	K	760	775
PSM	EDNGIGILTLNNPSR	1912	sp|Q9NTX5|ECHD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=18975	93.03705666666667	2	1612.805008	1611.821649	K	M	60	75
PSM	QLTQPETHFGR	1913	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=14110	66.038375	2	1375.5940	1375.5917	K	E	289	300
PSM	SKILLSSSGCSADIDSGK	1914	sp|Q6P9F7|LRC8B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:21,10-UNIMOD:4	ms_run[1]:scan=11199	52.663781666666665	3	1903.858785	1903.859824	K	Q	186	204
PSM	KGSMISVMSSEGNADTPVSK	1915	sp|P21359|NF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21,4-UNIMOD:35,8-UNIMOD:35	ms_run[1]:scan=7091	34.424323333333334	3	2135.911209	2135.911602	R	F	874	894
PSM	DAGLSFKDDMPK	1916	sp|Q9NW64|RBM22_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=10293	48.651336666666666	2	1418.580234	1418.578898	R	S	98	110
PSM	ILSANGEAK	1917	sp|P20020|AT2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5500	27.469771666666666	2	901.475974	901.486896	K	V	614	623
PSM	IEVLEEELR	1918	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=16303	77.05397666666667	2	1130.617773	1128.602654	K	L	1034	1043
PSM	AQGEPVAGHESPK	1919	sp|O94979|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:21	ms_run[1]:scan=1408	9.286439999999999	2	1385.597246	1385.597660	R	I	789	802
PSM	TGRDTPENGETAIGAENSEK	1920	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:21	ms_run[1]:scan=5162	26.049763333333335	3	2154.905343	2154.906651	K	I	475	495
PSM	SSEPVQHEESIR	1921	sp|Q9UDY2|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:21	ms_run[1]:scan=3719	19.858193333333332	2	1476.623121	1476.624603	R	K	952	964
PSM	KGSSTDISEDWEK	1922	sp|Q9NW68|BSDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=10416	49.19938833333334	2	1562.654730	1560.634499	K	D	385	398
PSM	ASSHSSQTQGGGSVTK	1923	sp|P02545|LMNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:21	ms_run[1]:scan=524	5.237475	2	1598.656374	1597.673344	R	K	402	418
PSM	VKEEPPSPPQSPR	1924	sp|Q00613|HSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=5010	25.45239666666667	2	1606.678599	1606.679355	R	V	297	310
PSM	VMEGKGQSPFDPAHK	1925	sp|Q9H3S1|SEM4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=977	7.450431666666667	2	1723.718026	1722.743672	K	H	169	184
PSM	NEDISVSKLGSDAQVK	1926	sp|Q8TF40|FNIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:21	ms_run[1]:scan=11168	52.53530666666666	2	1768.798981	1768.824425	R	V	67	83
PSM	YYETVSDVLNSVKK	1927	sp|Q14746|COG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=6985	33.961016666666666	2	1804.740748	1803.773315	K	M	646	660
PSM	ATSEEDVSIKSPICEK	1928	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=10071	47.69291666666667	2	1871.798924	1871.822376	K	Q	1606	1622
PSM	NKTSTTSSMVASAEQPR	1929	sp|Q6NXS1|IPP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:21,9-UNIMOD:35	ms_run[1]:scan=3162	17.4046	2	1888.818864	1889.819022	K	R	17	34
PSM	EIQNGNLHESDSESVPR	1930	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:21	ms_run[1]:scan=8830	42.124990000000004	2	1990.824914	1989.842928	K	D	66	83
PSM	PSEEAPKCSQDQGVLASELAQNK	1931	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4,9-UNIMOD:21	ms_run[1]:scan=14357	67.20917333333333	3	2566.144820	2565.141813	K	E	120	143
PSM	AAVEELLER	1932	sp|Q15814|TBCC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14815	69.493	2	1028.5502	1028.5502	R	A	69	78
PSM	ADLDVSGPK	1933	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5037	25.56	2	900.45526	900.4553	K	V	3049	3058
PSM	AEDGATPSPSNETPKK	1934	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=1676	10.519	2	1707.7353	1707.7353	K	K	138	154
PSM	AEDKPSTDLSAPVNGEATSQK	1935	sp|Q7Z4V5|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	19-UNIMOD:21	ms_run[2]:scan=8166	39.203	3	2223.9897	2223.9897	K	G	590	611
PSM	AEEEHLSSSGGLAK	1936	sp|Q52LW3-2|RHG29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=5373	26.947	2	1493.6399	1493.6399	R	N	349	363
PSM	AEGPDVAVDLPK	1937	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14018	65.579	2	1209.6241	1209.6241	K	G	3489	3501
PSM	AGDRNSEDDGVVMTFSSVK	1938	sp|Q9NY61|AATF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=14612	68.476	3	2108.8722	2108.8722	R	V	198	217
PSM	AGSSASSPPSASSSPHPSAAVPAADPADSASGSSNK	1939	sp|Q8NDF8-4|PAPD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=9188	43.731	3	3273.4059	3273.4059	R	R	43	79
PSM	AGTQIENIEEDFR	1940	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=18668	91.064	2	1520.7107	1520.7107	K	D	48	61
PSM	AIISSSDDSSDEDKLK	1941	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=9173	43.659	2	1788.7666	1788.7666	K	I	1012	1028
PSM	AILILDNDGDR	1942	sp|P61923-5|COPZ1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15277	71.767	2	1213.6303	1213.6303	K	L	15	26
PSM	AILVDLEPGTMDSVR	1943	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=17839	85.859	2	1630.8236	1630.8236	R	S	63	78
PSM	AKTQTPPVSPAPQPTEER	1944	sp|Q14247-2|SRC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=5241	26.364	2	2092.9232	2092.9232	R	L	360	378
PSM	ALEELQEALAEK	1945	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=18261	88.448	2	1342.698	1342.6980	R	E	141	153
PSM	APPGLTPAPASPPVLPR	1946	sp|C9J069|AJM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=16764	79.71	2	1716.8964	1716.8964	R	R	99	116
PSM	AQGEPVAGHESPK	1947	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=938	7.2777	2	1385.5977	1385.5977	R	I	522	535
PSM	AQSPGAVEEILDR	1948	sp|Q9NYM9|BET1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=16823	80.041	2	1383.6994	1383.6994	R	E	7	20
PSM	ASPDQNASTHTPQSSVK	1949	sp|Q14677-2|EPN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=1185	8.3089	2	1833.7894	1833.7894	K	T	280	297
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	1950	sp|Q8NDT2|RB15B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14593	68.383	3	2789.2772	2789.2772	R	T	112	140
PSM	ASSPQGFDVDR	1951	sp|P27216-2|ANX13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7405	35.839	2	1177.5364	1177.5364	K	D	49	60
PSM	ATGSAGLLGDPECEGSPPEHSPEQGR	1952	sp|Q5TH69|BIG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=12257	57.358	3	2714.128	2714.1280	K	S	1046	1072
PSM	AVDCLLDSK	1953	sp|Q99442|SEC62_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:4	ms_run[2]:scan=9821	46.581	2	1019.4957	1019.4957	K	W	52	61
PSM	AVEEPLNAFKESK	1954	sp|Q08722|CD47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=13698	64.091	2	1540.7174	1540.7174	K	G	305	318
PSM	AVVVSPKEENK	1955	sp|O75909-1|CCNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=2930	16.352	2	1278.6221	1278.6221	R	A	336	347
PSM	CDEGYESGFMMMK	1956	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,10-UNIMOD:35,11-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=7851	37.866	2	1631.5612	1631.5612	K	N	1097	1110
PSM	CECEIGYELDR	1957	sp|P35555|FBN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,3-UNIMOD:4	ms_run[2]:scan=13016	60.821	2	1442.5806	1442.5806	R	S	1470	1481
PSM	CELCDDGYFGDPLGR	1958	sp|P11047|LAMC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=19211	94.596	2	1772.7134	1772.7134	R	N	804	819
PSM	CMVEVPQELETSTGHSLEK	1959	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,2-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=15334	72.058	3	2268.9644	2268.9644	K	E	400	419
PSM	CPEILSDESSSDEDEKK	1960	sp|P35659-2|DEK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=7648	37.013	3	2046.7977	2046.7977	K	N	188	205
PSM	CPTGYYLNEDTR	1961	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4	ms_run[2]:scan=10529	49.679	2	1487.6351	1487.6351	R	V	1633	1645
PSM	DFYNPVVPEAQK	1962	sp|O15551|CLD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15281	71.781	2	1405.6878	1405.6878	R	R	145	157
PSM	DGSNKSGAEEQGPIDGPSK	1963	sp|O43493-4|TGON2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=3407	18.529	3	1951.816	1951.8160	K	S	219	238
PSM	DHTPSQELALTQSVGGDSSADR	1964	sp|Q86U44-2|MTA70_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=14363	67.241	3	2350.0074	2350.0074	K	L	62	84
PSM	DLDTHQVSDDLSETDISNEAR	1965	sp|Q8NFW9-5|MYRIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=15444	72.625	3	2439.0075	2439.0075	R	D	550	571
PSM	DLSELGSVR	1966	sp|Q15149-6|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12316	57.617	2	974.50327	974.5033	K	T	3344	3353
PSM	DMDDEESWIK	1967	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35	ms_run[2]:scan=12425	58.116	2	1282.5023	1282.5023	R	E	1752	1762
PSM	DQLLLGPTYATPK	1968	sp|P55084-2|ECHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=16635	78.98	2	1415.766	1415.7660	K	V	327	340
PSM	DSHSSEEDEASSQTDLSQTISK	1969	sp|Q5JTV8-2|TOIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=9502	45.063	3	2459.9813	2459.9813	R	K	153	175
PSM	DTFEHDPSESIDEFNK	1970	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=14295	66.938	2	1988.7677	1988.7677	K	S	187	203
PSM	DVDDATLSR	1971	sp|P41219|PERI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4334	22.61	2	990.4618	990.4618	K	L	203	212
PSM	DVLLQVDDER	1972	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13574	63.449	2	1200.5986	1200.5986	K	R	1846	1856
PSM	DVSHSSPVDLK	1973	sp|Q96JN0-2|LCOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=5168	26.076	2	1262.5544	1262.5544	K	I	244	255
PSM	DYDSLAQPGFFDR	1974	sp|P12110|CO6A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=19498	96.636	2	1529.6787	1529.6787	K	F	1001	1014
PSM	EDALDDSVSSSSVHASPLASSPVR	1975	sp|Q7Z3J3|RGPD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=16005	75.5	3	2492.1068	2492.1068	R	K	1256	1280
PSM	EEAENTLQSFR	1976	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11809	55.358	2	1322.6103	1322.6103	R	Q	197	208
PSM	EEEEDSFSGDFK	1977	sp|Q8N8V4|ANS4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11922	55.85	2	1417.5521	1417.5521	R	E	236	248
PSM	EEETSIDVAGKPNEVTK	1978	sp|P53985|MOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=8962	42.695	2	1924.8667	1924.8667	K	A	463	480
PSM	EEGGPGPVSTPDNR	1979	sp|O75150-3|BRE1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3789	20.202	2	1410.6375	1410.6375	K	K	548	562
PSM	EFCENLSADCR	1980	sp|P30153|2AAA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=9721	46.085	2	1399.5496	1399.5496	K	E	308	319
PSM	EGEEPTKGNSGSEACTSSFLR	1981	sp|Q9H2Y7-2|ZN106_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11670	54.75	3	2321.9471	2321.9471	K	L	521	542
PSM	EILGTAQSVGCNVDGR	1982	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:4	ms_run[2]:scan=12541	58.631	2	1674.7995	1674.7995	K	H	98	114
PSM	EILLQVEDER	1983	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15278	71.771	2	1242.6456	1242.6456	K	K	1853	1863
PSM	EILLSNSDPHDIPESK	1984	sp|Q99996-5|AKAP9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=13787	64.504	2	1872.8506	1872.8506	K	D	1539	1555
PSM	ELDALDANDELTPLGR	1985	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=19360	95.653	2	1740.853	1740.8530	R	I	838	854
PSM	ELSSYEDFLDAR	1986	sp|Q9UIQ6-3|LCAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=19659	97.744	2	1443.6518	1443.6518	K	F	485	497
PSM	EQLTQELQEAR	1987	sp|Q4V328-3|GRAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12426	58.12	2	1343.6681	1343.6681	K	K	303	314
PSM	ETGTEHSPGVQPADVK	1988	sp|Q9H7C9-3|AAMDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=4021	21.202	2	1730.7513	1730.7513	R	E	40	56
PSM	ETGYVVERPSTTK	1989	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=6235	30.727	2	1545.7076	1545.7076	K	D	461	474
PSM	ETNLDSLPLVDTHSK	1990	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=16242	76.743	2	1747.803	1747.8030	R	R	425	440
PSM	ETPHSPGVEDAPIAK	1991	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=7967	38.364	2	1626.7291	1626.7291	R	V	184	199
PSM	ETPHSPGVEDAPIAK	1992	sp|Q9UHB6-3|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=10508	49.589	3	1626.7291	1626.7291	R	V	184	199
PSM	EVLDEDTDEEKETLK	1993	sp|Q9Y3P9|RBGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=10239	48.433	2	1871.7925	1871.7925	K	N	990	1005
PSM	EVQGNESEAFR	1994	sp|P09327|VILI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5074	25.698	2	1264.5684	1264.5684	R	G	98	109
PSM	EYPDAQGFAADVR	1995	sp|Q15059-2|BRD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14957	70.188	2	1437.6525	1437.6525	R	L	369	382
PSM	FDAIYETEMSK	1996	sp|O43704|ST1B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:35	ms_run[2]:scan=11340	53.314	2	1348.5857	1348.5857	K	T	277	288
PSM	FDQLLAEEK	1997	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11566	54.304	2	1091.5499	1091.5499	K	A	1470	1479
PSM	FEETTADGR	1998	sp|Q01469|FABP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1861	11.311	2	1024.4462	1024.4462	K	K	73	82
PSM	FFEEVNDPAK	1999	sp|P49748-3|ACADV_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11750	55.098	2	1194.5557	1194.5557	R	N	135	145
PSM	FLNRSPEESFDIK	2000	sp|Q96S38-2|KS6C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=16937	80.654	2	1740.7161	1740.7161	K	E	407	420
PSM	FTEEEEQLSR	2001	sp|O00748-2|EST2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7434	35.999	2	1266.5728	1266.5728	K	K	460	470
PSM	GDQPAASGDSDDDEPPPLPR	2002	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10542	49.735	3	2034.8767	2034.8767	R	L	48	68
PSM	GDSLKEPTSIAESSR	2003	sp|Q9C0B5-2|ZDHC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=9891	46.898	2	1655.7404	1655.7404	R	H	325	340
PSM	GEGPDVDVTLPK	2004	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13975	65.377	2	1225.619	1225.6190	K	A	4331	4343
PSM	GEGPEVDVNLPK	2005	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13407	62.642	2	1252.6299	1252.6299	K	A	1141	1153
PSM	GFYIYQEGVK	2006	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15569	73.25	2	1202.5972	1202.5972	K	R	635	645
PSM	GGPVQVLEDEELK	2007	sp|Q13228-2|SBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=17804	85.681	2	1411.7195	1411.7195	K	S	294	307
PSM	GGVTGSPEASISGSKGDLK	2008	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=9835	46.641	2	1825.8459	1825.8459	K	S	5726	5745
PSM	GLDCDIDIQK	2009	sp|P29350-2|PTN6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:4	ms_run[2]:scan=11414	53.638	2	1175.5492	1175.5492	K	T	438	448
PSM	GLGPPSPPAPPR	2010	sp|Q13425-2|SNTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=11789	55.264	2	1221.5907	1221.5907	R	G	90	102
PSM	GNAEGSSDEEGKLVIDEPAK	2011	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=11538	54.196	3	2123.926	2123.9260	K	E	120	140
PSM	GNISTSSKPASTSGK	2012	sp|O75592-2|MYCB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=842	6.8694	2	1500.6821	1500.6821	R	S	2717	2732
PSM	GNSRPGTPSAEGGSTSSTLR	2013	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=4912	25.066	2	1997.8804	1997.8804	R	A	383	403
PSM	GSQDSSENDLVRSPK	2014	sp|O15195-2|VILL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=4239	22.171	2	1697.7258	1697.7258	K	S	747	762
PSM	GYSFTTTAER	2015	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9066	43.163	2	1131.5197	1131.5197	R	E	197	207
PSM	HSSQTSEESAIETGSSSSTFIK	2016	sp|P16234|PGFRA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=14324	67.071	3	2379.0115	2379.0115	R	R	1040	1062
PSM	IATITTTHTPSQQGTQETR	2017	sp|Q96QZ7-4|MAGI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=6614	32.366	3	2150.0005	2150.0005	K	N	1012	1031
PSM	IDATSASVLASR	2018	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11035	51.945	2	1189.6303	1189.6303	K	F	120	132
PSM	IDEPLEGSEDR	2019	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7250	35.104	2	1258.5677	1258.5677	K	I	399	410
PSM	IEDVTPIPSDSTRR	2020	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=9866	46.78	2	1664.7771	1664.7771	R	K	129	143
PSM	IEGEMQVPDVDIR	2021	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:35	ms_run[2]:scan=13447	62.846	2	1515.7239	1515.7239	K	G	1092	1105
PSM	ILGADTSVDLEETGR	2022	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15246	71.619	2	1574.7788	1574.7788	R	V	59	74
PSM	ILQEGVDPK	2023	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5255	26.422	2	997.54441	997.5444	R	K	561	570
PSM	INPTESTSKAEENEK	2024	sp|Q8NHP6-2|MSPD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=2519	14.428	2	1755.7564	1755.7564	K	V	231	246
PSM	ISTVELEDFK	2025	sp|Q9BXN1|ASPN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=16720	79.43	2	1179.6023	1179.6023	K	R	253	263
PSM	ISVYYNEATGGK	2026	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10290	48.641	2	1300.6299	1300.6299	R	Y	47	59
PSM	ITLDNAYMEK	2027	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:35	ms_run[2]:scan=10070	47.689	2	1212.5696	1212.5696	K	C	127	137
PSM	KAASPSPQSVR	2028	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=1097	7.9494	2	1286.5421	1286.5421	K	R	733	744
PSM	KAGSDGDIMDSSTEAPPISIK	2029	sp|Q6F5E8|CARL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=13390	62.561	3	2213.9763	2213.9763	K	S	1243	1264
PSM	KASPEPEGEAAGK	2030	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=728	6.3428	2	1349.5864	1349.5864	R	M	382	395
PSM	KCSLPAEEDSVLEK	2031	sp|P27816-6|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=12452	58.241	3	1683.7427	1683.7427	K	L	634	648
PSM	KDSIPQVLLPEEEK	2032	sp|Q15052-2|ARHG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=17633	84.679	3	1703.8383	1703.8383	R	L	528	542
PSM	KDSISEDEMVLR	2033	sp|Q8N5D0-5|WDTC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=10609	50.047	3	1516.648	1516.6480	R	E	508	520
PSM	KGSISSTQDTPVAVEEDCSLASSK	2034	sp|Q9BZ71-3|PITM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=13835	64.72	3	2575.1361	2575.1361	R	R	257	281
PSM	KSEDGTPAEDGTPAATGGSQPPSMGR	2035	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21,24-UNIMOD:35	ms_run[2]:scan=4671	24.047	3	2596.0749	2596.0749	R	K	1185	1211
PSM	KSGSQDFPQCNTIENTGTK	2036	sp|P28290-2|ITPI2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=9862	46.761	2	2190.9253	2190.9253	R	Q	437	456
PSM	KSSPSTGSLDSGNESK	2037	sp|Q15057|ACAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1106	7.9867	2	1659.6989	1659.6989	K	E	377	393
PSM	KTSEGIIPTDSDNEK	2038	sp|Q70Z35-2|PREX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=7429	35.976	2	1712.7506	1712.7506	R	G	1065	1080
PSM	KTSLVIVESADNQPETCER	2039	sp|Q01484|ANK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=12614	58.951	3	2255.0141	2255.0141	R	L	3843	3862
PSM	KTSTDFSEVIK	2040	sp|Q01484|ANK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12161	56.96	2	1333.6167	1333.6167	R	Q	2131	2142
PSM	KVTSPLQSPTK	2041	sp|Q6IQ23|PKHA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4663	24.01	2	1344.6091	1344.6091	R	A	900	911
PSM	LASGEDDPFDSDFSCPVK	2042	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:4	ms_run[2]:scan=18475	89.825	2	1984.836	1984.8360	K	L	377	395
PSM	LDEFGEQLSK	2043	sp|P16615-5|AT2A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12216	57.183	2	1164.5663	1164.5663	K	V	253	263
PSM	LDNTPASPPRSPAEPNDIPIAK	2044	sp|O95359-6|TACC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=14100	65.992	3	2459.1135	2459.1135	K	G	389	411
PSM	LDTDDLDEIEK	2045	sp|Q9UMR2-3|DD19B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14283	66.88	2	1304.5984	1304.5984	R	I	357	368
PSM	LEAQLVDLK	2046	sp|Q9HD26-2|GOPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14727	69.058	2	1027.5914	1027.5914	K	S	94	103
PSM	LEEKSEDQDLQGLK	2047	sp|P51608-2|MECP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=9924	47.048	3	1710.7713	1710.7713	R	D	21	35
PSM	LEGGSGGDSEVQR	2048	sp|P62195-2|PRS8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1424	9.354	2	1289.5848	1289.5848	R	T	251	264
PSM	LEKSIDDLEEK	2049	sp|P09493-8|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=9979	47.3	3	1397.6327	1397.6327	K	V	249	260
PSM	LESYRPDTDLSR	2050	sp|Q8ND76-2|CCNY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10296	48.666	2	1530.6716	1530.6716	R	E	23	35
PSM	LFDEEEDSSEKLFDDSDER	2051	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=17218	82.274	3	2383.9217	2383.9217	K	G	706	725
PSM	LFDEEEDSSEKLFDDSDER	2052	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=18131	87.642	3	2383.9217	2383.9217	K	G	706	725
PSM	LFEESDDKEDEDADGK	2053	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=7427	35.966	3	1920.715	1920.7150	K	E	672	688
PSM	LGAGEGGEASVSPEKTSTTSK	2054	sp|Q13428-6|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=5228	26.314	2	2071.9311	2071.9311	K	G	1329	1350
PSM	LIDDMVAQVLK	2055	sp|P48735|IDHP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:35	ms_run[2]:scan=17372	83.208	2	1259.6795	1259.6795	R	S	289	300
PSM	LNAGQIPLDEDDPR	2056	sp|Q96Q15-4|SMG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13792	64.526	2	1551.7529	1551.7529	K	L	488	502
PSM	LPLLPPESPGPLR	2057	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=20180	101.6	2	1464.7742	1464.7742	R	Q	765	778
PSM	LPSSPVYEDAASFK	2058	sp|Q14247-2|SRC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=16978	80.876	2	1589.7015	1589.7015	R	A	378	392
PSM	LQPTPPIPAPAPK	2059	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=12722	59.464	2	1405.7371	1405.7371	R	P	254	267
PSM	LSEDYGVLK	2060	sp|P32119|PRDX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11374	53.46	2	1022.5284	1022.5284	R	T	111	120
PSM	LSKSNIDISSGLEDEEPK	2061	sp|Q9BZ71-3|PITM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=15564	73.227	3	2039.93	2039.9300	R	R	282	300
PSM	LSSASTGKPPLSVEDDFEK	2062	sp|A0A1B0GTU1|ZC11B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=16205	76.561	2	2085.9507	2085.9507	R	L	758	777
PSM	LVVNFESDK	2063	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12584	58.811	2	1049.5393	1049.5393	K	L	664	673
PSM	LYGSAGPPPTGEEDTAEKDEL	2064	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14169	66.316	3	2174.9855	2174.9855	K	-	634	655
PSM	LYTLVLTDPDAPSR	2065	sp|P30086|PEBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=18752	91.602	2	1559.8195	1559.8195	K	K	63	77
PSM	MKSVGDDEELQQNESGTSPK	2066	sp|P15822|ZEP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=5593	27.854	3	2273.9359	2273.9359	K	S	1034	1054
PSM	MSAEINEIIR	2067	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35	ms_run[2]:scan=13246	61.892	2	1190.5965	1190.5965	K	V	237	247
PSM	NAFLESELDEK	2068	sp|Q9GZM8-3|NDEL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15558	73.2	2	1293.6089	1293.6089	R	E	150	161
PSM	NCLALADDK	2069	sp|O75367-2|H2AY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=6862	33.45	2	1018.4753	1018.4753	K	K	293	302
PSM	NFEDVAFDEK	2070	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14904	69.919	2	1212.5299	1212.5299	K	K	376	386
PSM	NIDVFNVEDQK	2071	sp|Q8NBJ4-2|GOLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=16263	76.856	2	1319.6357	1319.6357	R	R	364	375
PSM	NKSPAAVTEPETNK	2072	sp|O75449|KTNA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2149	12.698	2	1564.7134	1564.7134	K	F	168	182
PSM	NLDDGIDDER	2073	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6884	33.538	2	1160.4946	1160.4946	K	L	300	310
PSM	NLDVQLLDTK	2074	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=16896	80.43	2	1157.6292	1157.6292	R	R	868	878
PSM	NLTSSSLNDISDKPEK	2075	sp|Q9Y6R1-4|S4A4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=10355	48.93	3	1826.8299	1826.8299	R	D	252	268
PSM	NPLPSKETIEQEK	2076	sp|P62328|TYB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=9365	44.481	2	1591.7495	1591.7495	K	Q	27	40
PSM	NSSSPVAATPASVNTTPDKPK	2077	sp|Q14469|HES1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=6815	33.271	2	2148.01	2148.0100	K	T	9	30
PSM	NSTVLLSMTHEDQK	2078	sp|Q12774|ARHG5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=7659	37.056	2	1697.7332	1697.7332	R	L	1161	1175
PSM	NTPSPFIETFTEDDEASR	2079	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=19829	98.979	2	2054.9069	2054.9069	K	A	212	230
PSM	NTSPQGVHNDVSK	2080	sp|P48552|NRIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1325	8.8927	2	1461.6249	1461.6249	K	F	516	529
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	2081	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=5075	25.701	3	3336.3553	3336.3553	R	R	157	186
PSM	PALPAGTEDTAK	2082	sp|P06396-2|GELS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5143	25.966	2	1169.5928	1169.5928	K	E	227	239
PSM	PGSPEPETEPVSSVQENHENER	2083	sp|Q13625-2|ASPP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=7789	37.615	3	2527.05	2527.0500	K	I	548	570
PSM	QGFGNVATNTDGK	2084	sp|P02675|FIBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5813	28.805	2	1307.6106	1307.6106	K	N	301	314
PSM	QLEYQQLEDDKLSQK	2085	sp|Q9Y2J2-2|E41L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=13587	63.511	2	1943.8878	1943.8878	K	S	76	91
PSM	QPITSHLSSDTTTSGTSDLK	2086	sp|O75167-5|PHAR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=10827	51.001	3	2154.9682	2154.9682	K	G	193	213
PSM	QQPLFVSGGDDYK	2087	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13155	61.477	2	1452.6885	1452.6885	K	I	62	75
PSM	QVATALQNLQTK	2088	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11415	53.642	2	1313.7303	1313.7303	K	T	465	477
PSM	SAEEEAADLPTKPTK	2089	sp|Q8WW12-2|PCNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=7314	35.39	2	1665.7499	1665.7499	R	I	53	68
PSM	SDIDEIVLVGGSTR	2090	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=18266	88.475	2	1459.7518	1459.7518	K	I	354	368
PSM	SEFEQNLSEK	2091	sp|Q16891-3|MIC60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7348	35.525	2	1209.5513	1209.5513	K	L	475	485
PSM	SEPVKEESSELEQPFAQDTSSVGPDR	2092	sp|Q14151|SAFB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	21-UNIMOD:21	ms_run[2]:scan=15919	75.048	3	2927.271	2927.2710	K	K	226	252
PSM	SESPKEPEQLR	2093	sp|P09651-3|ROA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=4958	25.256	2	1378.613	1378.6130	K	K	4	15
PSM	SGEGEVSGLMR	2094	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:35	ms_run[2]:scan=5005	25.433	2	1136.5132	1136.5132	R	K	391	402
PSM	SGYEFADDR	2095	sp|Q14112-2|NID2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7715	37.292	2	1058.4305	1058.4305	R	H	778	787
PSM	SHSDPGITTSSDTADFR	2096	sp|P81408-2|F189B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10345	48.884	2	1872.7527	1872.7527	R	D	395	412
PSM	SISSPSVSSETMDKPVDLSTR	2097	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=12898	60.314	3	2318.0349	2318.0349	K	K	2802	2823
PSM	SKSPLPPEEEAK	2098	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2913	16.258	2	1390.6381	1390.6381	R	D	226	238
PSM	SKTPTGPELDTSYK	2099	sp|Q8NF91-4|SYNE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=8661	41.38	3	1602.7178	1602.7178	R	G	8310	8324
PSM	SLAEEQYQDFEAR	2100	sp|O75110-2|ATP9A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14287	66.9	2	1584.7056	1584.7056	K	Y	484	497
PSM	SLDDEVNAFK	2101	sp|Q14141-2|SEPT6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14907	69.928	2	1136.535	1136.5350	K	Q	388	398
PSM	SLEDQVEMLR	2102	sp|P14314-2|GLU2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:35	ms_run[2]:scan=15578	73.287	2	1234.5864	1234.5864	K	T	168	178
PSM	SLEEDQEPIVSHQK	2103	sp|Q14241|ELOA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=7932	38.206	2	1717.756	1717.7560	R	P	222	236
PSM	SLKEESVEAVK	2104	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=7184	34.806	2	1297.6167	1297.6167	K	S	809	820
PSM	SLKSLEPEDEVEDDPK	2105	sp|Q13207|TBX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=13700	64.099	2	1908.8241	1908.8241	R	V	91	107
PSM	SLLDASEEAIKK	2106	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=13943	65.225	2	1382.6694	1382.6694	K	D	721	733
PSM	SLSSSLDDTEVKK	2107	sp|O95292|VAPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=9391	44.583	2	1487.6756	1487.6756	K	V	156	169
PSM	SLSVEHLETK	2108	sp|P26045-2|PTN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=9578	45.398	2	1221.5642	1221.5642	R	S	226	236
PSM	SLVTEAENSQHQQK	2109	sp|P11171-7|41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=6793	33.181	2	1677.7359	1677.7359	K	E	6	20
PSM	SLYHDISGDTSGDYR	2110	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=13399	62.604	2	1764.6992	1764.6992	K	K	447	462
PSM	SMDKSDEELQFPK	2111	sp|Q08AE8-3|SPIR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21,2-UNIMOD:35	ms_run[2]:scan=12468	58.303	2	1648.6692	1648.6692	K	E	505	518
PSM	SPEHPVDDIDK	2112	sp|Q14667-3|K0100_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=5196	26.191	2	1330.5442	1330.5442	K	M	248	259
PSM	SPELQAEAK	2113	sp|P02652|APOA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2602	14.83	2	971.49238	971.4924	K	S	54	63
PSM	SPSKPLPEVTDEYK	2114	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12346	57.742	2	1668.7648	1668.7648	R	N	92	106
PSM	SPTSDDISLLHESQSDR	2115	sp|Q9Y3C5|RNF11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=13604	63.6	3	1965.8317	1965.8317	K	A	7	24
PSM	SRTSVQTEDDQLIAGQSAR	2116	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10841	51.054	3	2140.975	2140.9750	R	A	282	301
PSM	SRTSVQTEDDQLIAGQSAR	2117	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,4-UNIMOD:21	ms_run[2]:scan=10861	51.136	3	2220.9413	2220.9413	R	A	282	301
PSM	SSKEEAEMAYK	2118	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=1259	8.6185	3	1367.5316	1367.5316	R	D	734	745
PSM	SSKTDLQGSASPSK	2119	sp|Q6VY07|PACS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=1233	8.5078	2	1471.6556	1471.6556	K	V	485	499
PSM	SSPPAPPLPPGSGSPGTPQALPR	2120	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=15715	73.993	3	2244.094	2244.0940	R	R	585	608
PSM	SSSVTSIDKESR	2121	sp|Q5T5C0-2|STXB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=3324	18.138	2	1374.6028	1374.6028	R	E	744	756
PSM	STIGVMVTASHNPEEDNGVK	2122	sp|O95394|AGM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=10990	51.718	2	2179.9457	2179.9457	K	L	55	75
PSM	STPSHGSVSSLNSTGSLSPK	2123	sp|Q9UBC2-4|EP15R_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=9754	46.256	2	2008.9103	2008.9103	R	H	238	258
PSM	STSSETDCNDNVPSHK	2124	sp|Q13480|GAB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=1011	7.5931	2	1856.6884	1856.6884	K	N	206	222
PSM	SVDPDSPAEASGLR	2125	sp|O14745-2|NHRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8833	42.141	2	1399.6579	1399.6579	R	A	25	39
PSM	SVEEGKIDGIIDK	2126	sp|Q96A49|SYAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=13478	63	2	1481.7015	1481.7015	K	T	86	99
PSM	SVPEDDGHALLAER	2127	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=11973	56.06	2	1587.693	1587.6930	K	I	1569	1583
PSM	TAANKSPCETISSPSSTLESK	2128	sp|Q9C0D5|TANC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=10133	47.953	3	2274.0087	2274.0087	K	D	202	223
PSM	TADDPSLSLIK	2129	sp|P39656-3|OST48_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14460	67.718	2	1158.6132	1158.6132	K	Y	78	89
PSM	TCFETFPDK	2130	sp|P11216|PYGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4	ms_run[2]:scan=11578	54.354	2	1143.4907	1143.4907	R	V	325	334
PSM	TDGSISGDRQPVTVADYISR	2131	sp|P51116|FXR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=17000	81.001	3	2216.0111	2216.0111	R	A	598	618
PSM	TDKTDEPVPGASSATAALSPQEK	2132	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	19-UNIMOD:21	ms_run[2]:scan=11704	54.897	3	2379.0843	2379.0843	K	R	415	438
PSM	TELSQSDMFDQR	2133	sp|P62495-2|ERF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:35	ms_run[2]:scan=8438	40.421	2	1471.6249	1471.6249	K	L	201	213
PSM	TGTAEMSSILEER	2134	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35	ms_run[2]:scan=9559	45.321	2	1438.661	1438.6610	K	I	46	59
PSM	THSLSNADGQYDPYTDSR	2135	sp|Q8IVL1-5|NAV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=10418	49.211	3	2105.8328	2105.8328	R	F	630	648
PSM	TLEEAVGNIVK	2136	sp|Q9Y678|COPG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=16986	80.92	2	1171.6449	1171.6449	K	F	796	807
PSM	TLGTMIAGDTSGDYR	2137	sp|P20073-2|ANXA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:35	ms_run[2]:scan=11959	56.002	2	1572.709	1572.7090	K	R	443	458
PSM	TLSDPPSPLPHGPPNK	2138	sp|Q9ULH1|ASAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=13028	60.882	2	1812.7849	1812.7849	R	G	837	853
PSM	TNQELQEINR	2139	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6543	32.048	2	1243.6157	1243.6157	R	V	136	146
PSM	TPSPAAEDAREPEAK	2140	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=3279	17.933	2	1647.7141	1647.7141	K	G	1257	1272
PSM	TQDPVPPETPSDSDHK	2141	sp|A0JLT2|MED19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=4709	24.214	2	1828.7517	1828.7517	R	K	184	200
PSM	TQSGSSLSLASAATTEPESVHSGGTPSQR	2142	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13892	64.98	3	2909.304	2909.3040	R	V	1118	1147
PSM	TQSSASLAASYAAQQHPQAAASYR	2143	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13206	61.708	3	2544.1394	2544.1394	R	G	518	542
PSM	TSIAIDTIINQK	2144	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=17753	85.369	2	1315.7347	1315.7347	K	R	219	231
PSM	TSSKESSPIPSPTSDR	2145	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=7663	37.076	2	1754.7724	1754.7724	R	K	2159	2175
PSM	TTPSYVAFTDTER	2146	sp|P0DMV9|HS71B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14341	67.141	2	1486.694	1486.6940	R	L	37	50
PSM	TVSKVDDFLANEAK	2147	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=17836	85.843	2	1615.7495	1615.7495	R	G	22	36
PSM	VAILTDDEEEQKR	2148	sp|Q6ZSS7|MFSD6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=9414	44.681	2	1624.7345	1624.7345	K	K	6	19
PSM	VFAQNEEIQEMAQNK	2149	sp|Q8TD06|AGR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=8971	42.737	3	1793.8254	1793.8254	K	F	80	95
PSM	VFSNGADLSGVTEEAPLK	2150	sp|P01009|A1AT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=17401	83.376	2	1832.9156	1832.9156	K	L	335	353
PSM	VGETIIDLENR	2151	sp|Q9NZM1-2|MYOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15803	74.44	2	1257.6565	1257.6565	K	F	1592	1603
PSM	VKASPITNDGEDEFVPSDGLDK	2152	sp|Q02880-2|TOP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=16251	76.786	3	2412.0734	2412.0734	K	D	1392	1414
PSM	VKEPSVQEATSTSDILK	2153	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=14102	66	3	1910.9238	1910.9238	K	V	230	247
PSM	VMLGETNPADSK	2154	sp|O60361|NDK8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35	ms_run[2]:scan=5782	28.643	2	1276.5969	1276.5969	R	P	74	86
PSM	VNVDEVGGEALGR	2155	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=20020	100.4	2	1313.6575	1313.6575	K	L	19	32
PSM	VNVDEVGGEALGR	2156	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15925	75.079	2	1313.6575	1313.6575	K	L	19	32
PSM	VSGGLEVLAEK	2157	sp|O43423|AN32C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13497	63.102	2	1100.6077	1100.6077	R	C	72	83
PSM	VSTHSQEMDSGTEYGMGSSTK	2158	sp|Q9UKE5-8|TNIK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21,8-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=2309	13.501	3	2329.8716	2329.8716	R	A	858	879
PSM	VTLTSEEEAR	2159	sp|P00338-4|LDHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5494	27.444	2	1133.5564	1133.5564	K	L	248	258
PSM	VYEDSGIPLPAESPKK	2160	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=13655	63.86	2	1808.8597	1808.8597	K	G	50	66
PSM	YDALKEEASPVPLTSNVGSTVK	2161	sp|Q9UMZ2-6|SYNRG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=16067	75.826	3	2384.1512	2384.1512	K	G	551	573
PSM	YGLQDSDEEEEEHPSK	2162	sp|P52948-4|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=6199	30.562	3	1970.7419	1970.7419	K	T	866	882
PSM	YITGTDILDMK	2163	sp|Q9Y3A6-2|TMED5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:35	ms_run[2]:scan=15757	74.188	2	1284.6272	1284.6272	K	L	142	153
PSM	YNTEGRVSPSPSQESLSSSK	2164	sp|Q5JSH3-3|WDR44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=7749	37.437	3	2218.9743	2218.9743	K	S	81	101
PSM	YSLEPVAVELK	2165	sp|P00558-2|PGK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=18191	88.021	2	1246.6809	1246.6809	K	S	48	59
PSM	EILLQVEDER	2166	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=15274	71.75135166666668	2	1242.646046	1242.645582	K	K	1853	1863
PSM	QTALVELVK	2167	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=14883	69.81990166666667	2	982.5635	982.5694	K	H	550	559
PSM	ETNLDSLPLVDTHSK	2168	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:27,12-UNIMOD:21	ms_run[1]:scan=18899	92.56907833333334	2	1729.7903	1729.7919	R	R	425	440
PSM	TTKSPSDSGYSYETIGK	2169	sp|P46821|MAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:21	ms_run[1]:scan=9964	47.24153	3	1901.787248	1899.813920	R	T	1912	1929
PSM	MEIQEIQLK	2170	sp|P09493|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=12616	58.96366333333333	2	1146.595395	1146.595461	K	E	141	150
PSM	MEIQEIQLK	2171	sp|P09493|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=12720	59.456665	2	1146.595395	1146.595461	K	E	141	150
PSM	MEIQEIQLK	2172	sp|P09493|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=11967	56.03446166666667	2	1146.594810	1146.595461	K	E	141	150
PSM	VTNGAFTGEISPGMIK	2173	sp|P60174|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	14-UNIMOD:35	ms_run[1]:scan=15629	73.53673833333333	2	1637.793468	1636.813058	K	D	107	123
PSM	GCSEDHSGLDAK	2174	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=1291	8.742339999999999	2	1354.485542	1354.486061	K	S	1183	1195
PSM	ILDSVGIEADDDR	2175	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=13051	60.97920500000001	2	1416.670079	1416.673253	K	L	26	39
PSM	QSVDKVTSPTKV	2176	sp|Q05682|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=10078	47.72537	2	1350.6425	1350.6427	K	-	782	794
PSM	TGMMDTDDFR	2177	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3631	19.49735666666667	2	1187.441636	1187.458709	K	A	763	773
PSM	TGMMDTDDFR	2178	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3877	20.58410333333333	2	1187.439578	1187.458709	K	A	763	773
PSM	ETPHSPGVEDAPIAK	2179	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:21	ms_run[1]:scan=8425	40.36158833333334	2	1625.721314	1626.729068	R	V	486	501
PSM	ETPHSPGVEDAPIAK	2180	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:27,2-UNIMOD:21	ms_run[1]:scan=10172	48.13929166666667	3	1608.7181	1608.7180	R	V	486	501
PSM	DGSNKSGAEEQGPIDGPSK	2181	sp|O43493|TGON2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:21	ms_run[1]:scan=3422	18.603679999999997	3	1953.830496	1951.816045	K	S	219	238
PSM	PVPAAPVPSPVAPAPVPSR	2182	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	9-UNIMOD:21	ms_run[1]:scan=14859	69.70859333333334	3	1885.989309	1884.986286	K	R	123	142
PSM	QSSFKDDQDKTEK	2183	sp|Q68DQ2|CRBG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=2329	13.6043	2	1617.6539	1617.6554	K	D	142	155
PSM	QQPLFVSGGDDYK	2184	sp|P53621|COPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=17009	81.05279666666667	2	1435.6621	1435.6614	K	I	62	75
PSM	TVVQLEGDNK	2185	sp|P07148|FABPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=5775	28.613013333333335	2	1101.559503	1101.566603	K	L	81	91
PSM	DPDPEFPTVK	2186	sp|Q96G03|PGM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=12453	58.242755	2	1143.544976	1143.544805	K	Y	283	293
PSM	VPFAPGPSPPPLLGNMDQER	2187	sp|O75420|GGYF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:21,16-UNIMOD:35	ms_run[1]:scan=19914	99.632295	3	2215.020636	2214.018056	R	L	531	551
PSM	QKSDHGAYSQSPAIK	2188	sp|Q9Y4B6|DCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5009	25.449733333333334	3	1680.7342	1678.7342	R	K	977	992
PSM	TENSTSAPAAKPK	2189	sp|P07305|H10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	4-UNIMOD:21	ms_run[1]:scan=723	6.324888333333333	2	1381.6122	1380.6282	M	R	2	15
PSM	YGLQDSDEEEEEHPSK	2190	sp|P52948|NUP98_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:21	ms_run[1]:scan=7541	36.53704666666667	3	1970.730439	1970.741877	K	T	883	899
PSM	EIQNGNLHESDSESVPR	2191	sp|Q86UP2|KTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:27,10-UNIMOD:21	ms_run[1]:scan=11776	55.20766666666666	2	1972.8142	1971.8322	K	D	66	83
PSM	DLAEITTLDR	2192	sp|Q9BS26|ERP44_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=16551	78.52184	2	1146.596230	1145.592818	R	S	149	159
PSM	YGEHEASPDNGQNEFSDIIK	2193	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:21	ms_run[1]:scan=17421	83.48428	3	2329.936770	2328.953601	K	S	4	24
PSM	ASQSRPNSSALETLGGEK	2194	sp|O94804|STK10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:21	ms_run[1]:scan=12233	57.256119999999996	2	1911.856636	1910.873500	K	L	447	465
PSM	SSSVTSIDKESR	2195	sp|Q5T5C0|STXB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:21	ms_run[1]:scan=4006	21.14202166666667	2	1374.602838	1374.602805	R	E	780	792
PSM	SSSVKTPALEELVPGSEEKPK	2196	sp|P0CK96|S352B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,6-UNIMOD:21	ms_run[1]:scan=18320	88.79996333333332	3	2333.1388	2333.1398	M	G	2	23
PSM	EGMEEAEFLEAR	2197	sp|A6NHL2|TBAL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:35	ms_run[1]:scan=13946	65.235975	2	1425.603765	1425.608210	R	E	418	430
PSM	TFDANGDGTIDFR	2198	sp|P61601|NCALD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=15327	72.026615	2	1428.615617	1427.631723	R	E	71	84
PSM	TNNNQILEVKSPIK	2199	sp|P42568|AF9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:21	ms_run[1]:scan=12911	60.36094	2	1677.831255	1676.849852	K	Q	473	487
PSM	EDNGIGILTLNNPSR	2200	sp|Q9NTX5|ECHD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=18652	90.975065	2	1612.804733	1611.821649	K	M	60	75
PSM	VEGSGDPEEGKMDDEDPLVPGR	2201	sp|P29597|TYK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=11270	52.989443333333334	3	2422.982345	2422.983581	R	D	610	632
PSM	SLEDVTAEYIHK	2202	sp|Q9P0K7|RAI14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:21	ms_run[1]:scan=16059	75.78274833333333	2	1483.6597	1483.6591	K	A	667	679
PSM	MEIGLPDEK	2203	sp|P46459|NSF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=10005	47.415929999999996	2	1047.498767	1046.495412	K	G	393	402
PSM	GHASVVSLLIDR	2204	sp|Q9ULJ7|ANR50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=18880	92.44767333333333	2	1425.613853	1425.641847	K	G	726	738
PSM	TFDTNGDGTIDFR	2205	sp|P37235|HPCL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=15540	73.11533166666666	2	1458.626057	1457.642287	R	E	71	84
PSM	TFDTNGDGTIDFR	2206	sp|P37235|HPCL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22		ms_run[1]:scan=15939	75.14763666666667	2	1458.6262	1457.6422	R	E	71	84
PSM	TPSPEPVDKDFYSEFGNK	2207	sp|Q9Y2I1|NISCH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=18227	88.23516	3	2137.912521	2135.908883	R	T	1282	1300
PSM	AEQSLHDLQER	2208	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	4-UNIMOD:21	ms_run[1]:scan=6438	31.588876666666668	2	1405.6032	1404.6032	R	L	254	265
PSM	SGDHLHNDSQIEADFR	2209	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=17120	81.69402	2	1962.7732	1961.7902	M	L	2	18
PSM	GESSRKPPTPTPEGPTVSVK	2210	sp|O95744|PM2P2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	3-UNIMOD:21,4-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=19667	97.80787	2	2290.9642	2289.9682	M	Q	2	22
PSM	DENRALVHQLSNESR	2211	sp|Q9H4L5|OSBL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	11-UNIMOD:21	ms_run[1]:scan=12019	56.28106166666667	2	1847.8132	1846.8322	R	L	427	442
PSM	VELQELNDR	2212	sp|P17661|DESM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=10935	51.458025	2	1115.543186	1114.561852	K	F	110	119
PSM	MISDAIPELK	2213	sp|P40926|MDHM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=15337	72.06902833333334	2	1130.581838	1131.584562	K	A	315	325
PSM	IQLVEEELDR	2214	sp|P09493|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=16312	77.088705	2	1243.628878	1242.645582	R	A	92	102
PSM	VNVDEVGGEALGR	2215	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=14185	66.39803	2	1313.657318	1313.657543	K	L	19	32
PSM	VNVDEVGGEALGR	2216	sp|P68871|HBB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=18004	86.84016666666666	2	1313.671182	1313.657543	K	L	19	32
PSM	MILDEFYNVK	2217	sp|Q03112-4|MECOM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35,7-UNIMOD:21	ms_run[1]:scan=13352	62.37255666666667	2	1365.577950	1366.588007	-	F	1	11
PSM	GVVDSDDLPLNVSR	2218	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=16227	76.667495	2	1485.730218	1484.747087	K	E	435	449
PSM	KGSITEYTAAEEK	2219	sp|Q12982|BNIP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=8608	41.16725666666667	2	1505.656722	1505.665071	R	E	112	125
PSM	VGEEEHVYSFPNK	2220	sp|P49023|PAXI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:21	ms_run[1]:scan=8647	41.318290000000005	2	1613.657220	1613.676304	R	Q	111	124
PSM	QNCELFEQLGEYK	2221	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:4	ms_run[1]:scan=21229	110.03503666666667	2	1655.712863	1656.745372	K	F	414	427
PSM	RASVCAEAYNPDEEEDDAESR	2222	sp|P31323|KAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=9433	44.75933166666667	3	2491.941416	2491.943507	R	I	112	133
PSM	IEEVLSPEGSPSKSPSK	2223	sp|Q9UEY8|ADDG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	14-UNIMOD:21	ms_run[1]:scan=20618	105.06281666666668	2	1848.838022	1849.871041	K	K	668	685
PSM	VGEQDSAPTQEKPTSPGK	2224	sp|Q9BX66|SRBS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	15-UNIMOD:21	ms_run[1]:scan=2936	16.38015	2	1936.853609	1934.862267	R	A	336	354
PSM	VAYEGSDSEKGEGAEPLK	2225	sp|P78549|NTH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:21	ms_run[1]:scan=7254	35.12290333333333	3	1944.838601	1944.835383	R	V	66	84
PSM	TALTSSAGSCVRIPSGSCR	2226	sp|Q9NQF3|SERHL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:4,18-UNIMOD:4	ms_run[1]:scan=7800	37.65780833333333	2	2124.902504	2125.868706	R	P	181	200
PSM	EGEEPTKGNSGSEACTSSFLR	2227	sp|Q9H2Y7|ZN106_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=11622	54.557095	3	2323.967650	2321.947136	K	L	1293	1314