MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_NT_JPST000210
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\121026_CRC_N_Fr16.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\121026_CRC_N_Fr16.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q96NW4|ANR27_HUMAN	Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	1023-UNIMOD:21,962-UNIMOD:21	0.05	38.0	2	2	2
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	719-UNIMOD:21	0.02	37.0	3	1	0
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	266-UNIMOD:21	0.05	37.0	8	1	0
PRT	sp|O14497-3|ARI1A_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	1505-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36.0	null	145-UNIMOD:28,160-UNIMOD:21	0.07	36.0	1	1	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.07	35.0	1	1	1
PRT	sp|O94823|AT10B_HUMAN	Probable phospholipid-transporting ATPase VB OS=Homo sapiens OX=9606 GN=ATP10B PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	1371-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	1222-UNIMOD:21	0.01	35.0	2	1	0
PRT	sp|Q6NWY9-2|PR40B_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens OX=9606 GN=PRPF40B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	753-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q13459-2|MYO9B_HUMAN	Isoform Short of Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1405-UNIMOD:21	0.01	34.0	2	1	0
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	332-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q13477-4|MADCA_HUMAN	Isoform 4 of Mucosal addressin cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=MADCAM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	176-UNIMOD:21	0.08	33.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	805-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	362-UNIMOD:21,604-UNIMOD:21,132-UNIMOD:21,490-UNIMOD:21	0.09	33.0	8	4	2
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	597-UNIMOD:35,608-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|P46379-4|BAG6_HUMAN	Isoform 4 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	113-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	642-UNIMOD:21,278-UNIMOD:35,280-UNIMOD:21,516-UNIMOD:21	0.05	32.0	3	3	3
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	344-UNIMOD:21,240-UNIMOD:21	0.06	32.0	5	2	0
PRT	sp|Q9BX66-3|SRBS1_HUMAN	Isoform 3 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	555-UNIMOD:21,802-UNIMOD:21	0.03	32.0	2	2	2
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	2048-UNIMOD:21,1999-UNIMOD:21	0.02	32.0	3	2	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	240-UNIMOD:21	0.07	32.0	1	1	1
PRT	sp|Q9UPU7-2|TBD2B_HUMAN	Isoform 2 of TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	317-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	2144-UNIMOD:21,2152-UNIMOD:4	0.01	31.0	3	1	0
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1122-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q8TF61|FBX41_HUMAN	F-box only protein 41 OS=Homo sapiens OX=9606 GN=FBXO41 PE=2 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	478-UNIMOD:21,479-UNIMOD:21	0.02	31.0	3	1	0
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	21-UNIMOD:21	0.07	31.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	11-UNIMOD:21,26-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	830-UNIMOD:21	0.03	31.0	6	2	0
PRT	sp|Q14814-6|MEF2D_HUMAN	Isoform MEF2D00 of Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	205-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q9Y2I9|TBC30_HUMAN	TBC1 domain family member 30 OS=Homo sapiens OX=9606 GN=TBC1D30 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	114-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q13427|PPIG_HUMAN	Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	745-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.09	30.0	2	1	0
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	489-UNIMOD:21	0.01	30.0	6	1	0
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	79-UNIMOD:21	0.06	30.0	5	1	0
PRT	sp|Q9Y6J9|TAF6L_HUMAN	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens OX=9606 GN=TAF6L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	485-UNIMOD:35,501-UNIMOD:21	0.03	30.0	2	1	0
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	451-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	297-UNIMOD:35	0.04	30.0	3	1	0
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	515-UNIMOD:21	0.03	30.0	2	1	0
PRT	sp|Q9Y6C2|EMIL1_HUMAN	EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	596-UNIMOD:21,599-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q86TI0-2|TBCD1_HUMAN	Isoform 2 of TBC1 domain family member 1 OS=Homo sapiens OX=9606 GN=TBC1D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	596-UNIMOD:21,604-UNIMOD:4,627-UNIMOD:21	0.03	30.0	2	2	2
PRT	sp|Q6UX71-3|PXDC2_HUMAN	Isoform 3 of Plexin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PLXDC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	128-UNIMOD:21	0.12	30.0	2	1	0
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	702-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P16157-10|ANK1_HUMAN	Isoform Er9 of Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1666-UNIMOD:21	0.01	30.0	1	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	2718-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9H8G2|CAAP1_HUMAN	Caspase activity and apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CAAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	89-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	735-UNIMOD:21,741-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.11	30.0	2	1	0
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	553-UNIMOD:28,554-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	1032-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|O60885-2|BRD4_HUMAN	Isoform C of Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	296-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|O14672-2|ADA10_HUMAN	Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ADAM10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	418-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q86V15|CASZ1_HUMAN	Zinc finger protein castor homolog 1 OS=Homo sapiens OX=9606 GN=CASZ1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	57-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P50750|CDK9_HUMAN	Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	347-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	515-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	18-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|Q68EM7-3|RHG17_HUMAN	Isoform 3 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	401-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	214-UNIMOD:21,216-UNIMOD:21,217-UNIMOD:21	0.07	29.0	4	1	0
PRT	sp|P32241|VIPR1_HUMAN	Vasoactive intestinal polypeptide receptor 1 OS=Homo sapiens OX=9606 GN=VIPR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	422-UNIMOD:21,430-UNIMOD:4,436-UNIMOD:35	0.05	29.0	1	1	0
PRT	sp|P16157|ANK1_HUMAN	Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	1666-UNIMOD:21	0.01	29.0	1	1	0
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	416-UNIMOD:21	0.06	28.0	2	1	0
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	620-UNIMOD:21,619-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	127-UNIMOD:21	0.08	28.0	1	1	1
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	2	1	0
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	418-UNIMOD:21,420-UNIMOD:21	0.03	28.0	3	1	0
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|P08235|MCR_HUMAN	Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	703-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	224-UNIMOD:21,230-UNIMOD:35	0.03	28.0	3	1	0
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	695-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	337-UNIMOD:21	0.03	28.0	10	1	0
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	2388-UNIMOD:35,2397-UNIMOD:21,135-UNIMOD:21	0.01	28.0	2	2	2
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	290-UNIMOD:21,758-UNIMOD:21	0.04	28.0	2	2	2
PRT	sp|Q96D21|RHES_HUMAN	GTP-binding protein Rhes OS=Homo sapiens OX=9606 GN=RASD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	205-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	109-UNIMOD:21,108-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|P42696-2|RBM34_HUMAN	Isoform 2 of RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	14-UNIMOD:21	0.07	28.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	305-UNIMOD:21,310-UNIMOD:35	0.05	28.0	2	2	2
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	893-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|O14558|HSPB6_HUMAN	Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	16-UNIMOD:21	0.09	28.0	1	1	1
PRT	sp|Q9UIF8-4|BAZ2B_HUMAN	Isoform 4 of Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1087-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q13905-2|RPGF1_HUMAN	Isoform Short of Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	296-UNIMOD:21,183-UNIMOD:21	0.04	28.0	2	2	2
PRT	sp|Q9BZL6-2|KPCD2_HUMAN	Isoform 2 of Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	40-UNIMOD:21,41-UNIMOD:21	0.02	28.0	7	1	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	1456-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|Q03111|ENL_HUMAN	Protein ENL OS=Homo sapiens OX=9606 GN=MLLT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	292-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	243-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9BQ67|GRWD1_HUMAN	Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	10-UNIMOD:21,11-UNIMOD:4,17-UNIMOD:35	0.07	28.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1033-UNIMOD:21,1038-UNIMOD:35	0.01	28.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	928-UNIMOD:21,248-UNIMOD:21	0.04	28.0	2	2	2
PRT	sp|O14617|AP3D1_HUMAN	AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	658-UNIMOD:21	0.01	28.0	1	1	0
PRT	sp|Q13554|KCC2B_HUMAN	Calcium/calmodulin-dependent protein kinase type II subunit beta OS=Homo sapiens OX=9606 GN=CAMK2B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	423-UNIMOD:21,434-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P19484|TFEB_HUMAN	Transcription factor EB OS=Homo sapiens OX=9606 GN=TFEB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	142-UNIMOD:21,144-UNIMOD:35,146-UNIMOD:35	0.06	27.0	1	1	1
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	39-UNIMOD:4,42-UNIMOD:21,46-UNIMOD:4	0.03	27.0	1	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	970-UNIMOD:4,971-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	198-UNIMOD:21,237-UNIMOD:21	0.06	27.0	2	2	2
PRT	sp|Q96PX6|CC85A_HUMAN	Coiled-coil domain-containing protein 85A OS=Homo sapiens OX=9606 GN=CCDC85A PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	313-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	374-UNIMOD:21,379-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	21-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P56181-2|NDUV3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	193-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	510-UNIMOD:21,175-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	211-UNIMOD:21	0.09	27.0	2	1	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	207-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q9Y6R1-4|S4A4_HUMAN	Isoform 4 of Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	257-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	436-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|Q9NRM7|LATS2_HUMAN	Serine/threonine-protein kinase LATS2 OS=Homo sapiens OX=9606 GN=LATS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	380-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|O00255-3|MEN1_HUMAN	Isoform 3 of Menin OS=Homo sapiens OX=9606 GN=MEN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	452-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	237-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	216-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q8ND56-3|LS14A_HUMAN	Isoform 3 of Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	178-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q2KJY2-2|KI26B_HUMAN	Isoform 2 of Kinesin-like protein KIF26B OS=Homo sapiens OX=9606 GN=KIF26B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	623-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	391-UNIMOD:21,400-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.10	27.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	2	2	2
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	100-UNIMOD:21,97-UNIMOD:21	0.05	27.0	3	1	0
PRT	sp|Q86YZ3|HORN_HUMAN	Hornerin OS=Homo sapiens OX=9606 GN=HRNR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	1008-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q6PJ61|FBX46_HUMAN	F-box only protein 46 OS=Homo sapiens OX=9606 GN=FBXO46 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	338-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|O75122-3|CLAP2_HUMAN	Isoform 3 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1229-UNIMOD:35,1234-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q8N5H7-3|SH2D3_HUMAN	Isoform 3 of SH2 domain-containing protein 3C OS=Homo sapiens OX=9606 GN=SH2D3C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	116-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21	0.05	26.0	2	1	0
PRT	sp|P05771-2|KPCB_HUMAN	Isoform Beta-II of Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	641-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	649-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	218-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=HIST1H1E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	36-UNIMOD:21	0.06	26.0	2	1	0
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	316-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|A1A5D9-2|BICL2_HUMAN	Isoform 2 of BICD family-like cargo adapter 2 OS=Homo sapiens OX=9606 GN=BICDL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	142-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	373-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q13237-2|KGP2_HUMAN	Isoform 2 of cGMP-dependent protein kinase 2 OS=Homo sapiens OX=9606 GN=PRKG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	110-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q96S59-2|RANB9_HUMAN	Isoform 2 of Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	145-UNIMOD:35,146-UNIMOD:21,151-UNIMOD:35	0.06	26.0	1	1	1
PRT	sp|Q07617|SPAG1_HUMAN	Sperm-associated antigen 1 OS=Homo sapiens OX=9606 GN=SPAG1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	423-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q9P227-2|RHG23_HUMAN	Isoform 2 of Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	677-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P29474|NOS3_HUMAN	Nitric oxide synthase, endothelial OS=Homo sapiens OX=9606 GN=NOS3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	633-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	363-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q2TAZ0|ATG2A_HUMAN	Autophagy-related protein 2 homolog A OS=Homo sapiens OX=9606 GN=ATG2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	403-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|O14639-2|ABLM1_HUMAN	Isoform 2 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	527-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	162-UNIMOD:21,929-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	780-UNIMOD:21,778-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q6ZU35|K1211_HUMAN	Uncharacterized protein KIAA1211 OS=Homo sapiens OX=9606 GN=KIAA1211 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	1042-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q6UN15|FIP1_HUMAN	Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	488-UNIMOD:27,494-UNIMOD:21	0.03	26.0	1	1	0
PRT	sp|Q9UHF7|TRPS1_HUMAN	Zinc finger transcription factor Trps1 OS=Homo sapiens OX=9606 GN=TRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	826-UNIMOD:21,830-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	12-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	169-UNIMOD:21,151-UNIMOD:21,155-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|Q63ZY3-3|KANK2_HUMAN	Isoform 3 of KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	369-UNIMOD:35,375-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q14153-2|FA53B_HUMAN	Isoform 2 of Protein FAM53B OS=Homo sapiens OX=9606 GN=FAM53B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	179-UNIMOD:21,181-UNIMOD:4	0.06	25.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	991-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	48-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	2529-UNIMOD:21,2527-UNIMOD:21	0.00	25.0	2	1	0
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	268-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|Q9Y271|CLTR1_HUMAN	Cysteinyl leukotriene receptor 1 OS=Homo sapiens OX=9606 GN=CYSLTR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	313-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q9BZI7-2|REN3B_HUMAN	Isoform 2 of Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	297-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	987-UNIMOD:21,992-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	166-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	527-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1261-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	185-UNIMOD:21,183-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|P29323-2|EPHB2_HUMAN	Isoform 2 of Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	589-UNIMOD:35,590-UNIMOD:21,593-UNIMOD:35	0.02	25.0	1	1	0
PRT	sp|Q13094|LCP2_HUMAN	Lymphocyte cytosolic protein 2 OS=Homo sapiens OX=9606 GN=LCP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	207-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q6NV74|K121L_HUMAN	Uncharacterized protein KIAA1211-like OS=Homo sapiens OX=9606 GN=KIAA1211L PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	837-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P35568|IRS1_HUMAN	Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1100-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9BZ95-4|NSD3_HUMAN	Isoform 4 of Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	393-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q92565-2|RPGF5_HUMAN	Isoform 2 of Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	207-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q6DT37|MRCKG_HUMAN	Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1492-UNIMOD:21,1493-UNIMOD:35,1505-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|Q14135-5|VGLL4_HUMAN	Isoform 5 of Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	120-UNIMOD:21,121-UNIMOD:4	0.09	25.0	1	1	1
PRT	sp|P04920-2|B3A2_HUMAN	Isoform B1 of Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	99-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1097-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9NX40|OCAD1_HUMAN	OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	123-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1246-UNIMOD:21,1247-UNIMOD:35,1255-UNIMOD:4	0.02	25.0	2	1	0
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1954-UNIMOD:21	0.01	25.0	3	2	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	247-UNIMOD:21,248-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q6ZU52-2|K0408_HUMAN	Isoform 2 of Uncharacterized protein KIAA0408 OS=Homo sapiens OX=9606 GN=KIAA0408	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	294-UNIMOD:4,303-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q9NQG7-2|HPS4_HUMAN	Isoform 2 of Hermansky-Pudlak syndrome 4 protein OS=Homo sapiens OX=9606 GN=HPS4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	290-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q7Z3G6|PRIC2_HUMAN	Prickle-like protein 2 OS=Homo sapiens OX=9606 GN=PRICKLE2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	695-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	262-UNIMOD:21,263-UNIMOD:35	0.04	25.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	104-UNIMOD:4,125-UNIMOD:21	0.11	25.0	1	1	1
PRT	sp|Q9BYB0-3|SHAN3_HUMAN	Isoform 2 of SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens OX=9606 GN=SHANK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	364-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9BRD0|BUD13_HUMAN	BUD13 homolog OS=Homo sapiens OX=9606 GN=BUD13 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	271-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	29-UNIMOD:21,23-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	510-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1377-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1419-UNIMOD:21,1384-UNIMOD:21	0.02	24.0	4	2	1
PRT	sp|P29536-2|LMOD1_HUMAN	Isoform 2 of Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	492-UNIMOD:21,488-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|O15061|SYNEM_HUMAN	Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1181-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P62070-2|RRAS2_HUMAN	Isoform 2 of Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	106-UNIMOD:4,109-UNIMOD:21	0.13	24.0	1	1	1
PRT	sp|Q9NP72-3|RAB18_HUMAN	Isoform 3 of Ras-related protein Rab-18 OS=Homo sapiens OX=9606 GN=RAB18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	80-UNIMOD:21,81-UNIMOD:35	0.09	24.0	1	1	1
PRT	sp|Q9NZC9|SMAL1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	104-UNIMOD:35,108-UNIMOD:4,112-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P10636-3|TAU_HUMAN	Isoform Tau-A of Microtubule-associated protein tau OS=Homo sapiens OX=9606 GN=MAPT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	137-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	315-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|O75385|ULK1_HUMAN	Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	556-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O75628|REM1_HUMAN	GTP-binding protein REM 1 OS=Homo sapiens OX=9606 GN=REM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	250-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	202-UNIMOD:21,211-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	456-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q5SYE7-2|NHSL1_HUMAN	Isoform 2 of NHS-like protein 1 OS=Homo sapiens OX=9606 GN=NHSL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	209-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9UHD1-2|CHRD1_HUMAN	Isoform 2 of Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	180-UNIMOD:21,192-UNIMOD:4	0.06	24.0	1	1	1
PRT	sp|Q15696|U2AFM_HUMAN	U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 OS=Homo sapiens OX=9606 GN=ZRSR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	384-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1166-UNIMOD:21,1161-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1631-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O95834-2|EMAL2_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 2 OS=Homo sapiens OX=9606 GN=EML2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	108-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q96AX9-9|MIB2_HUMAN	Isoform 9 of E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens OX=9606 GN=MIB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	309-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|O75581|LRP6_HUMAN	Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens OX=9606 GN=LRP6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1500-UNIMOD:35,1508-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q7LFL8|CXXC5_HUMAN	CXXC-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=CXXC5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	84-UNIMOD:21,96-UNIMOD:35,97-UNIMOD:35	0.09	24.0	1	1	1
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	734-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	447-UNIMOD:21,453-UNIMOD:21,268-UNIMOD:21	0.06	24.0	2	2	2
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	369-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q69YN4-4|VIR_HUMAN	Isoform 4 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	184-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	21-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	167-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q86U06-4|RBM23_HUMAN	Isoform 4 of Probable RNA-binding protein 23 OS=Homo sapiens OX=9606 GN=RBM23	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	112-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P49458-2|SRP09_HUMAN	Isoform 2 of Signal recognition particle 9 kDa protein OS=Homo sapiens OX=9606 GN=SRP9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	34-UNIMOD:21,39-UNIMOD:4	0.15	24.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	450-UNIMOD:21,402-UNIMOD:21,406-UNIMOD:21,769-UNIMOD:21	0.06	24.0	6	3	2
PRT	sp|P27448|MARK3_HUMAN	MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	39-UNIMOD:385,39-UNIMOD:4,42-UNIMOD:21,46-UNIMOD:4	0.03	24.0	1	1	0
PRT	sp|Q8TAD8|SNIP1_HUMAN	Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	31-UNIMOD:28,35-UNIMOD:21	0.04	24.0	3	1	0
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	591-UNIMOD:4	0.02	23.0	3	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	158-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P0C7T5|ATX1L_HUMAN	Ataxin-1-like OS=Homo sapiens OX=9606 GN=ATXN1L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	208-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1848-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9H8M2|BRD9_HUMAN	Bromodomain-containing protein 9 OS=Homo sapiens OX=9606 GN=BRD9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	566-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P51798-2|CLCN7_HUMAN	Isoform 2 of H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens OX=9606 GN=CLCN7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q7KZI7-10|MARK2_HUMAN	Isoform 10 of Serine/threonine-protein kinase MARK2 OS=Homo sapiens OX=9606 GN=MARK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	7-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q96S15-2|WDR24_HUMAN	Isoform 2 of GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	581-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q14586|ZN267_HUMAN	Zinc finger protein 267 OS=Homo sapiens OX=9606 GN=ZNF267 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	105-UNIMOD:21,106-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q9Y4C1|KDM3A_HUMAN	Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	445-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q17R98-3|ZN827_HUMAN	Isoform 3 of Zinc finger protein 827 OS=Homo sapiens OX=9606 GN=ZNF827	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	487-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9P0K7-3|RAI14_HUMAN	Isoform 3 of Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	281-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q8NEN9|PDZD8_HUMAN	PDZ domain-containing protein 8 OS=Homo sapiens OX=9606 GN=PDZD8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1071-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	114-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9ULC5-3|ACSL5_HUMAN	Isoform 2 of Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens OX=9606 GN=ACSL5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	28-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	251-UNIMOD:21,257-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	21-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P53814-2|SMTN_HUMAN	Isoform A of Smoothelin OS=Homo sapiens OX=9606 GN=SMTN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	67-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q15643|TRIPB_HUMAN	Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1886-UNIMOD:35,1891-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	388-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	480-UNIMOD:4,481-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P61073|CXCR4_HUMAN	C-X-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CXCR4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	339-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q9H1B7|I2BPL_HUMAN	Interferon regulatory factor 2-binding protein-like OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	547-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q92934|BAD_HUMAN	Bcl2-associated agonist of cell death OS=Homo sapiens OX=9606 GN=BAD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	117-UNIMOD:35,118-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	41-UNIMOD:21	0.15	23.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	160-UNIMOD:21,328-UNIMOD:21	0.05	23.0	3	2	1
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	641-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	552-UNIMOD:21,553-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2271-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q2TAC6|KIF19_HUMAN	Kinesin-like protein KIF19 OS=Homo sapiens OX=9606 GN=KIF19 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	895-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q8IWB9|TEX2_HUMAN	Testis-expressed protein 2 OS=Homo sapiens OX=9606 GN=TEX2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	732-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9UHB7-2|AFF4_HUMAN	Isoform 2 of AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	178-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	296-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q9NR12-2|PDLI7_HUMAN	Isoform 2 of PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	96-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P40763-3|STAT3_HUMAN	Isoform 3 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	687-UNIMOD:4,705-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P32241-3|VIPR1_HUMAN	Isoform 3 of Vasoactive intestinal polypeptide receptor 1 OS=Homo sapiens OX=9606 GN=VIPR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	212-UNIMOD:21,220-UNIMOD:4,226-UNIMOD:35	0.09	23.0	1	1	0
PRT	sp|Q9Y6R7|FCGBP_HUMAN	IgGFc-binding protein OS=Homo sapiens OX=9606 GN=FCGBP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P17096-2|HMGA1_HUMAN	Isoform HMG-Y of High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	42-UNIMOD:21	0.16	23.0	2	1	0
PRT	sp|O15143|ARC1B_HUMAN	Actin-related protein 2/3 complex subunit 1B OS=Homo sapiens OX=9606 GN=ARPC1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	315-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q9UMD9|COHA1_HUMAN	Collagen alpha-1(XVII) chain OS=Homo sapiens OX=9606 GN=COL17A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	118-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	240-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q9P275|UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	713-UNIMOD:21,722-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	246-UNIMOD:35	0.05	22.0	1	1	1
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	163-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q8NDT2-2|RB15B_HUMAN	Isoform 2 of Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	205-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1000-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	544-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|O75069-4|TMCC2_HUMAN	Isoform 4 of Transmembrane and coiled-coil domains protein 2 OS=Homo sapiens OX=9606 GN=TMCC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	107-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q92738|US6NL_HUMAN	USP6 N-terminal-like protein OS=Homo sapiens OX=9606 GN=USP6NL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	642-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	711-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O95049-5|ZO3_HUMAN	Isoform 6 of Tight junction protein ZO-3 OS=Homo sapiens OX=9606 GN=TJP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	283-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P33527-8|MRP1_HUMAN	Isoform 8 of Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	815-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1861-UNIMOD:4,1863-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	112-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q9NX55-3|HYPK_HUMAN	Isoform 3 of Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	38-UNIMOD:21	0.14	22.0	1	1	1
PRT	sp|O14683|P5I11_HUMAN	Tumor protein p53-inducible protein 11 OS=Homo sapiens OX=9606 GN=TP53I11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	14-UNIMOD:21	0.06	22.0	2	1	0
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	993-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8TD19|NEK9_HUMAN	Serine/threonine-protein kinase Nek9 OS=Homo sapiens OX=9606 GN=NEK9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	942-UNIMOD:35,944-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1269-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9NP71-5|MLXPL_HUMAN	Isoform 5 of Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	196-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	121-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q8IX21|SLF2_HUMAN	SMC5-SMC6 complex localization factor protein 2 OS=Homo sapiens OX=9606 GN=SLF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	340-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9UPN4-2|CP131_HUMAN	Isoform 2 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	116-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	304-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	185-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|Q2NKQ1-4|SGSM1_HUMAN	Isoform 3 of Small G protein signaling modulator 1 OS=Homo sapiens OX=9606 GN=SGSM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	641-UNIMOD:35,646-UNIMOD:21,656-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	522-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O43149|ZZEF1_HUMAN	Zinc finger ZZ-type and EF-hand domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZZEF1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q59EK9-2|RUN3A_HUMAN	Isoform 2 of RUN domain-containing protein 3A OS=Homo sapiens OX=9606 GN=RUNDC3A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	361-UNIMOD:21,363-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|P09493-2|TPM1_HUMAN	Isoform 2 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	57-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|Q96SU4-5|OSBL9_HUMAN	Isoform 5 of Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	148-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1054-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q6PIF6-2|MYO7B_HUMAN	Isoform 2 of Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	904-UNIMOD:21,914-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1278-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	855-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q14802|FXYD3_HUMAN	FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	84-UNIMOD:21	0.23	22.0	1	1	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	282-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O14874-2|BCKD_HUMAN	Isoform 2 of [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	33-UNIMOD:21,42-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|Q8N4S9-2|MALD2_HUMAN	Isoform 2 of MARVEL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MARVELD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	37-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q5M775-5|CYTSB_HUMAN	Isoform 5 of Cytospin-B OS=Homo sapiens OX=9606 GN=SPECC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	344-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q96IG2-2|FXL20_HUMAN	Isoform 2 of F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	385-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P22105-1|TENX_HUMAN	Isoform 3 of Tenascin-X OS=Homo sapiens OX=9606 GN=TNXB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|Q9ULH0-2|KDIS_HUMAN	Isoform 2 of Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1456-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q14571|ITPR2_HUMAN	Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens OX=9606 GN=ITPR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1855-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	295-UNIMOD:21,297-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8WU20|FRS2_HUMAN	Fibroblast growth factor receptor substrate 2 OS=Homo sapiens OX=9606 GN=FRS2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	210-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P02671|FIBA_HUMAN	Fibrinogen alpha chain OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	559-UNIMOD:27,560-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|E9PAV3|NACAM_HUMAN	Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	766-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	80-UNIMOD:28	0.05	22.0	1	1	1
PRT	sp|O94812|BAIP3_HUMAN	BAI1-associated protein 3 OS=Homo sapiens OX=9606 GN=BAIAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	125-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P34741|SDC2_HUMAN	Syndecan-2 OS=Homo sapiens OX=9606 GN=SDC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	178-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P29323|EPHB2_HUMAN	Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	586-UNIMOD:21,589-UNIMOD:35,593-UNIMOD:35	0.01	22.0	1	1	0

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RHTVEDAVVSQGPEAAGPLSTPQEVSASR	1	sp|Q96NW4|ANR27_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21	ms_run[2]:scan=12254	70.539	3	3054.4408	3054.4408	R	S	1021	1050
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	2	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	10-UNIMOD:21	ms_run[2]:scan=8342	46.311	3	2671.2239	2671.2239	K	Q	710	737
PSM	RLSTSPDVIQGHQPR	3	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:21	ms_run[2]:scan=7131	39.582	2	1769.8574	1769.8574	R	D	264	279
PSM	KHVTTAEGTPGTTDQEGPPPDGPPEK	4	sp|O14497-3|ARI1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	9-UNIMOD:21	ms_run[2]:scan=4898	27.331	3	2722.2123	2722.2123	R	R	1497	1523
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	5	sp|P54727|RD23B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6446	35.68672333333333	3	3007.3313	3007.3290	K	S	145	174
PSM	KEEEEEEEEYDEGSNLKK	6	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5060	28.174	3	2212.9495	2212.9495	K	Q	230	248
PSM	PTHHPVSSITGQDFSASTPK	7	sp|O94823|AT10B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:21	ms_run[2]:scan=9311	51.94	3	2172.9841	2172.9841	R	S	1364	1384
PSM	SLVHEVGKPPQDVTDDSPPSK	8	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	17-UNIMOD:21	ms_run[2]:scan=8375	46.506	3	2311.0733	2311.0733	R	K	1206	1227
PSM	GSPSSHLLGADHGLR	9	sp|Q6NWY9-2|PR40B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:21	ms_run[2]:scan=8332	46.261	2	1582.7253	1582.7253	R	K	750	765
PSM	KKPGDASSLPDAGLSPGSQVDSK	10	sp|Q13459-2|MYO9B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	15-UNIMOD:21	ms_run[2]:scan=9086	50.626	3	2320.0948	2320.0948	K	S	1391	1414
PSM	SLNSTPPPPPAPAPAPPPALAR	11	sp|Q8TE68-4|ES8L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:21	ms_run[2]:scan=12223	70.335	2	2195.114	2195.1140	R	P	328	350
PSM	GVVDSDDLPLNVSR	12	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=13275	77.861	2	1484.7471	1484.7471	K	E	435	449
PSM	HLAEDDTHPPASLR	13	sp|Q13477-4|MADCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	12-UNIMOD:21	ms_run[2]:scan=5987	33.127	2	1637.7199	1637.7199	R	L	165	179
PSM	RLSTSPDVIQGHQPR	14	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=7327	40.6	2	1769.8574	1769.8574	R	D	264	279
PSM	SAPTAPTPPPPPPPATPR	15	sp|Q14202-2|ZMYM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:21	ms_run[2]:scan=8363	46.432	2	1827.892	1827.8921	R	K	799	817
PSM	SEVQQPVHPKPLSPDSR	16	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	13-UNIMOD:21	ms_run[2]:scan=6301	34.869	2	1979.9466	1979.9466	K	A	350	367
PSM	AHSLMELSPSAPPGGSPHLDSSR	17	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=10366	58.24	3	2425.0733	2425.0733	K	S	593	616
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	18	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	26-UNIMOD:21	ms_run[2]:scan=6097	33.725	3	2864.2839	2864.2839	R	G	88	119
PSM	KPTSAKPSSTTPR	19	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=470	4.7614	2	1436.7025	1436.7025	K	L	634	647
PSM	RKPSPEPEGEVGPPK	20	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21	ms_run[2]:scan=3768	21.238	2	1682.8029	1682.8029	K	I	341	356
PSM	RPSSSASTKDSESPR	21	sp|Q9BX66-3|SRBS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21	ms_run[2]:scan=450	4.6744	2	1670.7261	1670.7261	K	H	552	567
PSM	SHVSSEPYEPISPPQVPVVHEK	22	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:21	ms_run[2]:scan=13368	78.601	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SLVHEVGKPPQDVTDDSPPSK	23	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:21	ms_run[2]:scan=8547	47.511	3	2311.0733	2311.0733	R	K	1206	1227
PSM	SRPFTVAASFQSTSVKSPK	24	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:21	ms_run[2]:scan=11426	64.996	3	2104.0354	2104.0354	R	T	588	607
PSM	SRTHSTSSSLGSGESPFSR	25	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=7928	43.955	2	2045.8804	2045.8804	R	S	238	257
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	26	sp|P46379-4|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	26-UNIMOD:21	ms_run[2]:scan=5908	32.719	3	2864.2839	2864.2839	R	G	88	119
PSM	NRHSSGDPSSEGTSGSGSVSIR	27	sp|Q9UPU7-2|TBD2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21	ms_run[2]:scan=3743	21.118	3	2239.9455	2239.9455	K	K	313	335
PSM	RAPSVANVGSHCDLSLK	28	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9767	54.659	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RGAAAADLLSSSPESQHGGTQSPGGGQPLLQPTK	29	sp|Q9H3S7|PTN23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:21	ms_run[2]:scan=12761	74.167	3	3379.6158	3379.6158	R	V	1112	1146
PSM	RHSTEGEEGDVSDVGSR	30	sp|Q8TF61|FBX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=2952	17.125	3	1895.7647	1895.7647	R	T	476	493
PSM	RKPSVPDSASPADDSFVDPGER	31	sp|P16333-2|NCK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=10473	58.952	3	2408.0645	2408.0645	K	L	18	40
PSM	SLSSSLQAPVVSTVGMQR	32	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=14531	87.685	2	1941.9231	1941.9231	R	L	11	29
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	33	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21	ms_run[2]:scan=9503	53.13	3	3112.5078	3112.5078	R	S	818	847
PSM	VIPAKSPPPPTHSTQLGAPSR	34	sp|Q14814-6|MEF2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21	ms_run[2]:scan=6764	37.595	3	2217.1307	2217.1307	K	K	200	221
PSM	RRDSLDSSTEASGSDVVLGGR	35	sp|Q9Y2I9|TBC30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	4-UNIMOD:21	ms_run[1]:scan=9113	50.77851666666667	3	2243.030203	2243.017933	R	S	111	132
PSM	KFDHESSPGTDEDK	36	sp|Q13427|PPIG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:21	ms_run[1]:scan=1140	7.619861666666667	2	1669.648628	1670.646126	K	S	739	753
PSM	APEPHVEEDDDDELDSK	37	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6853	38.06	2	1938.7967	1938.7967	K	L	5	22
PSM	HRPSEADEEELAR	38	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=4092	22.984	2	1617.6784	1617.6784	K	R	486	499
PSM	KKEPAITSQNSPEAR	39	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=1708	10.317	2	1734.8302	1734.8302	K	E	69	84
PSM	KMPQLTASAIVSPHGDESPR	40	sp|Q9Y6J9|TAF6L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=9852	55.163	3	2216.0297	2216.0297	R	G	484	504
PSM	KRESESESDETPPAAPQLIK	41	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=9470	52.943	2	2291.0682	2291.0682	R	K	448	468
PSM	MGHAGAIIAGGK	42	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:35	ms_run[2]:scan=2159	12.739	2	1097.5652	1097.5652	R	G	297	309
PSM	NAIHTFVQSGSHLAAR	43	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=10188	57.214	2	1787.8468	1787.8468	K	E	507	523
PSM	PARPNLSGSSAGSPLSGLGGEGPGESEK	44	sp|Q9Y6C2|EMIL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11982	68.667	3	2594.2572	2594.2572	R	V	150	178
PSM	RADDFPVRDDPSDVTDEDEGPAEPPPPPK	45	sp|Q3YEC7|RABL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=11675	66.628	3	3319.3595	3319.3595	R	L	585	614
PSM	RANTLSHFPIECQEPPQPAR	46	sp|Q86TI0-2|TBCD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=11681	66.67	3	2427.1155	2427.1155	R	G	593	613
PSM	RGSGHPAYAEVEPVGEK	47	sp|Q6UX71-3|PXDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=6849	38.04	2	1861.836	1861.8360	R	E	126	143
PSM	RISHSLYSGIEGLDESPSR	48	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=13619	80.563	3	2182.0056	2182.0056	R	N	700	719
PSM	RQDDATGAGQDSENEVSLVSGHQR	49	sp|P16157-10|ANK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=7843	43.514	3	2635.126	2635.1260	K	G	1655	1679
PSM	RQVSASELHTSGILGPETLR	50	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=13590	80.343	3	2230.1107	2230.1107	R	D	2715	2735
PSM	RRSTDSSSVSGSLQQETK	51	sp|Q9H8G2|CAAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=4529	25.358	3	2031.9222	2031.9222	K	Y	87	105
PSM	RSSKEEAEMAYK	52	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1044	7.2062	2	1523.6327	1523.6327	K	D	733	745
PSM	VGAHAGEYGAEALER	53	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7678	42.577	2	1528.727	1528.7270	K	M	18	33
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	54	sp|Q9C0B5|ZDHC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=12590	72.95157333333333	3	3072.3950	3072.3933	R	T	553	583
PSM	SPSHSSSNRPFTPPTSTGGSK	55	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	12-UNIMOD:21	ms_run[1]:scan=5002	27.830409999999997	2	2195.968031	2194.964441	K	S	1021	1042
PSM	KADTTTPTTIDPIHEPPSLPPEPK	56	sp|O60885-2|BRD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=13377	78.659	3	2661.2939	2661.2939	R	T	291	315
PSM	LPPPKPLPGTLK	57	sp|O14672-2|ADA10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=9872	55.286	2	1336.752	1336.7520	K	R	409	421
PSM	RADAGSHTEGSPSQPR	58	sp|Q86V15|CASZ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:21	ms_run[2]:scan=533	5.04	2	1731.7326	1731.7326	K	D	47	63
PSM	RKGSQITQQSTNQSR	59	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=750	5.9621	2	1797.8483	1797.8483	R	N	344	359
PSM	RPEGPGAQAPSSPR	60	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:21	ms_run[2]:scan=1818	10.907	2	1485.6726	1485.6726	R	V	504	518
PSM	RPILQLSPPGPR	61	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=12812	74.515	2	1409.7544	1409.7544	R	G	12	24
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	62	sp|Q68EM7-3|RHG17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=9175	51.16	3	2686.2501	2686.2501	R	R	401	427
PSM	VAHSDKPGSTSTASFR	63	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:21	ms_run[2]:scan=3117	17.942	2	1726.7676	1726.7676	K	D	206	222
PSM	YRHPSGGSNGATCSTQVSMLTR	64	sp|P32241|VIPR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	5-UNIMOD:21,13-UNIMOD:4,19-UNIMOD:35	ms_run[1]:scan=7349	40.740768333333335	3	2463.028070	2462.046808	K	V	418	440
PSM	RQDDATGAGQDSENEVSLVSGHQR	65	sp|P16157|ANK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	12-UNIMOD:21	ms_run[1]:scan=8056	44.674634999999995	3	2636.112081	2635.125980	K	G	1655	1679
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	66	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:21	ms_run[2]:scan=12383	71.444	3	2574.2228	2574.2228	K	K	408	434
PSM	AAPPPPPPPPPLESSPR	67	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:21	ms_run[2]:scan=9801	54.858	3	1782.8706	1782.8706	K	V	606	623
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	68	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=16138	100.33	3	3613.8254	3613.8254	R	Q	125	162
PSM	DADDAVYELDGK	69	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9340	52.11	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	70	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10785	60.911	2	1309.5674	1309.5674	R	E	49	61
PSM	ERDHSPTPSVFNSDEER	71	sp|Q6UN15-3|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=7198	39.912	2	2080.8487	2080.8487	R	Y	414	431
PSM	FHQLDIDDLQSIR	72	sp|P16152-2|CBR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15332	93.969	2	1598.8053	1598.8053	R	A	59	72
PSM	GIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAK	73	sp|P08235|MCR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	21-UNIMOD:21	ms_run[2]:scan=10797	60.984	3	3649.709	3649.7090	K	E	683	716
PSM	GPPSPPAPVMHSPSR	74	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=4957	27.607	2	1608.712	1608.7120	R	K	221	236
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	75	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=8518	47.344	3	2671.2239	2671.2239	K	Q	710	737
PSM	GVPHPEDDHSQVEGPESLR	76	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	17-UNIMOD:21	ms_run[2]:scan=8153	45.241	2	2163.9222	2163.9222	K	-	679	698
PSM	IGHHSTSDDSSAYR	77	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=1379	8.6976	3	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	78	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=1802	10.826	3	1611.6315	1611.6315	R	S	333	347
PSM	ISMPDLDLHLKSPK	79	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=12019	68.923	2	1688.8209	1688.8209	K	A	2386	2400
PSM	KFSAGGDSDPPLKR	80	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=5428	30.178	2	1553.7239	1553.7239	R	S	288	302
PSM	KISVQYGDAFHPR	81	sp|Q96D21|RHES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=10725	60.529	3	1596.745	1596.7450	R	P	203	216
PSM	KKEPAITSQNSPEAR	82	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=1902	11.334	2	1734.8302	1734.8302	K	E	69	84
PSM	KLSVPTSDEEDEVPAPKPR	83	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21	ms_run[2]:scan=9864	55.228	2	2173.0304	2173.0304	K	G	103	122
PSM	KRSVQEGENPDDGVR	84	sp|P42696-2|RBM34_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=1681	10.181	3	1764.7792	1764.7792	R	G	12	27
PSM	LEGLTDEINFLR	85	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=18162	117.15	2	1418.7405	1418.7405	R	Q	214	226
PSM	PAAPAAHSAHSASVSPVESR	86	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:21	ms_run[2]:scan=3503	19.892	3	2007.9164	2007.9164	R	G	879	899
PSM	RASAPLPGLSAPGR	87	sp|O14558|HSPB6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=10162	57.073	2	1428.7239	1428.7239	R	L	14	28
PSM	RDTSGGIDLGEEQHPLGTPTPGR	88	sp|Q9UIF8-4|BAZ2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	18-UNIMOD:21	ms_run[2]:scan=10948	61.871	3	2469.1285	2469.1285	K	K	1070	1093
PSM	RLSGGSHSYGGESPR	89	sp|Q13905-2|RPGF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=2550	14.946	2	1625.6947	1625.6947	R	L	294	309
PSM	RLSSTSLASGHSVR	90	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=5471	30.4	3	1536.741	1536.7410	R	L	38	52
PSM	RLSTSPDVIQGHQPR	91	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=7325	40.594	3	1769.8574	1769.8574	R	D	264	279
PSM	RNSVERPAEPVAGAATPSLVEQQK	92	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=10243	57.494	3	2613.2912	2613.2912	R	M	1454	1478
PSM	RPATADSPKPSAK	93	sp|Q03111|ENL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21	ms_run[2]:scan=503	4.8991	2	1404.6762	1404.6762	K	K	286	299
PSM	RPDDVPLSLSPSKR	94	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=9118	50.812	3	1645.8189	1645.8189	K	A	234	248
PSM	RRTCETGEPMEAESGDTSSEGPAQVYLPGR	95	sp|Q9BQ67|GRWD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,4-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=10962	61.954	3	3362.4181	3362.4181	R	G	8	38
PSM	SHLVHGSSPGVMGTSVATSASK	96	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=5458	30.33	3	2191.9933	2191.9933	K	I	1027	1049
PSM	WAHDKFSGEEGEIEDDESGTENR	97	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21	ms_run[2]:scan=10970	62	3	2716.0562	2716.0562	K	E	922	945
PSM	HRPSEADEEELAR	98	sp|O14617|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:21	ms_run[1]:scan=3905	21.978679999999997	2	1618.682172	1617.678429	K	R	655	668
PSM	RGSGAPEAEGPLPCPSPAPFSPLPAPSPR	99	sp|Q13554|KCC2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=16100	100.044995	3	2976.404670	2975.400093	R	I	421	450
PSM	RNSVERPAEPVAGAATPSLVEQQK	100	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	3-UNIMOD:21	ms_run[1]:scan=10203	57.28071666666666	3	2613.292678	2613.291195	R	M	1454	1478
PSM	VAHSDKPGSTSTASFR	101	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	9-UNIMOD:21	ms_run[1]:scan=3365	19.145551666666666	2	1725.753390	1726.767579	K	D	206	222
PSM	AGHVLSSSAGNSAPNSPMAMLHIGSNPER	102	sp|P19484|TFEB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:21,18-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=9783	54.755	3	3000.3219	3000.3219	R	E	127	156
PSM	APEPHVEEDDDDELDSK	103	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6829	37.954	3	1938.7967	1938.7967	K	L	5	22
PSM	CRNSIASCADEQPHIGNYR	104	sp|P27448-8|MARK3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=9069	50.539	3	2326.9573	2326.9573	R	L	39	58
PSM	DASDDLDDLNFFNQK	105	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18036	116.14	2	1755.7588	1755.7588	K	K	65	80
PSM	DRDDFPVVLVGNK	106	sp|P10301|RRAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13592	80.355	2	1472.7623	1472.7623	K	A	131	144
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	107	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=8163	45.303	3	2671.2239	2671.2239	K	Q	710	737
PSM	HLQVNVTNPVQCSLHGK	108	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=10184	57.195	3	2009.9506	2009.9506	R	K	959	976
PSM	HQASDSENEEPPKPR	109	sp|Q96ST2|IWS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=1074	7.3337	2	1799.7476	1799.7476	R	M	193	208
PSM	HRPSEADEEELAR	110	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=4223	23.719	3	1617.6784	1617.6784	K	R	486	499
PSM	HVLSGSPEHFQK	111	sp|Q96PX6|CC85A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=5252	29.243	2	1444.65	1444.6500	K	H	308	320
PSM	IGHHSTSDDSSAYR	112	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=1279	8.2176	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	113	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=1156	7.689	3	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	114	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=1488	9.2393	2	1611.6315	1611.6315	R	S	333	347
PSM	KKDSLHGSTGAVNATR	115	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=1826	10.939	3	1800.7921	1800.7921	K	P	371	387
PSM	KKEEPSQNDISPK	116	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=1199	7.8659	2	1578.7291	1578.7291	K	T	11	24
PSM	KLSVPTSDEEDEVPAPKPR	117	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=9890	55.396	3	2173.0304	2173.0304	K	G	103	122
PSM	KPEASHSFENR	118	sp|P56181-2|NDUV3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=1136	7.5985	2	1380.5823	1380.5823	R	A	187	198
PSM	LKDLFDYSPPLHK	119	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=15023	91.529	2	1651.8011	1651.8011	K	N	503	516
PSM	LLKPGEEPSEYTDEEDTK	120	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=8585	47.718	3	2158.9195	2158.9195	R	D	200	218
PSM	LNHVAAGLVSPSLK	121	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=11407	64.872	2	1484.7752	1484.7752	K	S	198	212
PSM	NLTSSSLNDISDKPEK	122	sp|Q9Y6R1-4|S4A4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=8853	49.307	2	1826.8299	1826.8299	R	D	252	268
PSM	NVAEALGHSPKDPGGGGGPVR	123	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=7599	42.13	2	2050.9586	2050.9586	K	A	428	449
PSM	RDSLQKPGLEAPPR	124	sp|Q9NRM7|LATS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=6992	38.824	3	1642.8192	1642.8192	R	A	378	392
PSM	RESKPEEPPPPK	125	sp|O00255-3|MEN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=1233	8.0076	2	1469.6916	1469.6916	R	K	450	462
PSM	RHSTEGEEGDVSDVGSR	126	sp|Q8TF61|FBX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=2975	17.232	2	1895.7647	1895.7647	R	T	476	493
PSM	RKSELEFETLK	127	sp|Q5JSH3-4|WDR44_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=9838	55.08	3	1458.712	1458.7120	K	T	235	246
PSM	RLSSTSLASGHSVR	128	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=5295	29.445	2	1536.741	1536.7410	R	L	38	52
PSM	RLSSTSLASGHSVR	129	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=5887	32.621	3	1536.741	1536.7410	R	L	38	52
PSM	RPAEATSSPTSPERPR	130	sp|Q9BU76|MMTA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=1572	9.6388	2	1817.8421	1817.8421	R	H	210	226
PSM	RSPVSTRPLPSASQK	131	sp|Q8ND56-3|LS14A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=4138	23.24	2	1689.8563	1689.8563	R	A	174	189
PSM	SHSPVPAAAPAHSPSPASPR	132	sp|Q2KJY2-2|KI26B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=4675	26.126	3	1999.9265	1999.9265	R	S	621	641
PSM	SHVSSEPYEPISPPQVPVVHEK	133	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=13495	79.612	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SRDDLYDQDDSR	134	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3508	19.915	2	1483.6175	1483.6175	R	D	374	386
PSM	SRSGEGEVSGLMR	135	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=4644	25.952	2	1459.6127	1459.6127	R	K	389	402
PSM	STAQQELDGKPASPTPVIVASHTANK	136	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:21	ms_run[2]:scan=9200	51.305	3	2726.3276	2726.3276	R	E	818	844
PSM	VNVDEVGGEALGR	137	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10751	60.671	2	1313.6575	1313.6575	K	L	19	32
PSM	IRLDETDDPDDYGDR	138	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9167	51.11363333333333	3	1793.771570	1793.770401	K	E	399	414
PSM	KKEPAITSQNSPEAR	139	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	11-UNIMOD:21	ms_run[1]:scan=2225	13.120228333333333	3	1735.816052	1734.830179	K	E	90	105
PSM	QSLGHGQHGSGSGQSPSPSR	140	sp|Q86YZ3|HORN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	17-UNIMOD:21	ms_run[1]:scan=827	6.27484	3	2027.845440	2026.860644	R	G	992	1012
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	141	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=12238	70.433	3	2574.2228	2574.2228	K	K	408	434
PSM	ADEASEGDSPAPARPEDTPPAPPPPPAR	142	sp|Q6PJ61|FBX46_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=8373	46.492	3	2871.2712	2871.2712	R	D	330	358
PSM	ASLLHSMPTHSSPR	143	sp|O75122-3|CLAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=3568	20.203	2	1615.7178	1615.7178	K	S	1223	1237
PSM	DLDDIEDENEQLK	144	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11442	65.102	2	1574.6948	1574.6948	R	Q	313	326
PSM	DMESPTKLDVTLAK	145	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=10885	61.514	2	1642.7525	1642.7525	K	D	277	291
PSM	GPHTSPSHTLGK	146	sp|Q8N5H7-3|SH2D3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=1078	7.3532	2	1297.5816	1297.5816	K	A	112	124
PSM	HIKEEPLSEEEPCTSTAIASPEK	147	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10271	57.655	3	2661.1881	2661.1881	K	K	495	518
PSM	HPPVLTPPDQEVIR	148	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=12056	69.178	3	1676.8287	1676.8287	R	N	636	650
PSM	HPPVLTPPDQEVIR	149	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=12203	70.203	3	1676.8287	1676.8287	R	N	636	650
PSM	HRPSEADEEELAR	150	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=4037	22.682	3	1617.6784	1617.6784	K	R	486	499
PSM	IEEVLSPEGSPSKSPSK	151	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=7895	43.773	2	1849.871	1849.8710	K	K	636	653
PSM	IYHLPDAESDEDEDFKEQTR	152	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=12129	69.723	3	2516.0381	2516.0381	K	L	210	230
PSM	KASGPPVSELITK	153	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=10917	61.701	2	1405.7218	1405.7218	R	A	34	47
PSM	KHSEEAEFTPPLK	154	sp|Q3B726|RPA43_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=9032	50.364	2	1591.7283	1591.7283	R	C	314	327
PSM	KQDFDEDDILK	155	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10574	59.561	2	1364.646	1364.6460	K	E	50	61
PSM	KRTSLSPAEILEEK	156	sp|A1A5D9-2|BICL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=12372	71.353	2	1679.8495	1679.8495	K	E	139	153
PSM	KSNLDEEVNVIPPHTPVR	157	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:21	ms_run[2]:scan=11099	62.841	3	2123.0412	2123.0412	R	T	359	377
PSM	KTSGLVSLHSR	158	sp|Q13237-2|KGP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=5309	29.516	2	1263.6337	1263.6337	R	R	108	119
PSM	PFSSPSMSPSHGMNIHNLASGK	159	sp|Q96S59-2|RANB9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35,8-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=8339	46.295	3	2394.0134	2394.0134	R	G	139	161
PSM	RAPSVANVGSHCDLSLK	160	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9931	55.67	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RASAAAAAGGGATGHPGGGQGAENPAGLK	161	sp|Q07617|SPAG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=5666	31.425	3	2538.1725	2538.1725	R	S	421	450
PSM	RHSTSDLSDATFSDIR	162	sp|Q9P227-2|RHG23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=11135	63.057	3	1886.816	1886.8160	K	R	675	691
PSM	RKESSNTDSAGALGTLR	163	sp|P29474|NOS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=6874	38.163	2	1841.8633	1841.8633	K	F	630	647
PSM	RLEQTSVRDPSPEADAPVLGSPEK	164	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=10474	58.956	3	2657.2698	2657.2698	R	E	353	377
PSM	RLSAQAHPAGK	165	sp|Q2TAZ0|ATG2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=886	6.5066	2	1214.5921	1214.5921	R	M	401	412
PSM	RSSGREEDDEELLR	166	sp|O14639-2|ABLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=6533	36.22	2	1769.7581	1769.7581	R	R	525	539
PSM	RSTVLGLPQHVQK	167	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=8194	45.48	2	1541.8079	1541.8079	R	E	160	173
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	168	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=12113	69.609	3	3174.5598	3174.5598	K	N	773	803
PSM	KPASPPLPATQQEKPSQTPEAGR	169	sp|Q6ZU35|K1211_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:21	ms_run[1]:scan=6225	34.45177833333333	3	2494.220526	2494.221718	R	K	1039	1062
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	170	sp|Q9C0B5|ZDHC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=12443	71.913225	3	3072.3954	3072.3933	R	T	553	583
PSM	ERDHSPTPSVFNSDEER	171	sp|Q6UN15|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:27,7-UNIMOD:21	ms_run[1]:scan=7219	40.019434999999994	3	2062.8316	2062.8377	R	Y	488	505
PSM	TLRDSPNVEAAHLAR	172	sp|Q9UHF7|TRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:21	ms_run[1]:scan=7879	43.698645	3	1728.831665	1728.830848	K	P	826	841
PSM	AAVVTSPPPTTAPHK	173	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=4881	27.253	2	1552.7651	1552.7651	R	E	7	22
PSM	AHYTHSDYQYSQR	174	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=3027	17.493	2	1734.6788	1734.6788	R	S	159	172
PSM	ALAMPGRPESPPVFR	175	sp|Q63ZY3-3|KANK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=11062	62.604	2	1719.8168	1719.8168	R	S	366	381
PSM	ANVLSSPCDQAGLHHR	176	sp|Q14153-2|FA53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=7338	40.668	2	1840.804	1840.8040	R	F	174	190
PSM	DKDDDEVFEKK	177	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3099	17.857	2	1366.6252	1366.6252	K	Q	658	669
PSM	EEQTDTSDGESVTHHIR	178	sp|P36915|GNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=4871	27.207	2	2019.8171	2019.8171	R	R	45	62
PSM	HADHSSLTLGSGSSTTR	179	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=4600	25.737	2	1792.7741	1792.7741	R	L	2522	2539
PSM	HIKEEPLSEEEPCTSTAIASPEK	180	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=9568	53.541	3	2661.1881	2661.1881	K	K	495	518
PSM	HRPSEADEEELAR	181	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=3544	20.089	2	1617.6784	1617.6784	K	R	486	499
PSM	HRPSEADEEELAR	182	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=4416	24.745	3	1617.6784	1617.6784	K	R	486	499
PSM	HSPQHTTTLSLSTLATPK	183	sp|P52799|EFNB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=12023	68.947	3	1998.9776	1998.9776	K	R	259	277
PSM	IGHHSTSDDSSAYR	184	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=1047	7.2173	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	185	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=1993	11.854	3	1611.6315	1611.6315	R	S	333	347
PSM	KHSLSSVTYVPR	186	sp|Q9Y271|CLTR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=7564	41.939	2	1452.7126	1452.7126	R	K	311	323
PSM	KLDKENLSDER	187	sp|Q9BZI7-2|REN3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=2752	16.056	2	1425.6501	1425.6501	K	A	290	301
PSM	KLNHTPVSTMSSSQPVSR	188	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=2895	16.812	3	2050.9507	2050.9507	K	P	983	1001
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	189	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=12566	72.78	3	3605.6199	3605.6199	K	L	150	183
PSM	KPGDGEVSPSTEDAPFQHSPLGK	190	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=11633	66.371	3	2459.1006	2459.1006	K	A	520	543
PSM	LELKASPNVEAPQPHR	191	sp|P50851-2|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=8869	49.394	2	1864.9197	1864.9197	R	H	1256	1272
PSM	LHQLSGSDQLESTAHSR	192	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=6800	37.792	3	1944.8691	1944.8691	K	I	179	196
PSM	LLKPGEEPSEYTDEEDTK	193	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:21	ms_run[2]:scan=8616	47.895	2	2158.9195	2158.9195	R	D	200	218
PSM	LQHYTSGHMTPGMK	194	sp|P29323-2|EPHB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35,10-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=1193	7.8444	2	1698.6895	1698.6895	K	I	581	595
PSM	LRSPPEALVQGR	195	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=8672	48.225	2	1401.713	1401.7130	R	Y	130	142
PSM	NHSPLPPPQTNHEEPSR	196	sp|Q13094|LCP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=3702	20.919	3	2015.8851	2015.8851	R	S	205	222
PSM	RGSGHPAYAEVEPVGEK	197	sp|Q6UX71-3|PXDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=6828	37.951	3	1861.836	1861.8360	R	E	126	143
PSM	RGTLDQPPNQEDKPGAR	198	sp|Q6NV74|K121L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=3324	18.95	3	1957.9007	1957.9007	R	T	835	852
PSM	RHSSETFSSTPSATR	199	sp|P35568|IRS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=3161	18.162	2	1729.7421	1729.7421	R	V	1098	1113
PSM	RHTSAEEEEPPPVK	200	sp|Q9BZ95-4|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=2278	13.403	2	1684.7458	1684.7458	R	I	391	405
PSM	RHTVDEYSPQK	201	sp|Q92565-2|RPGF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=2063	12.261	2	1438.6242	1438.6242	R	K	205	216
PSM	RLSSTSLASGHSVR	202	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=4945	27.547	3	1536.741	1536.7410	R	L	38	52
PSM	RLSTSPDVIQGHQPR	203	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=7687	42.635	3	1769.8574	1769.8574	R	D	264	279
PSM	RPASMGSEGLGGDADPMKR	204	sp|Q6DT37|MRCKG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,5-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=3830	21.567	3	2042.8551	2042.8551	R	K	1489	1508
PSM	RPASVSSSAAVEHEQR	205	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=2914	16.925	3	1789.8108	1789.8108	K	E	237	253
PSM	RPPSAATTCDPVVEEHFR	206	sp|Q14135-5|VGLL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=10083	56.609	3	2147.946	2147.9460	R	R	113	131
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	207	sp|P04920-2|B3A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=10616	59.84	3	3351.4012	3351.4012	R	A	94	125
PSM	RRPSGSEQSDNESVQSGR	208	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=747	5.9511	3	2054.8767	2054.8767	K	S	1094	1112
PSM	RSSPPGHYYQK	209	sp|Q9NX40|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=1548	9.5297	2	1398.6082	1398.6082	R	S	121	132
PSM	RSTVLGLPQHVQK	210	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=8349	46.349	3	1541.8079	1541.8079	R	E	160	173
PSM	RTPTMPQEEAAACPPHILPPEK	211	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=10832	61.2	3	2565.1757	2565.1757	R	R	1243	1265
PSM	RVIENADGSEEETDTR	212	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=3429	19.47	2	1899.7847	1899.7847	R	D	1946	1962
PSM	RVSHQGYSTEAEFEEPR	213	sp|P30533|AMRP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=8362	46.428	3	2100.8902	2100.8902	R	V	240	257
PSM	SEVQQPVHPKPLSPDSR	214	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=6835	37.982	3	1979.9466	1979.9466	K	A	350	367
PSM	SHPDLHVSNDCSSSVAESSSPLR	215	sp|Q6ZU52-2|K0408_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=8701	48.422	3	2547.0697	2547.0697	K	N	284	307
PSM	SLASPAGLQDGSAQHHPK	216	sp|Q9NQG7-2|HPS4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=6045	33.441	2	1879.8578	1879.8578	R	G	287	305
PSM	SRPFTVAASFQSTSVKSPK	217	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=11325	64.29	2	2104.0354	2104.0354	R	T	588	607
PSM	SRSDNALHLASER	218	sp|Q7Z3G6|PRIC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=6271	34.708	2	1534.6889	1534.6889	R	E	693	706
PSM	TLRDSPNVEAAHLAR	219	sp|Q9UHF7|TRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=7812	43.353	3	1728.8308	1728.8308	K	P	826	841
PSM	VAHSDKPGSTSTASFR	220	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=2580	15.113	3	1726.7676	1726.7676	K	D	206	222
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	221	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=11971	68.601	3	3174.5598	3174.5598	K	N	773	803
PSM	YHGHSMSDPGVSYR	222	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3397	19.313	2	1687.645	1687.6450	R	T	258	272
PSM	YSPESQAQSVHHQR	223	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=2885	16.75	2	1732.7319	1732.7319	R	P	1998	2012
PSM	KKEPAITSQNSPEAR	224	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:21	ms_run[1]:scan=1974	11.760423333333334	3	1735.818463	1734.830179	K	E	90	105
PSM	RLSTSPDVIQGHQPR	225	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21	ms_run[1]:scan=8063	44.721043333333334	3	1770.845783	1769.857397	R	D	264	279
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	226	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14195	85.03441	3	3458.399095	3459.429735	K	L	104	135
PSM	AAPPPPPPPPPLESSPR	227	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=10139	56.934	3	1782.8706	1782.8706	K	V	606	623
PSM	AHSPQGEGEIPLHR	228	sp|Q9BYB0-3|SHAN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=6365	35.223	3	1606.7253	1606.7253	K	G	362	376
PSM	ARHDSPDLAPNVTYSLPR	229	sp|Q9BRD0|BUD13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=12733	73.964	3	2087.979	2087.9790	R	T	267	285
PSM	DGDDVIIIGVFK	230	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=18226	117.68	2	1289.6867	1289.6867	K	G	302	314
PSM	DKYEPAAVSEQGDKK	231	sp|P05023-2|AT1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2966	17.188	2	1663.8053	1663.8053	R	G	8	23
PSM	DLHQPSLSPASPHSQGFER	232	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=10198	57.26	2	2168.964	2168.9640	K	G	16	35
PSM	FNGGHSPTHSPEK	233	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=813	6.2185	2	1473.6038	1473.6038	R	I	505	518
PSM	GRPPAEKLSPNPPK	234	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=4068	22.839	2	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPNLTK	235	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=8355	46.385	3	1894.9666	1894.9666	R	K	1411	1428
PSM	GSPKPSPQPSPKPSPK	236	sp|P29536-2|LMOD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=1184	7.8116	2	1694.8393	1694.8393	K	N	479	495
PSM	HQASDSENEELPKPR	237	sp|Q96ST2|IWS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=4003	22.483	3	1815.7789	1815.7789	R	I	232	247
PSM	HVTLGPGQSPLSR	238	sp|O15061|SYNEM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=8148	45.218	2	1427.6922	1427.6922	R	E	1173	1186
PSM	IGHHSTSDDSSAYR	239	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=1892	11.286	2	1611.6315	1611.6315	R	S	333	347
PSM	KAEGEPQEESPLK	240	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=3311	18.893	2	1520.676	1520.6760	K	S	166	179
PSM	KFQEQECPPSPEPTRK	241	sp|P62070-2|RRAS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=4513	25.275	3	2036.9027	2036.9027	R	E	100	116
PSM	KHSMLFIEASAK	242	sp|Q9NP72-3|RAB18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7543	41.82	2	1456.6786	1456.6786	R	T	78	90
PSM	KKDSLHGSTGAVNATR	243	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=1829	10.949	2	1800.7921	1800.7921	K	P	371	387
PSM	KKEPAITSQNSPEAR	244	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=1509	9.3383	3	1734.8302	1734.8302	K	E	69	84
PSM	KMPQLTASAIVSPHGDESPR	245	sp|Q9Y6J9|TAF6L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=9675	54.155	3	2216.0297	2216.0297	R	G	484	504
PSM	KPEEMPTACPGHSPR	246	sp|Q9NZC9|SMAL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=1105	7.4613	3	1788.7325	1788.7325	K	S	100	115
PSM	KVAVVRTPPK	247	sp|P10636-3|TAU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=2533	14.852	2	1173.6635	1173.6635	K	S	131	141
PSM	KVLSPTAAKPSPFEGK	248	sp|Q96QC0|PP1RA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=8444	46.924	2	1735.891	1735.8910	K	T	310	326
PSM	LDETDDPDDYGDR	249	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6093	33.706	2	1524.5852	1524.5852	R	E	401	414
PSM	LHSAPNLSDLHVVR	250	sp|O75385|ULK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=12569	72.801	3	1636.8087	1636.8087	R	P	554	568
PSM	RDSAAKEPPAPR	251	sp|O75628|REM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=984	6.9339	2	1373.6453	1373.6453	R	R	248	260
PSM	RGSIGENQVEVMVEEK	252	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=9667	54.111	3	1898.8445	1898.8445	K	T	200	216
PSM	RKQSSSEISLAVER	253	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=7814	43.361	2	1668.8196	1668.8196	R	A	453	467
PSM	RKTITGVPDNIQK	254	sp|Q5SYE7-2|NHSL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=6114	33.81	2	1548.8025	1548.8025	R	E	207	220
PSM	RKTSDFNTFLAQEGCTK	255	sp|Q9UHD1-2|CHRD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=11922	68.275	3	2081.9242	2081.9242	R	G	178	195
PSM	RLSSTSLASGHSVR	256	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=5664	31.414	3	1536.741	1536.7410	R	L	38	52
PSM	RLSTSPDVIQGHQPR	257	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=7505	41.614	3	1769.8574	1769.8574	R	D	264	279
PSM	RNPSPDHSYK	258	sp|Q15696|U2AFM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=805	6.1849	2	1279.5347	1279.5347	R	R	381	391
PSM	RRPESAPAESSPSK	259	sp|Q07889|SOS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=865	6.4227	2	1577.7199	1577.7199	R	I	1157	1171
PSM	RRSNVSSPATPTASSSSSTTPTR	260	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=3155	18.135	3	2414.1187	2414.1187	K	K	1629	1652
PSM	RSSPPGHYYQK	261	sp|Q9NX40|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1754	10.555	2	1398.6082	1398.6082	R	S	121	132
PSM	RTPTMPQEEAAACPPHILPPEK	262	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=10669	60.189	3	2565.1757	2565.1757	R	R	1243	1265
PSM	RVGGYATSPSSPKK	263	sp|O95834-2|EMAL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=1489	9.243	2	1513.729	1513.7290	R	E	98	112
PSM	RVSADSQPFQHGDK	264	sp|Q96AX9-9|MIB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=3853	21.678	2	1650.7151	1650.7151	R	V	307	321
PSM	SHYTMEFGYSSNSPSTHR	265	sp|O75581|LRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7369	40.848	3	2182.8415	2182.8415	R	S	1496	1514
PSM	SRPFTVAASFQSTSVKSPK	266	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	17-UNIMOD:21	ms_run[2]:scan=11274	63.992	3	2104.0354	2104.0354	R	T	588	607
PSM	SRPLSHYSSFGSSGGSGGGSMMGGESADK	267	sp|Q7LFL8|CXXC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21,21-UNIMOD:35,22-UNIMOD:35	ms_run[2]:scan=7136	39.605	3	2888.1379	2888.1379	R	A	76	105
PSM	SRSDNALHLASER	268	sp|Q7Z3G6|PRIC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=6269	34.698	3	1534.6889	1534.6889	R	E	693	706
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	269	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=8855	49.319	3	3112.5078	3112.5078	R	S	818	847
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	270	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=9124	50.849	3	3112.5078	3112.5078	R	S	818	847
PSM	TGASASFNSTDPSPEEPPAPSHPHTSSLGR	271	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=9038	50.401	3	3097.3415	3097.3415	R	R	729	759
PSM	TKPTQAAGPSSPQKPPTPEETK	272	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=4119	23.126	3	2436.0975	2436.0975	K	A	437	459
PSM	TPKDSPGIPPSANAHQLFR	273	sp|P51812|KS6A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=11131	63.036	3	2112.0154	2112.0154	K	G	365	384
PSM	TPPGPPPPDDDEDDPVPLPVSGDKEEDAPHR	274	sp|Q69YN4-4|VIR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=12420	71.726	3	3366.4565	3366.4565	R	E	184	215
PSM	VAHEPVAPPEDKESESEAK	275	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=4329	24.26	3	2127.9362	2127.9362	R	V	8	27
PSM	VGGSSVDLHR	276	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=4446	24.905	2	1105.4917	1105.4917	R	F	164	174
PSM	VHYRSPPLATGEPVDNLSPEER	277	sp|Q86U06-4|RBM23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=11743	67.079	3	2542.1853	2542.1853	R	D	108	130
PSM	VREEEIEVDSR	278	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5114	28.485	2	1359.663	1359.6630	R	V	628	639
PSM	YHGHSMSDPGVSYR	279	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3330	18.982	3	1687.645	1687.6450	R	T	258	272
PSM	YRHSDGNLCVK	280	sp|P49458-2|SRP09_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=2616	15.307	3	1427.6017	1427.6017	K	V	31	42
PSM	RESPSPAPKPR	281	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=665	5.622198333333333	2	1300.628776	1300.628900	K	K	448	459
PSM	CRNSIASCADEQPHIGNYR	282	sp|P27448|MARK3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	ms_run[1]:scan=11212	63.579915	3	2309.9309	2309.9302	R	L	39	58
PSM	KKEPAITSQNSPEAR	283	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:21	ms_run[1]:scan=2022	12.018223333333333	2	1735.818316	1734.830179	K	E	90	105
PSM	QERLSPEVAPPAHR	284	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=8097	44.93870166666667	2	1648.7723	1648.7717	K	R	31	45
PSM	QERLSPEVAPPAHR	285	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=5984	33.111554999999996	3	1650.7752	1648.7722	K	R	31	45
PSM	RVSHQGYSTEAEFEEPR	286	sp|P30533|AMRP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:21	ms_run[1]:scan=8400	46.63717833333333	2	2101.898292	2100.890213	R	V	240	257
PSM	ADDKETCFAEEGKK	287	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4	ms_run[2]:scan=2422	14.268	3	1626.7196	1626.7196	K	L	585	599
PSM	ADDKETCFAEEGKK	288	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4	ms_run[2]:scan=2418	14.248	2	1626.7196	1626.7196	K	L	585	599
PSM	AGDLLEDSPKRPK	289	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=5272	29.331	2	1504.7287	1504.7287	R	E	151	164
PSM	APSATSPSGQLPHHSSTQPLDLAPGR	290	sp|P0C7T5|ATX1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=11119	62.969	3	2688.2657	2688.2657	K	M	201	227
PSM	ASPGHSPHYFAASSPTSPNALPPAR	291	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=10907	61.643	3	2596.186	2596.1860	R	K	1847	1872
PSM	DQHHLGSPSR	292	sp|Q9H8M2|BRD9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=838	6.3198	2	1212.5037	1212.5037	R	L	560	570
PSM	DRDDEEAAPLLR	293	sp|P51798-2|CLCN7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8314	46.157	2	1398.6739	1398.6739	R	R	14	26
PSM	ERDHSPTPSVFNSDEER	294	sp|Q6UN15-3|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=7176	39.801	3	2080.8487	2080.8487	R	Y	414	431
PSM	ERDHSPTPSVFNSDEER	295	sp|Q6UN15-3|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=7547	41.84	3	2080.8487	2080.8487	R	Y	414	431
PSM	GPPSPPAPVMHSPSR	296	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5136	28.615	2	1608.712	1608.7120	R	K	221	236
PSM	GRNSATSADEQPHIGNYR	297	sp|Q7KZI7-10|MARK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=6207	34.353	3	2051.881	2051.8810	R	L	4	22
PSM	GRPPAEKLSPNPPK	298	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=4063	22.816	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPNLTK	299	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=8176	45.378	3	1894.9666	1894.9666	R	K	1411	1428
PSM	HEIVDTPPGPEHLQDK	300	sp|Q96S15-2|WDR24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=8768	48.822	2	1890.8513	1890.8513	R	A	576	592
PSM	HGSCDLENLHLR	301	sp|Q14586|ZN267_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=10207	57.3	3	1529.6446	1529.6446	R	K	103	115
PSM	HLEHAPSPSDVSNAPEVK	302	sp|Q9Y4C1|KDM3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=7886	43.73	3	1992.8942	1992.8942	K	A	439	457
PSM	HLQVNVTNPVQCSLHGK	303	sp|O94832|MYO1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=10201	57.274	3	2009.9506	2009.9506	R	K	959	976
PSM	HLSLHTEER	304	sp|Q17R98-3|ZN827_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=4115	23.105	2	1200.5289	1200.5289	R	K	485	494
PSM	HRPSPPATPPPK	305	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2340	13.801	3	1440.6316	1440.6316	R	T	399	411
PSM	IGHHSTSDDSSAYR	306	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=1696	10.255	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	307	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=2067	12.288	2	1611.6315	1611.6315	R	S	333	347
PSM	KAPPPPISPTQLSDVSSPR	308	sp|Q9P0K7-3|RAI14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:21	ms_run[2]:scan=11603	66.167	3	2053.0245	2053.0245	R	S	266	285
PSM	KASGPPVSELITK	309	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=10858	61.35	2	1405.7218	1405.7218	R	A	34	47
PSM	KHSEEAEFTPPLK	310	sp|Q3B726|RPA43_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=8863	49.355	2	1591.7283	1591.7283	R	C	314	327
PSM	KKSLLSAALAK	311	sp|Q8NEN9|PDZD8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=8786	48.933	2	1208.6894	1208.6894	R	S	1069	1080
PSM	KKSPNELVDDLFK	312	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=15275	93.556	2	1611.7909	1611.7909	R	G	112	125
PSM	KNSEPGSPHSLEALR	313	sp|Q9ULC5-3|ACSL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=7985	44.277	2	1700.7883	1700.7883	R	D	26	41
PSM	KPASPPLPATQQEKPSQTPEAGR	314	sp|Q6ZU35|K1211_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=6438	35.635	3	2494.2217	2494.2217	R	K	1039	1062
PSM	KPRPSEGDEDCLPASK	315	sp|P78346|RPP30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3537	20.057	3	1864.8026	1864.8026	K	K	247	263
PSM	KQSLGELIGTLNAAK	316	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=16649	104.49	2	1621.844	1621.8440	R	V	19	34
PSM	LGIHEDSQNR	317	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2120	12.529	2	1167.5632	1167.5632	K	K	447	457
PSM	LGSVTHVTSFSHAPPSSR	318	sp|P53814-2|SMTN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9267	51.664	2	1945.9047	1945.9047	R	G	65	83
PSM	LHQLSGSDQLESTAHSR	319	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=7533	41.767	3	1944.8691	1944.8691	K	I	179	196
PSM	LKSEDGVEGDLGETQSR	320	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=7983	44.27	3	1898.8259	1898.8259	R	T	133	150
PSM	LSVHDMKPLDSPGR	321	sp|Q15643|TRIPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5616	31.156	3	1646.7488	1646.7488	K	R	1881	1895
PSM	MGHAGAIIAGGK	322	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=2363	13.939	2	1097.5652	1097.5652	R	G	297	309
PSM	PSPTSPVKPSSPASKPDGPAELPLTDR	323	sp|Q13905-2|RPGF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=11284	64.053	3	2807.3743	2807.3743	R	E	174	201
PSM	QERLSPEVAPPAHR	324	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=6101	33.743	3	1665.7988	1665.7988	K	R	31	45
PSM	RASPSKPASAPASR	325	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=611	5.3851	2	1461.7089	1461.7089	K	S	512	526
PSM	RATREEPPGAPFAENTAER	326	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=8000	44.363	3	2177.9855	2177.9855	R	F	386	405
PSM	RGFEGSCSQKESEEGNPVR	327	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=4723	26.368	3	2231.9267	2231.9267	K	G	474	493
PSM	RGGHSSVSTESESSSFHSS	328	sp|P61073|CXCR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=3022	17.467	3	2030.7967	2030.7967	K	-	334	353
PSM	RHSTEGEEGDVSDVGSR	329	sp|Q8TF61|FBX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=3012	17.419	3	1895.7647	1895.7647	R	T	476	493
PSM	RHTSAEEEEPPPVK	330	sp|Q9BZ95-4|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=2388	14.085	3	1684.7458	1684.7458	R	I	391	405
PSM	RKASPEPPDSAEGALK	331	sp|Q9H1B7|I2BPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=4928	27.456	2	1731.8193	1731.8193	K	L	544	560
PSM	RLSSTSLASGHSVR	332	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=5285	29.393	3	1536.741	1536.7410	R	L	38	52
PSM	RMSDEFVDSFK	333	sp|Q92934|BAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=11741	67.067	2	1455.5741	1455.5741	R	K	116	127
PSM	RNSSEASSGDFLDLK	334	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12912	75.249	2	1704.7356	1704.7356	R	G	39	54
PSM	RPASVSSSAAVEHEQR	335	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=2943	17.082	2	1789.8108	1789.8108	K	E	237	253
PSM	RPILQLSPPGPR	336	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=12671	73.507	2	1409.7544	1409.7544	R	G	12	24
PSM	RPLSSSHEASEGQAK	337	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=986	6.9411	2	1662.7363	1662.7363	K	D	157	172
PSM	RRPESAPAESSPSK	338	sp|Q07889|SOS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=864	6.4199	3	1577.7199	1577.7199	R	I	1157	1171
PSM	RRPSDENTIAPSEVQK	339	sp|Q86W92-3|LIPB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=4486	25.127	3	1905.8946	1905.8946	R	W	638	654
PSM	RRPSDENTIAPSEVQK	340	sp|Q86W92-3|LIPB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=4493	25.158	2	1905.8946	1905.8946	R	W	638	654
PSM	RTSMGGTQQQFVEGVR	341	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7981	44.258	3	1875.8299	1875.8299	R	M	550	566
PSM	SEVQQPVHPKPLSPDSR	342	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=6414	35.491	3	1979.9466	1979.9466	K	A	350	367
PSM	SKPLAASPKPAGLK	343	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=4430	24.814	2	1443.7851	1443.7851	K	E	2265	2279
PSM	SPSPPLPTHIPPEPPR	344	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12326	71.015	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	345	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12744	74.048	3	1797.8815	1797.8815	R	T	326	342
PSM	SRSFEVTGQGLSHPK	346	sp|Q2TAC6|KIF19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=7605	42.161	3	1708.7934	1708.7934	R	T	893	908
PSM	SSGVSGGKPGLLPAHSR	347	sp|Q8IWB9|TEX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:21	ms_run[2]:scan=5672	31.452	3	1685.825	1685.8250	K	H	717	734
PSM	SSSPGKPQAVSSLNSSHSR	348	sp|Q9UHB7-2|AFF4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=3784	21.325	3	1991.9062	1991.9062	R	S	178	197
PSM	SSVVSPSHPPPAPPLGSPPGPK	349	sp|Q9Y6W5|WASF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=11422	64.969	3	2168.0667	2168.0667	R	P	292	314
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	350	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=9339	52.107	3	3112.5078	3112.5078	R	S	818	847
PSM	TGVLAHLEEER	351	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10126	56.846	2	1252.6412	1252.6412	R	D	772	783
PSM	VAHSDKPGSTSTASFR	352	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=2590	15.168	2	1726.7676	1726.7676	K	D	206	222
PSM	VQTPDKQPLRPLVPDASK	353	sp|Q9NR12-2|PDLI7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=10210	57.315	2	2068.0718	2068.0718	K	Q	94	112
PSM	YCRPESQEHPEADPGSAAPYLK	354	sp|P40763-3|STAT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=8182	45.416	3	2581.0945	2581.0945	K	T	686	708
PSM	YRHPSGGSNGATCSTQVSMLTR	355	sp|P32241-3|VIPR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,13-UNIMOD:4,19-UNIMOD:35	ms_run[2]:scan=6918	38.414	3	2462.0468	2462.0468	K	V	208	230
PSM	PHYTTFDGR	356	sp|Q9Y6R7|FCGBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=4728	26.392068333333334	2	1092.4984	1092.4983	D	R	478	487
PSM	KQPPKEPSEVPTPK	357	sp|P17096-2|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:21	ms_run[1]:scan=3471	19.705898333333334	3	1640.817173	1640.817489	R	R	31	45
PSM	RLSTSPDVIQGHQPR	358	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=7046	39.13805833333333	3	1770.842429	1769.857397	R	D	264	279
PSM	KASSEGGTAAGAGLDSLHK	359	sp|O15143|ARC1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:21	ms_run[1]:scan=6745	37.46889166666667	3	1836.878159	1835.841472	K	N	308	327
PSM	THVTRHAYEGSSSGNSSPEYPR	360	sp|Q9UMD9|COHA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	17-UNIMOD:21	ms_run[1]:scan=5203	28.95915833333333	3	2499.045926	2498.061195	K	K	102	124
PSM	ADDKETCFAEEGKK	361	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:4	ms_run[2]:scan=3152	18.124	3	1626.7196	1626.7196	K	L	585	599
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	362	sp|Q9BUJ2-5|HNRL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	26-UNIMOD:21	ms_run[2]:scan=10185	57.198	3	3407.6452	3407.6452	R	N	215	246
PSM	ATGNDLRPPPPSPSSDLTHPMK	363	sp|Q9P275|UBP36_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=8553	47.538	3	2410.0988	2410.0988	R	T	702	724
PSM	DLHQPSLSPASPHSQGFER	364	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=10026	56.256	3	2168.964	2168.9640	K	G	16	35
PSM	DPDAQPGGELMLGGTDSK	365	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35	ms_run[2]:scan=9688	54.225	2	1802.7993	1802.7993	R	Y	236	254
PSM	DRSSPPPGYIPDELHQVAR	366	sp|Q9Y2U5|M3K2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12789	74.356	3	2213.0266	2213.0266	R	N	161	180
PSM	DRSVPNLTEGSLHEPGR	367	sp|Q96NW4|ANR27_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10143	56.956	3	1942.8898	1942.8898	R	Q	960	977
PSM	DRTPPHLLYSDR	368	sp|Q8NDT2-2|RB15B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8746	48.703	3	1548.7086	1548.7086	R	D	203	215
PSM	EDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPR	369	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	31-UNIMOD:21	ms_run[2]:scan=10218	57.353	3	3548.6573	3548.6573	R	G	970	1004
PSM	ERSPALKSPLQSVVVR	370	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12531	72.529	3	1844.9873	1844.9873	R	R	246	262
PSM	ERTESEVPPRPASPK	371	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=3219	18.44	2	1758.8302	1758.8302	K	V	532	547
PSM	ERTESEVPPRPASPK	372	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=3624	20.475	2	1758.8302	1758.8302	K	V	532	547
PSM	FGSADNIAHLK	373	sp|O75069-4|TMCC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10220	57.361	2	1251.5649	1251.5649	K	D	105	116
PSM	GIRPFPSEETTENDDDVYR	374	sp|P52735-3|VAV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11372	64.62	3	2239.0029	2239.0029	K	S	125	144
PSM	GLAHPPSYSNPPVYHGNSPK	375	sp|Q92738|US6NL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	18-UNIMOD:21	ms_run[2]:scan=8763	48.799	3	2197.9946	2197.9946	R	H	625	645
PSM	GPPSPPAPVMHSPSR	376	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5331	29.623	2	1608.712	1608.7120	R	K	221	236
PSM	GRPPAEKLSPNPPNLTK	377	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=7999	44.359	3	1894.9666	1894.9666	R	K	1411	1428
PSM	GSPKPSPQPSPKPSPK	378	sp|P29536-2|LMOD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=952	6.7814	2	1694.8393	1694.8393	K	N	479	495
PSM	GVGHEFQKVSVDK	379	sp|Q6GYQ0-3|RGPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=6321	34.978	3	1508.7025	1508.7025	K	S	702	715
PSM	HADHSSLTLGSGSSTTR	380	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=4326	24.242	3	1792.7741	1792.7741	R	L	2522	2539
PSM	HAQRSPEASQTDSPVESPR	381	sp|O95049-5|ZO3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=3336	19.007	3	2157.944	2157.9440	R	L	279	298
PSM	HHNSTAELQK	382	sp|P33527-8|MRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=722	5.8491	2	1243.5347	1243.5347	R	A	812	822
PSM	HRPSEADEEELAR	383	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=4471	25.028	2	1617.6784	1617.6784	K	R	486	499
PSM	HRPSPPATPPPK	384	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1338	8.5352	2	1440.6316	1440.6316	R	T	399	411
PSM	HRPSPPATPPPK	385	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1756	10.561	2	1440.6316	1440.6316	R	T	399	411
PSM	HRPSPPATPPPK	386	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1947	11.578	2	1440.6316	1440.6316	R	T	399	411
PSM	IACRSPQPDPVGTPTIFKPQSK	387	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=11773	67.273	3	2503.2294	2503.2294	K	R	1859	1881
PSM	IHIDPEIQDGSPTTSR	388	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=9944	55.732	2	1844.8306	1844.8306	R	R	102	118
PSM	KHDSGAADLER	389	sp|Q9NX55-3|HYPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=1340	8.5423	2	1277.5401	1277.5401	R	V	35	46
PSM	KHSQTDLVSR	390	sp|O14683|P5I11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1825	10.937	3	1249.5816	1249.5816	K	L	12	22
PSM	KHSQTDLVSR	391	sp|O14683|P5I11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2092	12.397	2	1249.5816	1249.5816	K	L	12	22
PSM	KKDELSDYAEK	392	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=4413	24.728	2	1404.6174	1404.6174	K	S	988	999
PSM	KKEPAITSQNSPEAR	393	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=1714	10.351	3	1734.8302	1734.8302	K	E	69	84
PSM	KKEPAITSQNSPEAR	394	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=1908	11.363	3	1734.8302	1734.8302	K	E	69	84
PSM	KKPGDASSLPDAGLSPGSQVDSK	395	sp|Q13459-2|MYO9B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21	ms_run[2]:scan=9130	50.886	2	2320.0948	2320.0948	K	S	1391	1414
PSM	KLEGGQQVGMHSK	396	sp|Q8TD19|NEK9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=842	6.3321	2	1493.6698	1493.6698	K	G	933	946
PSM	KLQLERPVSPETQADLQR	397	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=10553	59.444	3	2187.1049	2187.1049	R	N	921	939
PSM	KNQKPSQVNGAPGSPTEPAGQK	398	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=2351	13.862	3	2299.0958	2299.0958	K	Q	1254	1276
PSM	KNSEPGSPHSLEALR	399	sp|Q9ULC5-3|ACSL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=7906	43.835	3	1700.7883	1700.7883	R	D	26	41
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	400	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=12927	75.345	3	2662.3156	2662.3156	K	K	763	788
PSM	KPSREDDLLAPK	401	sp|Q9NP71-5|MLXPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=5633	31.246	3	1447.7072	1447.7072	R	Q	194	206
PSM	KQPPKEPSEVPTPK	402	sp|P17096-2|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=3515	19.949	3	1640.8175	1640.8175	R	R	31	45
PSM	KRDSDAGSSTPTTSTR	403	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=636	5.4951	2	1745.7581	1745.7581	R	S	1381	1397
PSM	KRLSQSDEDVIR	404	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=5177	28.834	2	1524.7297	1524.7297	K	L	118	130
PSM	KRNSVDSDLK	405	sp|Q8IX21|SLF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=1263	8.1441	2	1240.5813	1240.5813	R	S	337	347
PSM	KRPASLSTAPSEK	406	sp|Q9UPN4-2|CP131_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=2003	11.903	2	1450.7181	1450.7181	K	G	110	123
PSM	KRSPSPSPTPEAK	407	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=778	6.0733	2	1460.7025	1460.7025	R	K	300	313
PSM	KSPSGPVKSPPLSPVGTTPVK	408	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=9515	53.197	3	2139.1341	2139.1341	R	L	177	198
PSM	KTPSKPPAQLSPSVPK	409	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=6669	37.039	2	1740.9175	1740.9175	K	R	256	272
PSM	LSVHDMKPLDSPGR	410	sp|Q15643|TRIPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5489	30.489	2	1646.7488	1646.7488	K	R	1881	1895
PSM	MLHRDSTISNESSQSCSSGR	411	sp|Q2NKQ1-4|SGSM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,6-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=2465	14.48	3	2333.9366	2333.9366	R	Q	641	661
PSM	NAIHTFVQSGSHLAAR	412	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=10169	57.108	3	1787.8468	1787.8468	K	E	507	523
PSM	NFTKPQDGDVIAPLITPQKK	413	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=12924	75.325	3	2289.177	2289.1770	R	E	507	527
PSM	NVAEALGHSPKDPGGGGGPVR	414	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=7571	41.989	3	2050.9586	2050.9586	K	A	428	449
PSM	RAPSVANVGSHCDLSLK	415	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9721	54.402	2	1889.8819	1889.8819	R	I	2141	2158
PSM	RFDGDELTTDER	416	sp|O43149|ZZEF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7061	39.214	2	1452.6481	1452.6481	K	I	2502	2514
PSM	RGDDSFGDK	417	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1123	7.5471	2	995.43084	995.4308	R	Y	176	185
PSM	RHSFMSTEPLSAEASLSSDSQR	418	sp|Q59EK9-2|RUN3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=11081	62.731	3	2518.0795	2518.0795	R	L	359	381
PSM	RIQLVEEELDR	419	sp|P09493-2|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11525	65.637	2	1398.7467	1398.7467	R	A	35	46
PSM	RKESSNTDSAGALGTLR	420	sp|P29474|NOS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=6859	38.096	3	1841.8633	1841.8633	K	F	630	647
PSM	RKPSPEPEGEVGPPK	421	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=3961	22.249	2	1682.8029	1682.8029	K	I	341	356
PSM	RKPSPEPEGEVGPPK	422	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=4341	24.322	2	1682.8029	1682.8029	K	I	341	356
PSM	RKSELEFETLK	423	sp|Q5JSH3-4|WDR44_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=9999	56.088	3	1458.712	1458.7120	K	T	235	246
PSM	RKSQDSVLDPAER	424	sp|Q9UPN3|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=4910	27.379	3	1579.7355	1579.7355	K	A	55	68
PSM	RLEISPDSSPER	425	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=7520	41.702	2	1544.6273	1544.6273	R	A	147	159
PSM	RLIDSSGSASVLTHSSSGNSLK	426	sp|Q96SU4-5|OSBL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=10276	57.686	3	2282.0904	2282.0904	K	R	132	154
PSM	RLSSASTGKPPLSVEDDFEK	427	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12255	70.543	3	2242.0519	2242.0519	R	L	756	776
PSM	RLSSTSLASGHSVR	428	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=6110	33.792	3	1536.741	1536.7410	R	L	38	52
PSM	RLSTSPDVIQGHQPR	429	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=7130	39.58	3	1769.8574	1769.8574	R	D	264	279
PSM	RRDSDGVDGFEAEGK	430	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=5816	32.222	2	1716.7105	1716.7105	R	K	1051	1066
PSM	RRSIYDTVTDTEMVEK	431	sp|Q6PIF6-2|MYO7B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=9226	51.436	3	2037.9078	2037.9078	K	V	902	918
PSM	RSFSKEVEER	432	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=4620	25.835	2	1345.6027	1345.6027	K	S	988	998
PSM	RSSLPLDHGSPAQENPESEK	433	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=7439	41.237	3	2257.0012	2257.0012	R	S	1276	1296
PSM	RTKTEISEMNR	434	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=744	5.9399	2	1459.649	1459.6490	R	N	302	313
PSM	RVIENADGSEEETDTR	435	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=3457	19.629	3	1899.7847	1899.7847	R	D	1946	1962
PSM	RVSLEPHQGPGTPESK	436	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=5238	29.17	3	1797.8411	1797.8411	K	K	853	869
PSM	SATASPQLSHHSLR	437	sp|Q9BX66-3|SRBS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=4244	23.824	2	1570.7253	1570.7253	R	A	800	814
PSM	SGHHPGETPPLITPGSAQS	438	sp|Q14802|FXYD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=9427	52.669	2	1948.868	1948.8680	K	-	69	88
PSM	SRTSVQTEDDQLIAGQSAR	439	sp|P35221-3|CTNA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=8837	49.234	3	2140.975	2140.9750	R	A	282	301
PSM	STAQQELDGKPASPTPVIVASHTANK	440	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=9860	55.199	3	2726.3276	2726.3276	R	E	818	844
PSM	STSATDTHHVEMAR	441	sp|O14874-2|BCKD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=1008	7.033	2	1637.6505	1637.6505	R	E	31	45
PSM	THPTLHDSER	442	sp|Q8N4S9-2|MALD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=1213	7.9179	2	1271.5296	1271.5296	R	A	30	40
PSM	TILETSFHQHR	443	sp|Q5M775-5|CYTSB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=7992	44.316	2	1447.6609	1447.6609	K	E	339	350
PSM	VHAYFAPVTPPPSVGGSR	444	sp|Q96IG2-2|FXL20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=12877	74.999	2	1917.9138	1917.9138	K	Q	377	395
PSM	VHIEIGPDGR	445	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7557	41.899	2	1091.5724	1091.5724	R	V	317	327
PSM	VPEGPGAHEEVLPGDVR	446	sp|P22105-1|TENX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9434	52.717	3	1756.8744	1756.8744	R	Q	997	1014
PSM	VPKSPEHSAEPIR	447	sp|Q9ULH0-2|KDIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=3148	18.105	3	1525.729	1525.7290	R	T	1453	1466
PSM	VRDSTLHLK	448	sp|Q14571|ITPR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=4171	23.425	2	1147.5751	1147.5751	R	E	1852	1861
PSM	YHSVSTETPHER	449	sp|Q86TI0-2|TBCD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2112	12.486	2	1521.6249	1521.6249	R	N	625	637
PSM	ETPHSPGVEDAPIAK	450	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:21	ms_run[1]:scan=6657	36.97690166666666	2	1626.729191	1626.729068	R	V	486	501
PSM	THTTALAGRSPSPASGR	451	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=2637	15.417155	3	1825.789388	1825.787342	K	R	286	303
PSM	VGAHAGEYGAEALER	452	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=7653	42.42093	3	1528.727157	1528.727020	K	M	18	33
PSM	NRTSVHVPLEAR	453	sp|Q8WU20|FRS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	3-UNIMOD:21	ms_run[1]:scan=7462	41.36906333333334	2	1457.7221	1457.7135	K	V	208	220
PSM	ESSSHHPGIAEFPSR	454	sp|P02671|FIBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:27,2-UNIMOD:21	ms_run[1]:scan=7830	43.43798666666667	3	1698.7130	1698.7146	K	G	559	574
PSM	KVDGISHTSALAPVASSPK	455	sp|E9PAV3|NACAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	17-UNIMOD:21	ms_run[1]:scan=8098	44.94267833333333	3	1944.968459	1943.971758	K	E	750	769
PSM	QLSSGVSEIR	456	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=9279	51.732686666666666	2	1057.5402	1057.5399	R	H	80	90
PSM	SGSPAPPEPVDPSLGLR	457	sp|O94812|BAIP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:21	ms_run[1]:scan=7163	39.730225	3	1755.848045	1754.824031	R	A	113	130
PSM	KKDEGSYDLGER	458	sp|P34741|SDC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:21	ms_run[1]:scan=3501	19.884161666666667	3	1475.631116	1475.629354	R	K	173	185
PSM	MGHAGAIIAGGK	459	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35	ms_run[1]:scan=2428	14.301281666666668	2	1097.565154	1097.565164	R	G	297	309
PSM	LQHYTSGHMTPGMK	460	sp|P29323|EPHB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:21,9-UNIMOD:35,13-UNIMOD:35	ms_run[1]:scan=1799	10.80615	2	1698.689137	1698.689529	K	I	581	595