MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_NT_JPST000210
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\121026_CRC_N_Fr18.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\121026_CRC_N_Fr18.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P08294|SODE_HUMAN	Extracellular superoxide dismutase [Cu-Zn] OS=Homo sapiens OX=9606 GN=SOD3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null	63-UNIMOD:4	0.11	43.0	1	1	1
PRT	sp|Q9NPI6|DCP1A_HUMAN	mRNA-decapping enzyme 1A OS=Homo sapiens OX=9606 GN=DCP1A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38.0	null	351-UNIMOD:28,353-UNIMOD:21	0.05	38.0	1	1	1
PRT	sp|Q6PKG0|LARP1_HUMAN	La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37.0	null	1040-UNIMOD:21	0.01	37.0	1	1	0
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	262-UNIMOD:21,260-UNIMOD:21	0.04	36.0	2	1	0
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	596-UNIMOD:21	0.04	36.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	963-UNIMOD:21	0.01	36.0	2	1	0
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	266-UNIMOD:21	0.05	36.0	2	1	0
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4,302-UNIMOD:4,303-UNIMOD:4,591-UNIMOD:4	0.10	36.0	8	5	4
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36.0	null	145-UNIMOD:28,160-UNIMOD:21	0.07	36.0	1	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	139-UNIMOD:4	0.09	35.0	2	1	0
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	1278-UNIMOD:21	0.00	35.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	321-UNIMOD:35,330-UNIMOD:21,328-UNIMOD:21	0.06	35.0	9	1	0
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	43-UNIMOD:21	0.05	35.0	9	1	0
PRT	sp|Q6XZF7-2|DNMBP_HUMAN	Isoform 2 of Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	617-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|Q8WU39-3|MZB1_HUMAN	Isoform 3 of Marginal zone B- and B1-cell-specific protein OS=Homo sapiens OX=9606 GN=MZB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	51-UNIMOD:4	0.24	35.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	107-UNIMOD:21	0.12	34.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	2	2	2
PRT	sp|O00712-6|NFIB_HUMAN	Isoform 6 of Nuclear factor 1 B-type OS=Homo sapiens OX=9606 GN=NFIB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	76-UNIMOD:21,80-UNIMOD:21	0.06	33.0	3	1	0
PRT	sp|Q5VUB5|F1711_HUMAN	Protein FAM171A1 OS=Homo sapiens OX=9606 GN=FAM171A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	371-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P98174|FGD1_HUMAN	FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	48-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	1954-UNIMOD:21,1597-UNIMOD:28	0.03	33.0	4	3	2
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	681-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	781-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1010-UNIMOD:21	0.03	32.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	483-UNIMOD:21,487-UNIMOD:35,486-UNIMOD:21	0.03	32.0	5	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	2716-UNIMOD:28,2718-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q9ULV0|MYO5B_HUMAN	Unconventional myosin-Vb OS=Homo sapiens OX=9606 GN=MYO5B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	602-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|O95831-5|AIFM1_HUMAN	Isoform 5 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.07	31.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	34-UNIMOD:21	0.02	31.0	2	1	0
PRT	sp|Q9Y6R1-3|S4A4_HUMAN	Isoform 3 of Electrogenic sodium bicarbonate cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC4A4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	211-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|O43665-3|RGS10_HUMAN	Isoform 3 of Regulator of G-protein signaling 10 OS=Homo sapiens OX=9606 GN=RGS10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	16-UNIMOD:21	0.12	31.0	2	1	0
PRT	sp|Q7Z5N4-3|SDK1_HUMAN	Isoform 3 of Protein sidekick-1 OS=Homo sapiens OX=9606 GN=SDK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	2077-UNIMOD:21,2082-UNIMOD:4	0.01	31.0	2	1	0
PRT	sp|Q01085|TIAR_HUMAN	Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	922-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9P0J7|KCMF1_HUMAN	E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	171-UNIMOD:35,189-UNIMOD:21	0.07	30.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	362-UNIMOD:35,363-UNIMOD:21	0.01	30.0	4	1	0
PRT	sp|Q8N4C8-4|MINK1_HUMAN	Isoform 4 of Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	555-UNIMOD:21,568-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	830-UNIMOD:21	0.03	30.0	3	1	0
PRT	sp|Q9P1Y5|CAMP3_HUMAN	Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	799-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	168-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|Q9UIS9|MBD1_HUMAN	Methyl-CpG-binding domain protein 1 OS=Homo sapiens OX=9606 GN=MBD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	297-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	242-UNIMOD:21	0.08	29.0	3	1	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	802-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|O95757|HS74L_HUMAN	Heat shock 70 kDa protein 4L OS=Homo sapiens OX=9606 GN=HSPA4L PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	540-UNIMOD:4,545-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	246-UNIMOD:35	0.05	29.0	1	1	1
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	76-UNIMOD:21	0.05	29.0	2	1	0
PRT	sp|P25325|THTM_HUMAN	3-mercaptopyruvate sulfurtransferase OS=Homo sapiens OX=9606 GN=MPST PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	65-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|Q53GD3-4|CTL4_HUMAN	Isoform 4 of Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	2	1	0
PRT	sp|O75791-2|GRAP2_HUMAN	Isoform 2 of GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	149-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|Q00587-2|BORG5_HUMAN	Isoform 2 of Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	34-UNIMOD:21,37-UNIMOD:35	0.04	29.0	1	1	1
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	331-UNIMOD:21,341-UNIMOD:35,163-UNIMOD:21	0.07	29.0	3	2	1
PRT	sp|Q96JN8-2|NEUL4_HUMAN	Isoform 2 of Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	905-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q14185|DOCK1_HUMAN	Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	2191-UNIMOD:4,2144-UNIMOD:21,2152-UNIMOD:4	0.01	29.0	2	2	2
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	263-UNIMOD:35,269-UNIMOD:21,262-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	29.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	167-UNIMOD:28,186-UNIMOD:21,181-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|Q14686|NCOA6_HUMAN	Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	2018-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	138-UNIMOD:21	0.08	28.0	1	1	1
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	181-UNIMOD:4	0.07	28.0	3	1	0
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	613-UNIMOD:21,614-UNIMOD:21	0.03	28.0	3	2	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	337-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null		0.02	28.0	3	2	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	297-UNIMOD:35	0.04	28.0	1	1	1
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	88-UNIMOD:21	0.09	28.0	1	1	0
PRT	sp|Q9C0H9|SRCN1_HUMAN	SRC kinase signaling inhibitor 1 OS=Homo sapiens OX=9606 GN=SRCIN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	45-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|P10645|CMGA_HUMAN	Chromogranin-A OS=Homo sapiens OX=9606 GN=CHGA PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	372-UNIMOD:35	0.04	28.0	1	1	1
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	328-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	309-UNIMOD:21,307-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|P51151|RAB9A_HUMAN	Ras-related protein Rab-9A OS=Homo sapiens OX=9606 GN=RAB9A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	179-UNIMOD:21	0.11	28.0	1	1	1
PRT	sp|P12111-4|CO6A3_HUMAN	Isoform 4 of Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|P00387|NB5R3_HUMAN	NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	204-UNIMOD:4	0.06	28.0	1	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q8N3V7|SYNPO_HUMAN	Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28.0	null	806-UNIMOD:28,819-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q01970|PLCB3_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	474-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q15223|NECT1_HUMAN	Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	412-UNIMOD:35,422-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|Q99795|GPA33_HUMAN	Cell surface A33 antigen OS=Homo sapiens OX=9606 GN=GPA33 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|O75808|CAN15_HUMAN	Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1070-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	723-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P52746|ZN142_HUMAN	Zinc finger protein 142 OS=Homo sapiens OX=9606 GN=ZNF142 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1319-UNIMOD:21,1330-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|P05771-2|KPCB_HUMAN	Isoform Beta-II of Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	641-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	489-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	211-UNIMOD:21	0.10	27.0	4	1	0
PRT	sp|Q9Y2B5|VP9D1_HUMAN	VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=VPS9D1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	330-UNIMOD:21,333-UNIMOD:4,334-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|O60244|MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1124-UNIMOD:35,1127-UNIMOD:35,1136-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	151-UNIMOD:21,155-UNIMOD:21	0.04	27.0	2	1	0
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	135-UNIMOD:21,112-UNIMOD:21	0.17	27.0	2	2	2
PRT	sp|Q8N5C8-2|TAB3_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	102-UNIMOD:21,103-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	97-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|Q53GD3|CTL4_HUMAN	Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	5-UNIMOD:28	0.02	27.0	1	1	0
PRT	sp|Q8TEH3|DEN1A_HUMAN	DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	707-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|O75128-3|COBL_HUMAN	Isoform 3 of Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	347-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|O75955-2|FLOT1_HUMAN	Isoform 2 of Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9BR39|JPH2_HUMAN	Junctophilin-2 OS=Homo sapiens OX=9606 GN=JPH2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	469-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|Q93074-3|MED12_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	635-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P12110-3|CO6A2_HUMAN	Isoform 2C2A' of Collagen alpha-2(VI) chain OS=Homo sapiens OX=9606 GN=COL6A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	777-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1690-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q96RU3-5|FNBP1_HUMAN	Isoform 5 of Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	331-UNIMOD:35,359-UNIMOD:21	0.05	26.0	2	1	0
PRT	sp|Q9GZY8-4|MFF_HUMAN	Isoform 4 of Mitochondrial fission factor OS=Homo sapiens OX=9606 GN=MFF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	89-UNIMOD:21	0.11	26.0	1	1	1
PRT	sp|Q8IXJ6-5|SIR2_HUMAN	Isoform 5 of NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens OX=9606 GN=SIRT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	296-UNIMOD:21,294-UNIMOD:21	0.08	26.0	2	1	0
PRT	sp|Q8N4Y2|EFC4A_HUMAN	EF-hand calcium-binding domain-containing protein 4A OS=Homo sapiens OX=9606 GN=CRACR2B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	392-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q6IQ26-2|DEN5A_HUMAN	Isoform 2 of DENN domain-containing protein 5A OS=Homo sapiens OX=9606 GN=DENND5A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	851-UNIMOD:21,857-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|Q6ZUT9|DEN5B_HUMAN	DENN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=DENND5B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	833-UNIMOD:21,838-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|Q12809-2|KCNH2_HUMAN	Isoform B of Potassium voltage-gated channel subfamily H member 2 OS=Homo sapiens OX=9606 GN=KCNH2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	797-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q6ZRI8-4|RHG36_HUMAN	Isoform 4 of Rho GTPase-activating protein 36 OS=Homo sapiens OX=9606 GN=ARHGAP36	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	21-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|O95544|NADK_HUMAN	NAD kinase OS=Homo sapiens OX=9606 GN=NADK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	64-UNIMOD:21,69-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9NYF8-4|BCLF1_HUMAN	Isoform 4 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	285-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	264-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|O75382-4|TRIM3_HUMAN	Isoform 4 of Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	308-UNIMOD:21,318-UNIMOD:21	0.05	25.0	6	2	1
PRT	sp|Q3V6T2-5|GRDN_HUMAN	Isoform 5 of Girdin OS=Homo sapiens OX=9606 GN=CCDC88A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	233-UNIMOD:21,235-UNIMOD:4,240-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q8NDT2-2|RB15B_HUMAN	Isoform 2 of Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	205-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	502-UNIMOD:21,507-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|P78316-2|NOP14_HUMAN	Isoform 2 of Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	312-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q03989-5|ARI5A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	245-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|P11171-4|41_HUMAN	Isoform 4 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	425-UNIMOD:35,432-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	79-UNIMOD:21	0.06	25.0	2	1	0
PRT	sp|Q9NQT8|KI13B_HUMAN	Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	732-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	510-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9BQI5|SGIP1_HUMAN	SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	247-UNIMOD:21	0.02	25.0	4	1	0
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	300-UNIMOD:21,210-UNIMOD:21	0.10	25.0	2	2	2
PRT	sp|Q8NFM4-2|ADCY4_HUMAN	Isoform 2 of Adenylate cyclase type 4 OS=Homo sapiens OX=9606 GN=ADCY4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	198-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q13595-3|TRA2A_HUMAN	Isoform 3 of Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	101-UNIMOD:21,108-UNIMOD:35	0.08	25.0	1	1	1
PRT	sp|O15021-2|MAST4_HUMAN	Isoform 2 of Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=MAST4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1456-UNIMOD:4,1458-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8TAA9-2|VANG1_HUMAN	Isoform 2 of Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	336-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|O95613-2|PCNT_HUMAN	Isoform 2 of Pericentrin OS=Homo sapiens OX=9606 GN=PCNT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1696-UNIMOD:21	0.00	25.0	2	1	0
PRT	sp|Q00G26|PLIN5_HUMAN	Perilipin-5 OS=Homo sapiens OX=9606 GN=PLIN5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	277-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	285-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	296-UNIMOD:21	0.05	25.0	2	1	0
PRT	sp|Q15418-3|KS6A1_HUMAN	Isoform 3 of Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	271-UNIMOD:21	0.03	25.0	3	1	0
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	167-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	2	1	0
PRT	sp|Q9UMS6|SYNP2_HUMAN	Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	753-UNIMOD:28,755-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q717R9|CYS1_HUMAN	Cystin-1 OS=Homo sapiens OX=9606 GN=CYS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	17-UNIMOD:21	0.14	25.0	1	1	1
PRT	sp|A6ND36|FA83G_HUMAN	Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	25.0	null	634-UNIMOD:21	0.02	25.0	5	1	0
PRT	sp|Q9HC78|ZBT20_HUMAN	Zinc finger and BTB domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZBTB20 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	695-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9NW97|TMM51_HUMAN	Transmembrane protein 51 OS=Homo sapiens OX=9606 GN=TMEM51 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	93-UNIMOD:28,115-UNIMOD:21	0.15	25.0	1	1	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	257-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q8N3E9|PLCD3_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-3 OS=Homo sapiens OX=9606 GN=PLCD3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	105-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q96FF7|MISP3_HUMAN	Uncharacterized protein MISP3 OS=Homo sapiens OX=9606 GN=MISP3 PE=2 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	91-UNIMOD:21	0.06	24.0	3	1	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P61224-4|RAP1B_HUMAN	Isoform 4 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	69-UNIMOD:35	0.10	24.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	418-UNIMOD:4,422-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q6ZTN6-2|AN13D_HUMAN	Isoform 2 of Ankyrin repeat domain-containing protein 13D OS=Homo sapiens OX=9606 GN=ANKRD13D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	206-UNIMOD:21	0.09	24.0	1	1	1
PRT	sp|Q9H5N1-2|RABE2_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 2 OS=Homo sapiens OX=9606 GN=RABEP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	200-UNIMOD:21,193-UNIMOD:21	0.03	24.0	3	1	0
PRT	sp|P00915|CAH1_HUMAN	Carbonic anhydrase 1 OS=Homo sapiens OX=9606 GN=CA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P51178|PLCD1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens OX=9606 GN=PLCD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	134-UNIMOD:21,135-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|O15061-2|SYNEM_HUMAN	Isoform 2 of Synemin OS=Homo sapiens OX=9606 GN=SYNM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	936-UNIMOD:21,937-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q9Y6M7-11|S4A7_HUMAN	Isoform 11 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	437-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	798-UNIMOD:21,878-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	202-UNIMOD:21	0.11	24.0	1	1	1
PRT	sp|Q16566|KCC4_HUMAN	Calcium/calmodulin-dependent protein kinase type IV OS=Homo sapiens OX=9606 GN=CAMK4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	348-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	436-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q92888-2|ARHG1_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	743-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q13946-3|PDE7A_HUMAN	Isoform PDE7A3 of High affinity cAMP-specific 3',5'-cyclic phosphodiesterase 7A OS=Homo sapiens OX=9606 GN=PDE7A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	84-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	682-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O94875-9|SRBS2_HUMAN	Isoform 9 of Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	330-UNIMOD:21	0.02	24.0	4	1	0
PRT	sp|Q92615|LAR4B_HUMAN	La-related protein 4B OS=Homo sapiens OX=9606 GN=LARP4B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	718-UNIMOD:21,722-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|A1L390-2|PKHG3_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	274-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9NQC3-5|RTN4_HUMAN	Isoform 5 of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	182-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q9Y3X0|CCDC9_HUMAN	Coiled-coil domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CCDC9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	202-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q13574|DGKZ_HUMAN	Diacylglycerol kinase zeta OS=Homo sapiens OX=9606 GN=DGKZ PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	37-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q14289-2|FAK2_HUMAN	Isoform 2 of Protein-tyrosine kinase 2-beta OS=Homo sapiens OX=9606 GN=PTK2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	797-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q96F45-3|ZN503_HUMAN	Isoform 3 of Zinc finger protein 503 OS=Homo sapiens OX=9606 GN=ZNF503	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	102-UNIMOD:21	0.10	24.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	369-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|O95674|CDS2_HUMAN	Phosphatidate cytidylyltransferase 2 OS=Homo sapiens OX=9606 GN=CDS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	21-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q14814-6|MEF2D_HUMAN	Isoform MEF2D00 of Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	205-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	260-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	226-UNIMOD:21	0.03	24.0	4	1	0
PRT	sp|Q8N5C8|TAB3_HUMAN	TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	103-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q5TC79|ZBT37_HUMAN	Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	455-UNIMOD:4,465-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q14202|ZMYM3_HUMAN	Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	817-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q92766|RREB1_HUMAN	Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	175-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q8TAD8|SNIP1_HUMAN	Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	49-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	366-UNIMOD:21	0.05	24.0	3	2	1
PRT	sp|Q8IVE3|PKHH2_HUMAN	Pleckstrin homology domain-containing family H member 2 OS=Homo sapiens OX=9606 GN=PLEKHH2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1458-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q14669|TRIPC_HUMAN	E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	100-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	91-UNIMOD:21,108-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1233-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|O75140-6|DEPD5_HUMAN	Isoform 6 of GATOR complex protein DEPDC5 OS=Homo sapiens OX=9606 GN=DEPDC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	579-UNIMOD:21,583-UNIMOD:35	0.01	23.0	2	1	0
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	575-UNIMOD:21	0.01	23.0	4	1	0
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1377-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2536-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|Q8IZQ1-2|WDFY3_HUMAN	Isoform 2 of WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens OX=9606 GN=WDFY3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	818-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	254-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9NRF2-2|SH2B1_HUMAN	Isoform 2 of SH2B adapter protein 1 OS=Homo sapiens OX=9606 GN=SH2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	580-UNIMOD:21,587-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|P53365-3|ARFP2_HUMAN	Isoform 3 of Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	38-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q6ZSZ5-2|ARHGI_HUMAN	Isoform 4 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	972-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q8TE67-2|ES8L3_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	214-UNIMOD:21,229-UNIMOD:21	0.07	23.0	2	2	2
PRT	sp|Q6NZ36-5|FAP20_HUMAN	Isoform 5 of Fanconi anemia core complex-associated protein 20 OS=Homo sapiens OX=9606 GN=FAAP20	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	113-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|Q13563-2|PKD2_HUMAN	Isoform 2 of Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	164-UNIMOD:4,166-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P21860-5|ERBB3_HUMAN	Isoform 5 of Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens OX=9606 GN=ERBB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	339-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	450-UNIMOD:21,718-UNIMOD:21,402-UNIMOD:21,406-UNIMOD:21	0.04	23.0	3	3	3
PRT	sp|P57059|SIK1_HUMAN	Serine/threonine-protein kinase SIK1 OS=Homo sapiens OX=9606 GN=SIK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	473-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q5T8P6-3|RBM26_HUMAN	Isoform 3 of RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	127-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	635-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	41-UNIMOD:21,42-UNIMOD:21	0.15	23.0	2	1	0
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	243-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q6ZNC8-2|MBOA1_HUMAN	Isoform 2 of Lysophospholipid acyltransferase 1 OS=Homo sapiens OX=9606 GN=MBOAT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	339-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1167-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9NP64-2|NO40_HUMAN	Isoform 2 of Nucleolar protein of 40 kDa OS=Homo sapiens OX=9606 GN=ZCCHC17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	90-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	11-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q9UHD1|CHRD1_HUMAN	Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	47-UNIMOD:21,59-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	552-UNIMOD:21,553-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	448-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q13546-2|RIPK1_HUMAN	Isoform 2 of Receptor-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=RIPK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	370-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9UI08-4|EVL_HUMAN	Isoform 4 of Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	331-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	604-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.11	23.0	2	1	0
PRT	sp|Q9BUJ2|HNRL1_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	718-UNIMOD:21	0.04	23.0	1	1	0
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	2289-UNIMOD:4,2295-UNIMOD:4,2302-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	706-UNIMOD:21,709-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q05D32|CTSL2_HUMAN	CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	104-UNIMOD:21,115-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	619-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1177-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q96F24-3|NRBF2_HUMAN	Isoform 3 of Nuclear receptor-binding factor 2 OS=Homo sapiens OX=9606 GN=NRBF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	103-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|Q8IVH8-3|M4K3_HUMAN	Isoform 3 of Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP4K3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1419-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O75427|LRCH4_HUMAN	Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRCH4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	275-UNIMOD:21,283-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|Q15366-6|PCBP2_HUMAN	Isoform 6 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	184-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q96S15-2|WDR24_HUMAN	Isoform 2 of GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	581-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	2240-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|Q96A22|CK052_HUMAN	Uncharacterized protein C11orf52 OS=Homo sapiens OX=9606 GN=C11orf52 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	101-UNIMOD:21	0.12	22.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=HIST1H1C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	36-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q9UHI5|LAT2_HUMAN	Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	29-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O14683|P5I11_HUMAN	Tumor protein p53-inducible protein 11 OS=Homo sapiens OX=9606 GN=TP53I11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	14-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	929-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	37-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	390-UNIMOD:21,395-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	455-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P08575-4|PTPRC_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens OX=9606 GN=PTPRC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	814-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9Y4F1|FARP1_HUMAN	FERM, ARHGEF and pleckstrin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FARP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1042-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P51116|FXR2_HUMAN	Fragile X mental retardation syndrome-related protein 2 OS=Homo sapiens OX=9606 GN=FXR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	192-UNIMOD:21,197-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q5T0W9|FA83B_HUMAN	Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	389-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q8N4C6-4|NIN_HUMAN	Isoform 4 of Ninein OS=Homo sapiens OX=9606 GN=NIN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1128-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q8TER5-2|ARH40_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	247-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q5JSL3|DOC11_HUMAN	Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	12-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P11678|PERE_HUMAN	Eosinophil peroxidase OS=Homo sapiens OX=9606 GN=EPX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	431-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	67-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q13868-3|EXOS2_HUMAN	Isoform 3 of Exosome complex component RRP4 OS=Homo sapiens OX=9606 GN=EXOSC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	94-UNIMOD:21,101-UNIMOD:35	0.05	22.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	735-UNIMOD:21,741-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1278-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	13-UNIMOD:21,26-UNIMOD:35	0.04	22.0	2	1	0
PRT	sp|Q9NVW2-2|RNF12_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RLIM OS=Homo sapiens OX=9606 GN=RLIM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	89-UNIMOD:21,94-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q96DR7-3|ARHGQ_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 26 OS=Homo sapiens OX=9606 GN=ARHGEF26	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	80-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	tRNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	1811-UNIMOD:21,1819-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q96RU3|FNBP1_HUMAN	Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	331-UNIMOD:35,359-UNIMOD:21	0.05	22.0	1	1	0
PRT	sp|O43745|CHP2_HUMAN	Calcineurin B homologous protein 2 OS=Homo sapiens OX=9606 GN=CHP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	98-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|Q9Y2J2|E41L3_HUMAN	Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	492-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9H270|VPS11_HUMAN	Vacuolar protein sorting-associated protein 11 homolog OS=Homo sapiens OX=9606 GN=VPS11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	553-UNIMOD:35,560-UNIMOD:21,561-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	410-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O94875|SRBS2_HUMAN	Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	259-UNIMOD:21	0.01	22.0	1	1	0
PRT	sp|Q5JSH3|WDR44_HUMAN	WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	262-UNIMOD:21	0.01	22.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	RDDDGALHAACQVQPSATLDAAQPR	1	sp|P08294|SODE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:4	ms_run[2]:scan=10448	61.872	3	2662.2518	2662.2518	R	V	53	78
PSM	QRSPLLNQPVPELSHASLIANQSPFR	2	sp|Q9NPI6|DCP1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=18454	119.40491833333334	3	2961.4842	2961.4857	R	A	351	377
PSM	RHSVVAGGGGGEGR	3	sp|Q6PKG0|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37	3-UNIMOD:21	ms_run[1]:scan=678	5.43339	2	1374.617010	1374.615375	K	K	1038	1052
PSM	GHLSRPEAQSLSPYTTSANR	4	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:21	ms_run[2]:scan=8317	48.87	3	2251.0383	2251.0383	R	A	251	271
PSM	RADDFPVRDDPSDVTDEDEGPAEPPPPPK	5	sp|Q3YEC7|RABL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:21	ms_run[2]:scan=11290	67.299	3	3239.3932	3239.3932	R	L	585	614
PSM	RHSVVAGGGGGEGR	6	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=681	5.4484	2	1374.6154	1374.6154	K	K	961	975
PSM	RLSTSPDVIQGHQPR	7	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=6705	39.335	2	1769.8574	1769.8574	R	D	264	279
PSM	VHTECCHGDLLECADDR	8	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6948	40.766	2	2085.8303	2085.8303	K	A	265	282
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	9	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6018	35.176545000000004	3	3007.3319	3007.3290	K	S	145	174
PSM	HELQANCYEEVKDR	10	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:4	ms_run[2]:scan=5091	29.929	2	1789.8053	1789.8053	K	C	133	147
PSM	HGSFHEDEDPIGSPR	11	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:21	ms_run[2]:scan=6460	37.827	2	1758.6999	1758.6999	R	L	1266	1281
PSM	HTFMGVVSLGSPSGEVSHPR	12	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11268	67.161	3	2175.9773	2175.9773	R	K	318	338
PSM	PGAEGAPLLPPPLPPPSPPGSGR	13	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	17-UNIMOD:21	ms_run[2]:scan=15521	96.85	2	2237.1246	2237.1246	R	G	27	50
PSM	SHSDASVGSHSSTESEHGSSSPR	14	sp|Q6XZF7-2|DNMBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	21-UNIMOD:21	ms_run[2]:scan=608	5.1616	3	2390.9361	2390.9361	R	F	597	620
PSM	TCLHYLGEFGEDQIYEAHQQGR	15	sp|Q8WU39-3|MZB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:4	ms_run[2]:scan=14215	87.155	3	2650.187	2650.1870	R	G	50	72
PSM	GVVDSDDLPLNVSR	16	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=12918	78.007	2	1484.7471	1484.7471	K	E	435	449
PSM	PGAEGAPLLPPPLPPPSPPGSGR	17	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:21	ms_run[2]:scan=15655	97.861	2	2237.1246	2237.1246	R	G	27	50
PSM	SGSSHAPQDVSLSYPQHHVGNSSPTSTSPSR	18	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	22-UNIMOD:21	ms_run[2]:scan=7715	45.313	3	3270.4327	3270.4327	R	Y	86	117
PSM	DASDDLDDLNFFNQK	19	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=18069	116.32	2	1755.7588	1755.7588	K	K	65	80
PSM	HELQANCYEEVKDR	20	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:4	ms_run[2]:scan=5084	29.899	3	1789.8053	1789.8053	K	C	133	147
PSM	HTFMGVVSLGSPSGEVSHPR	21	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=11301	67.361	2	2175.9773	2175.9773	R	K	318	338
PSM	KPEKPLFSSASPQDSSPR	22	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:21	ms_run[2]:scan=6648	38.96	3	2036.9568	2036.9568	K	L	66	84
PSM	RASEFPGPLSVTSHGR	23	sp|Q5VUB5|F1711_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=10634	63.048	3	1776.8308	1776.8308	R	P	369	385
PSM	RGSGSALGGPLDPQFVGPSDTSLGAAPGHR	24	sp|P98174|FGD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=14908	92.228	3	2940.3879	2940.3879	R	V	46	76
PSM	RVIENADGSEEETDTR	25	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:21	ms_run[2]:scan=3256	19.231	2	1899.7847	1899.7847	R	D	1946	1962
PSM	SVSHGSNHTQKPDEQR	26	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:21	ms_run[2]:scan=466	4.5859	2	1885.8068	1885.8068	R	S	681	697
PSM	FADQDDIGNVSFDR	27	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12731	76.761	2	1597.7009	1597.7009	K	V	489	503
PSM	KQELEEICHDLEAR	28	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:4	ms_run[2]:scan=12052	72.185	2	1768.8414	1768.8414	K	V	774	788
PSM	SKDQDDQKPGPSER	29	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=517	4.7919	2	1585.7332	1585.7332	K	S	467	481
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	30	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	22-UNIMOD:21	ms_run[2]:scan=16044	100.79	3	2618.3622	2618.3622	R	S	989	1017
PSM	VERPPSPFSMAPQASLPPVPPR	31	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14286	87.664	3	2452.1974	2452.1974	K	L	478	500
PSM	QVSASELHTSGILGPETLR	32	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=16983	107.82969666666665	2	2056.9824	2056.9825	R	D	2716	2735
PSM	FPLVADLFHDDKDPVPATTPGK	33	sp|Q9ULV0|MYO5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	18-UNIMOD:21	ms_run[2]:scan=18371	118.75	3	2459.1774	2459.1774	K	G	585	607
PSM	GHLSRPEAQSLSPYTTSANR	34	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:21	ms_run[2]:scan=8288	48.695	2	2251.0383	2251.0383	R	A	251	271
PSM	IIKDGEQHEDLNEVAK	35	sp|O95831-5|AIFM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5103	29.989	2	1836.9218	1836.9218	K	L	239	255
PSM	LHDFLAHSSEESEETSSPPR	36	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:21	ms_run[2]:scan=8780	51.58	2	2333.9801	2333.9801	K	L	18	38
PSM	NLTSSSLNDISDKPEK	37	sp|Q9Y6R1-3|S4A4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=8411	49.413	2	1826.8299	1826.8299	R	D	208	224
PSM	RPPSDIHDSDGSSSSSHQSLK	38	sp|O43665-3|RGS10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=2223	13.08	3	2302.9815	2302.9815	K	S	13	34
PSM	SPPRPSPGGLHYSDEDICNK	39	sp|Q7Z5N4-3|SDK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=8891	52.222	2	2304.9835	2304.9835	R	Y	2065	2085
PSM	DTSNHFHVFVGDLSPEITTEDIK	40	sp|Q01085|TIAR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=16941	107.52	3	2600.2395	2600.2395	K	S	92	115
PSM	HTFMGVVSLGSPSGEVSHPR	41	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=10720	63.592	3	2175.9773	2175.9773	R	K	318	338
PSM	IHGSGHVEEPASPLAAYQK	42	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=8225	48.318	2	2069.9572	2069.9572	K	S	911	930
PSM	IKDPDASKPEDWDER	43	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6654	38.995	2	1799.8326	1799.8326	K	A	208	223
PSM	LDETDDPDDYGDR	44	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5615	32.877	2	1524.5852	1524.5852	R	E	401	414
PSM	RSNMHFTSSSTGGLSSSQSSYSPSNR	45	sp|Q9P0J7|KCMF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=6092	35.611	3	2844.177	2844.1770	R	E	168	194
PSM	SHHAPMSPGSSGGGGQPLAR	46	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2274	13.349	3	1982.8418	1982.8418	R	T	357	377
PSM	SKPGSTGPEPPIPQASPGPPGPLSQTPPMQR	47	sp|Q8N4C8-4|MINK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	16-UNIMOD:21,29-UNIMOD:35	ms_run[2]:scan=11869	70.981	3	3185.5217	3185.5217	K	P	540	571
PSM	STAQQELDGKPASPTPVIVASHTANK	48	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:21	ms_run[2]:scan=8747	51.395	3	2726.3276	2726.3276	R	E	818	844
PSM	VERPPSPFSMAPQASLPPVPPR	49	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14151	86.659	3	2452.1974	2452.1974	K	L	478	500
PSM	VHTECCHGDLLECADDR	50	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7126	41.759	3	2085.8303	2085.8303	K	A	265	282
PSM	VLTPPHDVDSLPHLR	51	sp|Q9P1Y5|CAMP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=13783	84.042	3	1774.8767	1774.8767	R	K	797	812
PSM	VNVDEVGGEALGR	52	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10215	60.475	2	1313.6575	1313.6575	K	L	19	32
PSM	PYHPPPLFPPSPQPPDSTPR	53	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	11-UNIMOD:21	ms_run[1]:scan=13849	84.504015	3	2304.080727	2303.077620	R	Q	158	178
PSM	PGAQPLPPPPPSQSPEPTEPHPR	54	sp|Q9UIS9|MBD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	14-UNIMOD:21	ms_run[1]:scan=8220	48.29189166666667	3	2490.178607	2489.174040	R	A	284	307
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	55	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	28-UNIMOD:21	ms_run[2]:scan=9682	57.083	3	3407.6452	3407.6452	R	N	215	246
PSM	APVHFVEPLSPTGVAGHR	56	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=12472	75.01	2	1949.9513	1949.9513	K	K	793	811
PSM	CHAEHTPEEEIDHTGAK	57	sp|O95757|HS74L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=2855	17.135	3	2039.8044	2039.8044	K	T	540	557
PSM	DPDAQPGGELMLGGTDSK	58	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=9234	54.267	2	1802.7993	1802.7993	R	Y	236	254
PSM	GSQHSPTRPPVAAAAASLGSLPGPGAAR	59	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:21	ms_run[2]:scan=14023	85.73	3	2660.3184	2660.3184	R	G	75	103
PSM	HIPGAAFFDIDQCSDR	60	sp|P25325|THTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:4	ms_run[2]:scan=15195	94.407	3	1847.8261	1847.8261	R	T	53	69
PSM	QRDEDDEAYGKPVK	61	sp|Q53GD3-4|CTL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1624	9.8086	2	1648.7693	1648.7693	K	Y	5	19
PSM	RHTDPVQLQAAGR	62	sp|O75791-2|GRAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=4393	25.863	3	1527.7307	1527.7307	R	V	147	160
PSM	RLTADMISHPLGDFR	63	sp|Q00587-2|BORG5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=12625	76.044	3	1823.839	1823.8390	R	H	32	47
PSM	RRGSDIDNPTLTVMDISPPSR	64	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=12119	72.623	3	2422.1312	2422.1312	R	S	328	349
PSM	SFPLHSPVAGVAHR	65	sp|Q96JN8-2|NEUL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=9363	55.067	2	1553.7504	1553.7504	K	F	900	914
PSM	SQDKLDKDDLEK	66	sp|Q14185|DOCK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2962	17.676	2	1432.7046	1432.7046	R	E	1681	1693
PSM	THEAEIVEGENHTYCIR	67	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:4	ms_run[2]:scan=8687	51.039	2	2056.9273	2056.9273	K	F	2177	2194
PSM	YHGHSMSDPGVSYR	68	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=2990	17.797	2	1687.645	1687.6450	R	T	258	272
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	69	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14579	89.808575	3	3442.4015	3442.4027	K	L	104	135
PSM	QHEAPSNRPLNELLTPQGPSPR	70	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=13794	84.09362833333333	3	2500.1860	2500.1855	R	T	167	189
PSM	RNSRTEEPTVASESVENGHR	71	sp|Q14686|NCOA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	3-UNIMOD:21	ms_run[1]:scan=4115	24.264041666666667	3	2335.023104	2334.034980	R	K	2016	2036
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	72	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:21	ms_run[2]:scan=15860	99.433	3	3613.8254	3613.8254	R	Q	125	162
PSM	APEPHVEEDDDDELDSK	73	sp|P52566|GDIR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6394	37.444	3	1938.7967	1938.7967	K	L	5	22
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	74	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	28-UNIMOD:21	ms_run[2]:scan=9522	56.07	3	3407.6452	3407.6452	R	N	215	246
PSM	DADDAVYELDGK	75	sp|Q13243-2|SRSF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10260	60.734	2	1309.5674	1309.5674	R	E	49	61
PSM	DPDDHTVCHLLFANQTEK	76	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:4	ms_run[2]:scan=12997	78.535	3	2138.9691	2138.9691	K	D	174	192
PSM	EKSPPDQPAVPHPPPSTPIK	77	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:21	ms_run[2]:scan=7599	44.605	3	2198.0773	2198.0773	K	L	598	618
PSM	HTFMGVVSLGSPSGEVSHPR	78	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11582	69.173	3	2175.9773	2175.9773	R	K	318	338
PSM	IGHHSTSDDSSAYR	79	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=1228	7.8145	3	1611.6315	1611.6315	R	S	333	347
PSM	LHDFLAHSSEESEETSSPPR	80	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	17-UNIMOD:21	ms_run[2]:scan=8741	51.361	3	2333.9801	2333.9801	K	L	18	38
PSM	LKEFLEDYDDDRDDPK	81	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10416	61.684	2	2011.9011	2011.9011	R	Y	496	512
PSM	MGHAGAIIAGGK	82	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35	ms_run[2]:scan=2149	12.646	2	1097.5652	1097.5652	R	G	297	309
PSM	PGAEGAPLLPPPLPPPSPPGSGR	83	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	17-UNIMOD:21	ms_run[2]:scan=15787	98.873	2	2237.1246	2237.1246	R	G	27	50
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	84	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:21	ms_run[2]:scan=4604	27.16	3	3024.3561	3024.3561	K	S	73	102
PSM	RFSNVGLVHTSER	85	sp|Q9C0H9|SRCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=8440	49.581	2	1580.7461	1580.7461	R	R	43	56
PSM	RLEGQEEEEDNRDSSMK	86	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:35	ms_run[2]:scan=988	6.7012	2	2066.8811	2066.8811	K	L	357	374
PSM	RRPTLGVQLDDK	87	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=8006	47.07	3	1476.745	1476.7450	R	R	325	337
PSM	SGPKPFSAPKPQTSPSPK	88	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:21	ms_run[2]:scan=5596	32.767	2	1916.9397	1916.9397	R	R	294	312
PSM	SHHAPMSPGSSGGGGQPLAR	89	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2139	12.595	2	1982.8418	1982.8418	R	T	357	377
PSM	VLATEDRSDHLIQTDTVNLHR	90	sp|P51151|RAB9A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:21	ms_run[2]:scan=10504	62.241	3	2512.2071	2512.2071	R	K	172	193
PSM	VVIHFTDGADGDLADLHR	91	sp|P12111-4|CO6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13454	81.723	3	1949.9595	1949.9595	K	A	1340	1358
PSM	DPDDHTVCHLLFANQTEK	92	sp|P00387|NB5R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	8-UNIMOD:4	ms_run[1]:scan=13309	80.72023666666666	3	2139.959515	2138.969118	K	D	197	215
PSM	HTFMGVVSLGSPSGEVSHPR	93	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	13-UNIMOD:21	ms_run[1]:scan=11186	66.64946166666667	3	2160.953290	2159.982339	R	K	318	338
PSM	LEGLTDEINFLR	94	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=18205	117.37350333333335	2	1418.739727	1418.740545	R	Q	214	226
PSM	QPPYQLRPSLFVLSPIKEPAK	95	sp|Q8N3V7|SYNPO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=19544	128.07183500000002	3	2470.3019	2470.3020	K	V	806	827
PSM	HRPSAGGPDSAGR	96	sp|Q01970|PLCB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:21	ms_run[1]:scan=586	5.070791666666667	2	1343.575453	1343.573176	R	K	471	484
PSM	AGIPQHHPPMAQNLQYPDDSDDEK	97	sp|Q15223|NECT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:35,20-UNIMOD:21	ms_run[2]:scan=8238	48.395	3	2798.1643	2798.1643	K	K	403	427
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	98	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	28-UNIMOD:21	ms_run[2]:scan=9858	58.091	3	3407.6452	3407.6452	R	N	215	246
PSM	DRDDFPVVLVGNK	99	sp|P10301|RRAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13257	80.361	2	1472.7623	1472.7623	K	A	131	144
PSM	EREEEDDYRQEEQR	100	sp|Q99795|GPA33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1738	10.348	2	1909.8038	1909.8038	R	S	294	308
PSM	GTHSPPLTPEVAGLHGPR	101	sp|O75808|CAN15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=10574	62.661	3	1901.9149	1901.9149	K	P	1067	1085
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	102	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:21	ms_run[2]:scan=7832	46.039	3	2671.2239	2671.2239	K	Q	710	737
PSM	HPEPAQPAPGSPAETTEGPLHCSR	103	sp|P52746|ZN142_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=7218	42.333	3	2602.1272	2602.1272	R	C	1309	1333
PSM	HPPVLTPPDQEVIR	104	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=11632	69.469	3	1676.8287	1676.8287	R	N	636	650
PSM	HRPSEADEEELAR	105	sp|O14617-3|AP3D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=3707	21.953	2	1617.6784	1617.6784	K	R	486	499
PSM	KPEKPLFSSASPQDSSPR	106	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:21	ms_run[2]:scan=6303	36.915	3	2036.9568	2036.9568	K	L	66	84
PSM	LLKPGEEPSEYTDEEDTKDHNK	107	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=5688	33.31	3	2653.1433	2653.1433	R	Q	200	222
PSM	LLKPGEEPSEYTDEEDTKDHNK	108	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=6055	35.378	3	2653.1433	2653.1433	R	Q	200	222
PSM	LRPSQSLHCMLSPPEPSAAPR	109	sp|Q9Y2B5|VP9D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21,9-UNIMOD:4,10-UNIMOD:35	ms_run[2]:scan=9732	57.357	3	2426.1236	2426.1236	R	P	325	346
PSM	MPGMSPANPSLHSPVPDASHSPR	110	sp|O60244|MED14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:35,4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7034	41.223	3	2480.0614	2480.0614	R	A	1124	1147
PSM	PGAEGAPLLPPPLPPPSPPGSGR	111	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	17-UNIMOD:21	ms_run[2]:scan=15721	98.362	3	2237.1246	2237.1246	R	G	27	50
PSM	PRPPQSSTGSTASPPVSTPVTGHK	112	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:21	ms_run[2]:scan=6335	37.097	3	2452.1748	2452.1748	K	R	139	163
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	113	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	18-UNIMOD:21	ms_run[2]:scan=8116	47.697	3	2602.1925	2602.1925	R	F	118	143
PSM	SGPKPFSAPKPQTSPSPK	114	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:21	ms_run[2]:scan=4314	25.367	2	1916.9397	1916.9397	R	R	294	312
PSM	SHHAPMSPGSSGGGGQPLAR	115	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2098	12.352	3	1982.8418	1982.8418	R	T	357	377
PSM	TLVHSSSDGHIDPQHAAGK	116	sp|Q8N5C8-2|TAB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=4334	25.483	3	2035.9113	2035.9113	R	Q	97	116
PSM	VHIPNDDAQFDASHCDSDK	117	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:4	ms_run[2]:scan=7601	44.617	3	2169.9022	2169.9022	R	G	83	102
PSM	VHTECCHGDLLECADDR	118	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6347	37.161	2	2085.8303	2085.8303	K	A	265	282
PSM	VVIHFTDGADGDLADLHR	119	sp|P12111-4|CO6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13208	80.04	3	1949.9595	1949.9595	K	A	1340	1358
PSM	LKEFLEDYDDDRDD	120	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27		ms_run[1]:scan=11627	69.43756833333333	2	1786.7533	1786.7528	R	P	496	510
PSM	QRDEDDEAYGKPVK	121	sp|Q53GD3|CTL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=3261	19.26846833333333	2	1631.7439	1631.7422	K	Y	5	19
PSM	KTPELGIVPPPPIPR	122	sp|Q8TEH3|DEN1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	2-UNIMOD:21	ms_run[1]:scan=14890	92.09539000000001	2	1689.921623	1689.921894	R	P	706	721
PSM	APAPPPPQPPPPSPLIPNR	123	sp|O75128-3|COBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:21	ms_run[2]:scan=11216	66.83	3	2019.0343	2019.0343	R	T	335	354
PSM	DIHDDQDYLHSLGK	124	sp|O75955-2|FLOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10509	62.264	3	1654.7587	1654.7587	K	A	105	119
PSM	GAGAAGLPQPPRESPQLHER	125	sp|Q9BR39|JPH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=8679	50.992	2	2147.0273	2147.0273	R	E	456	476
PSM	GDLAFGAPGPRPPSPFDDPADDPEHK	126	sp|Q93074-3|MED12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=14672	90.501	3	2781.2072	2781.2072	R	E	622	648
PSM	HESENLYSIACDKPQQVR	127	sp|P12110-3|CO6A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:4	ms_run[2]:scan=9552	56.263	3	2173.0222	2173.0222	K	N	767	785
PSM	HSTPSNSSNPSGPPSPNSPHR	128	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:21	ms_run[2]:scan=1661	9.9641	3	2219.9345	2219.9345	K	S	1676	1697
PSM	IGHHSTSDDSSAYR	129	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=1220	7.7739	2	1611.6315	1611.6315	R	S	333	347
PSM	IHIDPEIQDGSPTTSR	130	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=9473	55.773	2	1844.8306	1844.8306	R	R	102	118
PSM	LLKPGEEPSEYTDEEDTKDHNK	131	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:21	ms_run[2]:scan=6549	38.4	3	2653.1433	2653.1433	R	Q	200	222
PSM	LMSLLTSPHQPPPPPPASASPSAVPNGPQSPK	132	sp|Q96RU3-5|FNBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35,30-UNIMOD:21	ms_run[2]:scan=12422	74.676	3	3279.5999	3279.5999	K	Q	330	362
PSM	PADLDLIQSTPFKPLALKTPPR	133	sp|Q9GZY8-4|MFF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	19-UNIMOD:21	ms_run[2]:scan=18169	117.07	3	2497.3346	2497.3346	R	V	71	93
PSM	REHASIDAQSGAGVPNPSTSASPK	134	sp|Q8IXJ6-5|SIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	20-UNIMOD:21	ms_run[2]:scan=6207	36.302	3	2443.1129	2443.1129	R	K	277	301
PSM	RFSNVGLVHTSER	135	sp|Q9C0H9|SRCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=8383	49.237	3	1580.7461	1580.7461	R	R	43	56
PSM	RGSGHLPSAR	136	sp|Q8N4Y2|EFC4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=1258	7.9544	2	1116.519	1116.5190	R	-	390	400
PSM	RKSDASSLMPPLR	137	sp|Q6IQ26-2|DEN5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=5956	34.793	3	1552.7433	1552.7433	R	I	849	862
PSM	RKSDSGVMLPTLR	138	sp|Q6ZUT9|DEN5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=9794	57.72	3	1554.7589	1554.7589	R	V	831	844
PSM	RLSLPGQLGALTSQPLHR	139	sp|Q12809-2|KCNH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=16535	104.41	3	2023.0728	2023.0728	R	H	795	813
PSM	RPPSDIHDSDGSSSSSHQSLK	140	sp|O43665-3|RGS10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=2378	14.1	3	2302.9815	2302.9815	K	S	13	34
PSM	RVSVLGGAPGHNPDR	141	sp|Q6ZRI8-4|RHG36_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=5383	31.528	3	1610.7679	1610.7679	R	R	19	34
PSM	TRSLHGPCPVTTFGPK	142	sp|O95544|NADK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=9441	55.571	2	1833.8597	1833.8597	R	A	62	78
PSM	VETLKEEEEELKR	143	sp|Q9Y3L3|3BP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8209	48.227	2	1630.8414	1630.8414	K	K	188	201
PSM	YSPSQNSPIHHIPSR	144	sp|Q9NYF8-4|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=7561	44.348	2	1798.8152	1798.8152	R	R	284	299
PSM	QHEAPSNRPLNELLTPQGPSPR	145	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,15-UNIMOD:21	ms_run[1]:scan=12626	76.048185	3	2500.1863	2500.1855	R	T	167	189
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	146	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	21-UNIMOD:21	ms_run[1]:scan=10316	61.057183333333334	3	2685.118487	2685.135288	R	G	244	269
PSM	ALRPGDLPPSPDDVKR	147	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=8784	51.599	3	1811.8931	1811.8931	R	R	299	315
PSM	DGLHFLPHASSSAQSPCGSPGMK	148	sp|Q3V6T2-5|GRDN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:21,17-UNIMOD:4,22-UNIMOD:35	ms_run[2]:scan=10684	63.362	3	2463.0348	2463.0348	R	R	219	242
PSM	DLDDIEDENEQLK	149	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10979	65.282	2	1574.6948	1574.6948	R	Q	313	326
PSM	DRTPPHLLYSDR	150	sp|Q8NDT2-2|RB15B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=8300	48.769	3	1548.7086	1548.7086	R	D	203	215
PSM	EKSPPDQPAVPHPPPSTPIK	151	sp|P35611-2|ADDA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=7760	45.616	3	2198.0773	2198.0773	K	L	598	618
PSM	HIKEEPLSEEEPCTSTAIASPEK	152	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=9777	57.62	3	2661.1881	2661.1881	K	K	495	518
PSM	HMSADDLNDGFVLDKDDR	153	sp|P78316-2|NOP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=9832	57.937	3	2077.9011	2077.9011	K	R	311	329
PSM	HRLTPQEGLQAPGGSLR	154	sp|Q03989-5|ARI5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=8618	50.609	2	1895.9367	1895.9367	R	E	242	259
PSM	HSNLMLEDLDKSQEEIKK	155	sp|P11171-4|41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=8779	51.577	3	2252.0396	2252.0396	R	H	421	439
PSM	HTFMGVVSLGSPSGEVSHPR	156	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=11427	68.166	3	2175.9773	2175.9773	R	K	318	338
PSM	HTFMGVVSLGSPSGEVSHPR	157	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11951	71.5	3	2175.9773	2175.9773	R	K	318	338
PSM	KKEPAITSQNSPEAR	158	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=1510	9.2378	3	1734.8302	1734.8302	K	E	69	84
PSM	KRGSLLSEPAIQVR	159	sp|Q9NQT8|KI13B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=10296	60.957	3	1632.8713	1632.8713	R	R	729	743
PSM	LHEDDKEQDIADK	160	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2023	11.939	2	1554.7162	1554.7162	R	M	1113	1126
PSM	LHEDDKEQDIADK	161	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2035	12.019	3	1554.7162	1554.7162	R	M	1113	1126
PSM	LKDLFDYSPPLHK	162	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=14668	90.472	2	1651.8011	1651.8011	K	N	503	516
PSM	LTRPFPTGTPPPLPPK	163	sp|Q9BQI5|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=12677	76.402	3	1794.9434	1794.9434	K	N	239	255
PSM	LTRPFPTGTPPPLPPK	164	sp|Q9BQI5|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=12989	78.483	3	1794.9434	1794.9434	K	N	239	255
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	165	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:21	ms_run[2]:scan=12502	75.216	3	2775.2402	2775.2402	R	D	285	310
PSM	PFAHLSHGDSPVSTSTPLPEK	166	sp|Q8NFM4-2|ADCY4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:21	ms_run[2]:scan=10016	59.131	3	2283.0573	2283.0573	K	T	183	204
PSM	PRPPQSSTGSTASPPVSTPVTGHK	167	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=6173	36.089	3	2452.1748	2452.1748	K	R	139	163
PSM	PYHPPPLFPPSPQPPDSTPR	168	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=13563	82.49	3	2303.0776	2303.0776	R	Q	158	178
PSM	RAHTPTPGIYMGR	169	sp|Q13595-3|TRA2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4083	24.08	3	1551.7017	1551.7017	K	P	98	111
PSM	RAPAPGTLQDGLCHSLDR	170	sp|O15021-2|MAST4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=9356	55.031	3	2042.9357	2042.9357	R	G	1444	1462
PSM	RAPSVANVGSHCDLSLK	171	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9258	54.411	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RDSSHNELYYEEAEHER	172	sp|Q8TAA9-2|VANG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=7065	41.414	3	2242.8917	2242.8917	R	R	334	351
PSM	RHSQALEALQQR	173	sp|O95613-2|PCNT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=5699	33.366	3	1515.7307	1515.7307	R	L	1694	1706
PSM	RLSTSPDVIQGHQPR	174	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=6685	39.197	3	1769.8574	1769.8574	R	D	264	279
PSM	RRPTLGVQLDDK	175	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=7893	46.39	2	1476.745	1476.7450	R	R	325	337
PSM	RRSQAELETLVLSR	176	sp|Q00G26|PLIN5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=12914	77.982	3	1736.8934	1736.8934	R	S	275	289
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	177	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=7284	42.716	3	2455.0765	2455.0765	R	S	283	308
PSM	SSVVSPSHPPPAPPLGSPPGPK	178	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=10840	64.371	3	2168.0667	2168.0667	R	P	292	314
PSM	TPKDSPGIPPSAGAHQLFR	179	sp|Q15418-3|KS6A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=10766	63.882	3	2054.9939	2054.9939	R	G	267	286
PSM	VGGSSVDLHR	180	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=4173	24.562	2	1105.4917	1105.4917	R	F	164	174
PSM	VKDDIESLHDK	181	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3520	20.852	2	1297.6514	1297.6514	R	F	612	623
PSM	QKTPPPVAPKPAVK	182	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5202	30.51479666666667	2	1519.8163	1519.8158	K	S	753	767
PSM	RRGSDIDNPTLTVMDISPPSR	183	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=11970	71.61819666666666	3	2423.131779	2422.131189	R	S	328	349
PSM	RRSPESLPAGPGAAALEGGTR	184	sp|Q717R9|CYS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21	ms_run[1]:scan=9744	57.42505833333334	3	2129.034742	2129.037880	R	R	15	36
PSM	RHSEQVANGPTPPPR	185	sp|A6ND36|FA83G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	3-UNIMOD:21	ms_run[1]:scan=2374	14.071763333333333	3	1722.7832	1721.7992	R	R	632	647
PSM	HVALHSASNGTPPAGTPPGAR	186	sp|Q9HC78|ZBT20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	16-UNIMOD:21	ms_run[1]:scan=4648	27.410725	3	2074.959748	2073.974552	R	A	680	701
PSM	QGEDLAHVQHPTGAGPHAQEEDSQEEEEEDEEAASR	187	sp|Q9NW97|TMM51_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,23-UNIMOD:21	ms_run[1]:scan=9203	54.088898333333326	3	4005.5942	4003.5882	R	Y	93	129
PSM	AEQSLHDLQER	188	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=5112	30.032	2	1404.6035	1404.6035	R	L	254	265
PSM	ALRPGDLPPSPDDVKR	189	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=7921	46.543	3	1811.8931	1811.8931	R	R	299	315
PSM	APSQHIFFVQHIEAVR	190	sp|Q8N3E9|PLCD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=14666	90.459	2	1957.9564	1957.9564	R	E	103	119
PSM	ARSPPQPLGELKR	191	sp|Q96FF7|MISP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=7861	46.209	3	1527.7923	1527.7923	R	F	89	102
PSM	ARSPPQPLGELKR	192	sp|Q96FF7|MISP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=8030	47.216	3	1527.7923	1527.7923	R	F	89	102
PSM	DGDDVIIIGVFK	193	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=18252	117.76	2	1289.6867	1289.6867	K	G	302	314
PSM	DTDDVPMILVGNK	194	sp|P61224-4|RAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=12692	76.495	2	1431.6915	1431.6915	K	C	63	76
PSM	EEDCHSPTSKPPKPDQPLK	195	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=3460	20.492	2	2269.0086	2269.0086	K	V	415	434
PSM	EQGSDEISHHEK	196	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=739	5.6679	2	1394.6062	1394.6062	R	M	245	257
PSM	GAGAAGLPQPPRESPQLHER	197	sp|Q9BR39|JPH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=8853	51.996	2	2147.0273	2147.0273	R	E	456	476
PSM	GPGSPPRTPPAPGPPSFEEQLR	198	sp|Q6ZTN6-2|AN13D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=12670	76.354	3	2350.1107	2350.1107	R	L	199	221
PSM	HAPSLHGSTELLPLSR	199	sp|Q9H5N1-2|RABE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=11759	70.302	3	1793.8825	1793.8825	R	D	186	202
PSM	HAPSLHGSTELLPLSR	200	sp|Q9H5N1-2|RABE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=11788	70.472	2	1793.8825	1793.8825	R	D	186	202
PSM	HDTSLKPISVSYNPATAK	201	sp|P00915|CAH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9381	55.196	3	1928.0003	1928.0003	K	E	41	59
PSM	IIHHSGSMDQR	202	sp|P51178|PLCD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=512	4.7702	2	1375.5704	1375.5704	K	Q	128	139
PSM	IPHEFHTSMK	203	sp|O15061-2|SYNEM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=3883	22.974	2	1321.5526	1321.5526	K	G	929	939
PSM	KIPVFHNGSTPTLGETPK	204	sp|Q9Y6M7-11|S4A7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=10974	65.253	3	2001.9925	2001.9925	R	E	429	447
PSM	KLFAPVPFPSGSTEDVSPSGPQQPPPLPQK	205	sp|Q86YV5|PRAG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=16797	106.41	3	3208.5846	3208.5846	K	K	789	819
PSM	KPEKPLFSSASPQDSSPR	206	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=6610	38.748	2	2036.9568	2036.9568	K	L	66	84
PSM	KQADLEKEELAEELASSLSGR	207	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16172	101.72	3	2302.1652	2302.1652	R	N	1704	1725
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	208	sp|Q04323|UBXN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	25-UNIMOD:21	ms_run[2]:scan=9119	53.583	3	3290.5973	3290.5973	K	E	178	210
PSM	LGSASSSHGSIQESHKASR	209	sp|Q16566|KCC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=956	6.5653	2	2004.9014	2004.9014	R	D	339	358
PSM	LHKPPADSGVDLR	210	sp|O15427|MOT4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=5022	29.562	2	1483.7184	1483.7184	K	E	429	442
PSM	LTRPFPTGTPPPLPPK	211	sp|Q9BQI5|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=12829	77.436	3	1794.9434	1794.9434	K	N	239	255
PSM	MPGMSPANPSLHSPVPDASHSPR	212	sp|O60244|MED14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35,4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7203	42.234	3	2480.0614	2480.0614	R	A	1124	1147
PSM	PGAEGAPLLPPPLPPPSPPGSGR	213	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	17-UNIMOD:21	ms_run[2]:scan=15384	95.837	2	2237.1246	2237.1246	R	G	27	50
PSM	PGAEGAPLLPPPLPPPSPPGSGR	214	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	17-UNIMOD:21	ms_run[2]:scan=15454	96.352	3	2237.1246	2237.1246	R	G	27	50
PSM	PGAEGAPLLPPPLPPPSPPGSGR	215	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	17-UNIMOD:21	ms_run[2]:scan=15852	99.369	3	2237.1246	2237.1246	R	G	27	50
PSM	PKPRPSPSSTR	216	sp|Q92888-2|ARHG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=557	4.9568	2	1288.6289	1288.6289	R	E	738	749
PSM	QLHEYETELEDERK	217	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7891	46.379	2	1817.8432	1817.8432	R	Q	1597	1611
PSM	QRDEDDEAYGKPVK	218	sp|Q53GD3-4|CTL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1617	9.7744	3	1648.7693	1648.7693	K	Y	5	19
PSM	RGSHPYIDFR	219	sp|Q13946-3|PDE7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=8583	50.435	2	1326.587	1326.5870	R	I	82	92
PSM	RHSQALEALQQR	220	sp|O95613-2|PCNT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=5719	33.458	2	1515.7307	1515.7307	R	L	1694	1706
PSM	RHSVVAGGGGGEGR	221	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=682	5.4506	3	1374.6154	1374.6154	K	K	961	975
PSM	RIDISPSTFR	222	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=12057	72.217	2	1270.6071	1270.6071	R	K	678	688
PSM	RKSEPAVGPPR	223	sp|O94875-9|SRBS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1880	11.129	2	1272.634	1272.6340	R	G	328	339
PSM	RPAGGRPSPSAMGK	224	sp|Q92615|LAR4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=571	5.0119	2	1463.6704	1463.6704	R	R	711	725
PSM	RRESLSYIPK	225	sp|A1L390-2|PKHG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=6568	38.506	3	1327.665	1327.6650	R	G	271	281
PSM	RRGSSGSVDETLFALPAASEPVIR	226	sp|Q9NQC3-5|RTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=17100	108.77	3	2594.2854	2594.2854	K	S	178	202
PSM	RRSGPLEESER	227	sp|Q9Y3X0|CCDC9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1744	10.385	3	1394.6304	1394.6304	R	D	200	211
PSM	RRSPAGQASSSLAQR	228	sp|Q13574|DGKZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=2717	16.242	3	1650.7951	1650.7951	R	R	35	50
PSM	SPLTPEKEVGYLEFTGPPQKPPR	229	sp|Q14289-2|FAK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=15259	94.892	3	2646.3095	2646.3095	K	L	797	820
PSM	TGHILHPEYLQPLPSTPVSPIELDAK	230	sp|Q96F45-3|ZN503_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	19-UNIMOD:21	ms_run[2]:scan=16596	104.86	3	2931.4783	2931.4783	R	K	84	110
PSM	TPKDSPGIPPSAGAHQLFR	231	sp|Q15418-3|KS6A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=10610	62.877	3	2054.9939	2054.9939	R	G	267	286
PSM	TPKDSPGIPPSANAHQLFR	232	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=10592	62.775	3	2112.0154	2112.0154	K	G	365	384
PSM	VADPDHDHTGFLTEYVATR	233	sp|P28482-2|MK01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12763	76.991	3	2142.997	2142.9970	R	W	173	192
PSM	VAHEPVAPPEDKESESEAK	234	sp|O95674|CDS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=4116	24.268	3	2127.9362	2127.9362	R	V	8	27
PSM	VERPPSPFSMAPQASLPPVPPR	235	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14423	88.67	3	2452.1974	2452.1974	K	L	478	500
PSM	VIPAKSPPPPTHSTQLGAPSR	236	sp|Q14814-6|MEF2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=6351	37.182	3	2217.1307	2217.1307	K	K	200	221
PSM	VLTPPHDVDSLPHLR	237	sp|Q9P1Y5|CAMP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=13846	84.485	2	1774.8767	1774.8767	R	K	797	812
PSM	VSKPSQLQAHTPASQQTPPLPPYASPR	238	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=10871	64.565	3	2962.4702	2962.4702	K	S	250	277
PSM	YDERPGPSPLPHR	239	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=4899	28.853	3	1599.7195	1599.7195	R	D	219	232
PSM	YDERPGPSPLPHR	240	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=5263	30.867	3	1599.7195	1599.7195	R	D	219	232
PSM	YHGHSMSDPGVSYR	241	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3078	18.264	3	1687.645	1687.6450	R	T	258	272
PSM	QLHEYETELEDERK	242	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=12310	73.88455	3	1802.8222	1800.8162	R	Q	1597	1611
PSM	TLVHSSSDGHID	243	sp|Q8N5C8|TAB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	7-UNIMOD:21	ms_run[1]:scan=4229	24.889453333333332	2	1346.5501	1346.5499	R	P	97	109
PSM	RHSEQVANGPTPPPR	244	sp|A6ND36|FA83G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	3-UNIMOD:21	ms_run[1]:scan=2696	16.093715	3	1722.7832	1721.7992	R	R	632	647
PSM	NHPGCIPLEGPHSISPETTVTSR	245	sp|Q5TC79|ZBT37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=11709	69.965575	3	2566.172200	2565.168303	K	G	451	474
PSM	SAPTAPTPPPPPPPATPR	246	sp|Q14202|ZMYM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:21	ms_run[1]:scan=7895	46.396545	2	1828.894795	1827.892051	R	K	811	829
PSM	KLSHDAESERED	247	sp|Q92766|RREB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	3-UNIMOD:21	ms_run[1]:scan=858	6.137173333333333	2	1494.5999	1494.5983	R	P	173	185
PSM	RPDHSGGSPSPPTSEPAR	248	sp|Q8TAD8|SNIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:21	ms_run[1]:scan=1717	10.229591666666668	2	1909.809869	1910.827219	R	S	45	63
PSM	FASDDEHDEHDENGATGPVKR	249	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=3827	22.637716666666666	3	2405.944241	2404.955726	K	A	364	385
PSM	AAFHHLSAPALLSAQTR	250	sp|Q8IVE3|PKHH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=13075	79.089	3	1869.9251	1869.9251	K	G	1452	1469
PSM	ALQHTESPSETNKPHSK	251	sp|Q14669|TRIPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=727	5.6268	2	1969.8895	1969.8895	K	S	94	111
PSM	ALRPGDLPPSPDDVKR	252	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=8439	49.577	3	1811.8931	1811.8931	R	R	299	315
PSM	ARSPPQPLGELKR	253	sp|Q96FF7|MISP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=7693	45.195	3	1527.7923	1527.7923	R	F	89	102
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	254	sp|O94826|TOM70_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=7579	44.471	3	2465.0431	2465.0431	R	A	90	114
PSM	DLDKDDFLGR	255	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10182	60.272	2	1192.5724	1192.5724	K	C	724	734
PSM	DPDDHTVCHLLFANQTEK	256	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:4	ms_run[2]:scan=12844	77.527	3	2138.9691	2138.9691	K	D	174	192
PSM	DRSSPPPGYIPDELHQVAR	257	sp|Q9Y2U5|M3K2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12465	74.968	3	2213.0266	2213.0266	R	N	161	180
PSM	ERGSDASGQLFHGR	258	sp|P19174|PLCG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=5523	32.306	2	1595.6842	1595.6842	R	A	1230	1244
PSM	FHVGSAESMLHVR	259	sp|O75140-6|DEPD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=10023	59.175	2	1564.6858	1564.6858	R	P	575	588
PSM	FPPEDFRHSPEDFR	260	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=11465	68.398	2	1854.7727	1854.7727	R	R	567	581
PSM	FPPEDFRHSPEDFR	261	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=11620	69.404	2	1854.7727	1854.7727	R	R	567	581
PSM	FPPEDFRHSPEDFR	262	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=11786	70.459	2	1854.7727	1854.7727	R	R	567	581
PSM	GRPPAEKLSPNPPK	263	sp|P51531-2|SMCA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=3856	22.799	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GSQHSPTRPPVAAAAASLGSLPGPGAAR	264	sp|Q86VQ1|GLCI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=13879	84.717	3	2660.3184	2660.3184	R	G	75	103
PSM	HADHSSLTLGSGSSTTR	265	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:21	ms_run[2]:scan=4203	24.735	2	1792.7741	1792.7741	R	L	2522	2539
PSM	HAYHSVSTPPVYPPK	266	sp|Q8IZQ1-2|WDFY3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=6997	41.023	2	1758.8131	1758.8131	R	N	811	826
PSM	HHPVFSSSDPLEK	267	sp|Q86YV5|PRAG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=8496	49.917	3	1558.6817	1558.6817	R	A	872	885
PSM	HIHITQATETTTTR	268	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=3727	22.059	3	1688.7883	1688.7883	K	H	243	257
PSM	HLRLSLNEEGQCR	269	sp|Q9NRF2-2|SH2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=8133	47.793	3	1690.7611	1690.7611	K	V	576	589
PSM	HPSHSTTPSGPGDEVAR	270	sp|P53365-3|ARFP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=2015	11.887	3	1810.7636	1810.7636	R	G	32	49
PSM	HSPAPPPDPGFPAPSPPPADSPSEGFSLK	271	sp|Q6ZSZ5-2|ARHGI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	21-UNIMOD:21	ms_run[2]:scan=15205	94.481	3	2959.343	2959.3430	R	A	952	981
PSM	HTFMGVVSLGSPSGEVSHPR	272	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11110	66.154	3	2175.9773	2175.9773	R	K	318	338
PSM	HTSAREPSAFTLPPPR	273	sp|Q8TE67-2|ES8L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9899	58.376	3	1842.8778	1842.8778	R	R	212	228
PSM	KKDASDDLDDLNFFNQK	274	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15123	93.859	3	2011.9487	2011.9487	R	K	63	80
PSM	KKEPAITSQNSPEAR	275	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=1720	10.244	3	1734.8302	1734.8302	K	E	69	84
PSM	LKECCEKPLLEK	276	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=4499	26.509	2	1545.7895	1545.7895	K	S	299	311
PSM	LLHGAGGHLESPAR	277	sp|Q6NZ36-5|FAP20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=4789	28.216	2	1493.714	1493.7140	R	S	103	117
PSM	LMSLLTSPHQPPPPPPASASPSAVPNGPQSPK	278	sp|Q96RU3-5|FNBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35,30-UNIMOD:21	ms_run[2]:scan=12533	75.411	3	3279.5999	3279.5999	K	Q	330	362
PSM	REDQGPPCPSPVGGGDPLHR	279	sp|Q13563-2|PKD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=7792	45.813	3	2206.9579	2206.9579	R	H	157	177
PSM	REHASIDAQSGAGVPNPSTSASPK	280	sp|Q8IXJ6-5|SIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	18-UNIMOD:21	ms_run[2]:scan=6037	35.279	3	2443.1129	2443.1129	R	K	277	301
PSM	RESGPGIAPGPEPHGLTNK	281	sp|P21860-5|ERBB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=7113	41.679	3	1992.9419	1992.9419	K	K	337	356
PSM	RESPSPAPKPR	282	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=700	5.5167	2	1300.6289	1300.6289	K	K	448	459
PSM	RHTLAEVSTR	283	sp|P57059|SIK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=2497	14.823	3	1248.5976	1248.5976	R	L	471	481
PSM	RKSEPAVGPPR	284	sp|O94875-9|SRBS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=2708	16.174	2	1272.634	1272.6340	R	G	328	339
PSM	RLNHSPPQSSSR	285	sp|Q5T8P6-3|RBM26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=810	5.9325	2	1444.6572	1444.6572	R	Y	123	135
PSM	RLSESLHVVDENKNESK	286	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=7042	41.265	2	2062.9685	2062.9685	R	L	633	650
PSM	RNSSEASSGDFLDLK	287	sp|Q9UK76-3|JUPI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12586	75.776	2	1704.7356	1704.7356	R	G	39	54
PSM	RNSSEASSGDFLDLK	288	sp|Q9UK76-3|JUPI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=12585	75.772	3	1704.7356	1704.7356	R	G	39	54
PSM	RPDDVPLSLSPSKR	289	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=8694	51.083	3	1645.8189	1645.8189	K	A	234	248
PSM	RPQTLNSINKR	290	sp|Q6ZNC8-2|MBOA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=2795	16.79	3	1405.7191	1405.7191	R	K	333	344
PSM	RQSPSPSTRPIR	291	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=1812	10.756	2	1460.7249	1460.7249	R	R	711	723
PSM	RRPESAPAESSPSK	292	sp|Q07889|SOS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=630	5.2511	2	1577.7199	1577.7199	R	I	1157	1171
PSM	RRSFQDYTGQK	293	sp|Q9NP64-2|NO40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3626	21.482	3	1464.6511	1464.6511	R	I	88	99
PSM	RRSPPADAIPK	294	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3208	18.953	3	1286.6496	1286.6496	K	S	9	20
PSM	RRSPPADAIPK	295	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3546	21.002	3	1286.6496	1286.6496	K	S	9	20
PSM	RRTTDFSDFLSIVGCTK	296	sp|Q9UHD1|CHRD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=18564	120.25	3	2081.9605	2081.9605	K	G	45	62
PSM	RTSMGGTQQQFVEGVR	297	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7531	44.172	2	1875.8299	1875.8299	R	M	550	566
PSM	RVSEVEEEKEPVPQPLPSDDTR	298	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9695	57.155	3	2615.2116	2615.2116	R	V	446	468
PSM	RVSHDPFAQQR	299	sp|Q13546-2|RIPK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=4443	26.196	3	1419.6409	1419.6409	R	P	368	379
PSM	SKDQDDQKPGPSER	300	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=513	4.7735	3	1585.7332	1585.7332	K	S	467	481
PSM	SNSVEKPVSSILSR	301	sp|Q9UI08-4|EVL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=11397	67.977	3	1581.7764	1581.7764	R	T	329	343
PSM	SPPDQPAVPHPPPSTPIK	302	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:21	ms_run[2]:scan=8628	50.666	2	1940.9397	1940.9397	K	L	600	618
PSM	SRPFTVAASFQSTSVKSPK	303	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:21	ms_run[2]:scan=10814	64.197	3	2104.0354	2104.0354	R	T	588	607
PSM	SSSPEDPERDEEVLNHVLR	304	sp|Q8TE67-2|ES8L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=14230	87.26	3	2287.0118	2287.0118	R	D	229	248
PSM	STAQQELDGKPASPTPVIVASHTANK	305	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=9166	53.858	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	306	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=9396	55.292	3	2726.3276	2726.3276	R	E	818	844
PSM	TPKDSPGIPPSAGAHQLFR	307	sp|Q15418-3|KS6A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=10447	61.87	3	2054.9939	2054.9939	R	G	267	286
PSM	TPKDSPGIPPSANAHQLFR	308	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=11373	67.816	3	2112.0154	2112.0154	K	G	365	384
PSM	VERPPSPFSMAPQASLPPVPPR	309	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14702	90.696	3	2452.1974	2452.1974	K	L	478	500
PSM	VGAHAGEYGAEALER	310	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7156	41.932	2	1528.727	1528.7270	K	M	18	33
PSM	VKDDIESLHDK	311	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3510	20.802	3	1297.6514	1297.6514	R	F	612	623
PSM	YDERPGPSPLPHR	312	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=5075	29.859	3	1599.7195	1599.7195	R	D	219	232
PSM	YDERPGPSPLPHR	313	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=5445	31.885	3	1599.7195	1599.7195	R	D	219	232
PSM	QKTPPPVAPKPAVK	314	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5158	30.276401666666665	3	1519.8156	1519.8158	K	S	753	767
PSM	LKEFLEDYDDDRDD	315	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=11608	69.32356666666666	3	1786.7532	1786.7528	R	P	496	510
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	316	sp|Q9BUJ2|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	28-UNIMOD:21	ms_run[1]:scan=10015	59.12722666666667	3	3409.648587	3407.645226	R	N	691	722
PSM	HTFMGVVSLGSPSGEVSHPR	317	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:21	ms_run[1]:scan=11281	67.24661333333333	3	2160.964020	2159.982339	R	K	318	338
PSM	VGAHAGEYGAEALER	318	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7135	41.80604833333334	3	1528.726604	1528.727020	K	M	18	33
PSM	RPDGEGCVDENECQTKPGICENGR	319	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4,13-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=5166	30.319638333333337	3	2777.142372	2776.159926	R	C	2283	2307
PSM	RHSEQVANGPTPPPR	320	sp|A6ND36|FA83G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=2221	13.066871666666666	3	1722.785469	1721.799882	R	R	632	647
PSM	RHSEQVANGPTPPPR	321	sp|A6ND36|FA83G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=2143	12.616228333333334	3	1722.785469	1721.799882	R	R	632	647
PSM	VHTECCHGDLLECADDR	322	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=7886	46.35199	3	2086.814331	2085.830258	K	A	265	282
PSM	KPSGLNGEASKSQEMVHLVNK	323	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=6128	35.805690000000006	3	2349.105151	2348.119561	R	E	695	716
PSM	RKSQVNGEAGSYEMTNQHVK	324	sp|Q05D32|CTSL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=2941	17.574676666666665	3	2359.027962	2358.042374	R	Q	102	122
PSM	FASDDEHDEHDENGATGPVKR	325	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=4190	24.661896666666667	3	2405.941812	2404.955726	K	A	364	385
PSM	AAPPPPPPPPPLESSPR	326	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:21	ms_run[2]:scan=9644	56.863	3	1782.8706	1782.8706	K	V	606	623
PSM	ADDKETCFAEEGKK	327	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:4	ms_run[2]:scan=2394	14.201	3	1626.7196	1626.7196	K	L	585	599
PSM	ALRPGDLPPSPDDVKR	328	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=8268	48.567	3	1811.8931	1811.8931	R	R	299	315
PSM	ALRPGDLPPSPDDVKR	329	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=8614	50.589	3	1811.8931	1811.8931	R	R	299	315
PSM	AQFSVAGVHTVPGSPQAR	330	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:21	ms_run[2]:scan=10786	64.001	3	1887.8993	1887.8993	R	H	1164	1182
PSM	DAAAHLQTSHKPSAEDAEGQSPLSQK	331	sp|Q96F24-3|NRBF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	21-UNIMOD:21	ms_run[2]:scan=5934	34.662	3	2782.2559	2782.2559	K	Y	83	109
PSM	DPDDHTVCHLLFANQTEK	332	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4	ms_run[2]:scan=12852	77.569	2	2138.9691	2138.9691	K	D	174	192
PSM	EREEEDDYRQEEQR	333	sp|Q99795|GPA33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1717	10.23	2	1909.8038	1909.8038	R	S	294	308
PSM	ERGSDASGQLFHGR	334	sp|P19174|PLCG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=5516	32.273	3	1595.6842	1595.6842	R	A	1230	1244
PSM	FASDDEHDEHDENGATGPVK	335	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=4448	26.218	3	2248.8546	2248.8546	K	R	364	384
PSM	FHVGSAESMLHVR	336	sp|O75140-6|DEPD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=10196	60.349	2	1564.6858	1564.6858	R	P	575	588
PSM	FPPEDFRHSPEDFR	337	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=11768	70.353	3	1854.7727	1854.7727	R	R	567	581
PSM	GHVAHLEDDEGDDDESK	338	sp|Q8IVH8-3|M4K3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1943	11.465	3	1866.7504	1866.7504	R	H	386	403
PSM	GRPPAEKLSPNPPNLTK	339	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=7964	46.798	3	1894.9666	1894.9666	R	K	1411	1428
PSM	GSALGDLAPSRPPSFSPCPAEDLFPGHR	340	sp|O75427|LRCH4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=18000	115.77	3	3014.3746	3014.3746	R	Y	266	294
PSM	GVTIPYRPKPSSSPVIFAGGQDR	341	sp|Q15366-6|PCBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=12987	78.471	3	2508.2526	2508.2526	K	Y	173	196
PSM	GVVDSDDLPLNVSR	342	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12941	78.153	3	1484.7471	1484.7471	K	E	435	449
PSM	HAPSLHGSTELLPLSR	343	sp|Q9H5N1-2|RABE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=12076	72.346	3	1793.8825	1793.8825	R	D	186	202
PSM	HEIVDTPPGPEHLQDK	344	sp|Q96S15-2|WDR24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=8315	48.857	3	1890.8513	1890.8513	R	A	576	592
PSM	HPPVLTPPDQEVIR	345	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=11792	70.49	3	1676.8287	1676.8287	R	N	636	650
PSM	HQIVEVAGDDKYGR	346	sp|Q07960|RHG01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5443	31.873	3	1585.7849	1585.7849	R	K	70	84
PSM	HQPSTPDPFLKPR	347	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=7897	46.409	3	1598.7606	1598.7606	R	C	2236	2249
PSM	HRLTPQEGLQAPGGSLR	348	sp|Q03989-5|ARI5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=8591	50.478	3	1895.9367	1895.9367	R	E	242	259
PSM	HRPSPPATPPPK	349	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2209	12.992	3	1440.6316	1440.6316	R	T	399	411
PSM	HVHLENATEYATLR	350	sp|Q96A22|CK052_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=8918	52.368	2	1732.7934	1732.7934	K	F	94	108
PSM	KASGPPVSELITK	351	sp|P16403|H12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10376	61.43	2	1405.7218	1405.7218	R	A	34	47
PSM	KHPGGGESDASPEAGSGGGGVALK	352	sp|Q9UHI5|LAT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=4275	25.165	3	2200.975	2200.9750	K	K	14	38
PSM	KHSQTDLVSR	353	sp|O14683|P5I11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1632	9.8411	2	1249.5816	1249.5816	K	L	12	22
PSM	KLQLERPVSPETQADLQR	354	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=10045	59.32	3	2187.1049	2187.1049	R	N	921	939
PSM	LDELRDEGK	355	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2528	15.015	2	1073.5353	1073.5353	K	A	206	215
PSM	LDELRDEGKASSAK	356	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2252	13.227	2	1517.7686	1517.7686	K	Q	206	220
PSM	LFRPPSPAPAAPGAR	357	sp|Q86U90|YRDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=9165	53.855	3	1583.7974	1583.7974	R	L	32	47
PSM	LLKPGEEPSEYTDEEDTKDHNK	358	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=6221	36.382	3	2653.1433	2653.1433	R	Q	200	222
PSM	LRLSPSPTSQR	359	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=6358	37.224	2	1400.6214	1400.6214	R	S	387	398
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	360	sp|Q0JRZ9-3|FCHO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=16874	106.99	3	3062.559	3062.5590	K	A	444	473
PSM	LTRPFPTGTPPPLPPK	361	sp|Q9BQI5|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=12381	74.378	3	1794.9434	1794.9434	K	N	239	255
PSM	NRNSNVIPYDYNR	362	sp|P08575-4|PTPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=9009	52.912	2	1703.7417	1703.7417	K	V	811	824
PSM	PGAEGAPLLPPPLPPPSPPGSGR	363	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=15589	97.358	3	2237.1246	2237.1246	R	G	27	50
PSM	PGAEGAPLLPPPLPPPSPPGSGR	364	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=15927	99.927	2	2237.1246	2237.1246	R	G	27	50
PSM	PHVLSHKESLVY	365	sp|Q9Y4F1|FARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=8118	47.703	2	1487.7174	1487.7174	R	-	1034	1046
PSM	RASLLGDMHFR	366	sp|P51116|FXR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=8230	48.346	3	1397.6275	1397.6275	K	S	190	201
PSM	RESGPGIAPGPEPHGLTNK	367	sp|P21860-5|ERBB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=7132	41.791	2	1992.9419	1992.9419	K	K	337	356
PSM	RGSHPYIDFR	368	sp|Q13946-3|PDE7A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8559	50.297	3	1326.587	1326.5870	R	I	82	92
PSM	RHSYAGEQPETVPYLLLNR	369	sp|Q5T0W9|FA83B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=15722	98.365	3	2322.1158	2322.1158	K	A	386	405
PSM	RHVLSDLEDDEVR	370	sp|Q8N4C6-4|NIN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=11814	70.64	3	1661.741	1661.7410	R	D	1124	1137
PSM	RHVLSDLEDDEVR	371	sp|Q8N4C6-4|NIN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=11823	70.699	2	1661.741	1661.7410	R	D	1124	1137
PSM	RIQQHVGEEASPR	372	sp|Q8TER5-2|ARH40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=1496	9.1648	2	1585.7362	1585.7362	R	G	237	250
PSM	RKSEPAVGPPR	373	sp|O94875-9|SRBS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1725	10.274	3	1272.634	1272.6340	R	G	328	339
PSM	RKSEPAVGPPR	374	sp|O94875-9|SRBS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2740	16.409	3	1272.634	1272.6340	R	G	328	339
PSM	RLSKPGTAAELR	375	sp|Q5JSL3|DOC11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=4456	26.263	3	1377.713	1377.7130	K	Q	10	22
PSM	RNDHDDDEDEEVISK	376	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2803	16.827	3	1814.7555	1814.7555	K	T	341	356
PSM	RPLLGASNQALAR	377	sp|P11678|PERE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7233	42.432	3	1365.7841	1365.7841	R	W	157	170
PSM	RQSVSGLHR	378	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1344	8.4303	2	1118.5346	1118.5346	K	Y	429	438
PSM	RRPSLLSEFQPGNER	379	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=12299	73.81	3	1864.8945	1864.8945	R	S	64	79
PSM	RRSAEDELAMR	380	sp|Q13868-3|EXOS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=2463	14.614	3	1428.6181	1428.6181	R	G	92	103
PSM	RSSGREEDDEELLR	381	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=6008	35.126	3	1769.7581	1769.7581	R	R	208	222
PSM	RSSKEEAEMAYK	382	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1063	7.0187	2	1523.6327	1523.6327	K	D	733	745
PSM	RSSLPLDHGSPAQENPESEK	383	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=6942	40.736	3	2257.0012	2257.0012	R	S	1276	1296
PSM	SHHAPMSPGSSGGGGQPLAR	384	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2426	14.383	3	1982.8418	1982.8418	R	T	357	377
PSM	SLSSSLQAPVVSTVGMQR	385	sp|P35900|K1C20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=14277	87.599	2	1941.9231	1941.9231	R	L	11	29
PSM	SLSSSLQAPVVSTVGMQR	386	sp|P35900|K1C20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=14297	87.737	3	1941.9231	1941.9231	R	L	11	29
PSM	SPPRPSPGGLHYSDEDICNK	387	sp|Q7Z5N4-3|SDK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=8854	52	3	2304.9835	2304.9835	R	Y	2065	2085
PSM	SRSPLHPMSEIPR	388	sp|Q9NVW2-2|RNF12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=6127	35.803	3	1601.7385	1601.7385	R	R	87	100
PSM	SSVVSPSHPPPAPPLGSPPGPK	389	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=10994	65.378	3	2168.0667	2168.0667	R	P	292	314
PSM	TLVHSSSDGHIDPQHAAGK	390	sp|Q8N5C8-2|TAB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=4296	25.278	2	2035.9113	2035.9113	R	Q	97	116
PSM	TVHRSPLLLGAQR	391	sp|Q96DR7-3|ARHGQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=6850	40.168	3	1526.8083	1526.8083	R	R	76	89
PSM	VEQHVVDGKER	392	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=903	6.3191	2	1294.663	1294.6630	K	T	358	369
PSM	VERPPSPFSMAPQASLPPVPPR	393	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14838	91.703	3	2452.1974	2452.1974	K	L	478	500
PSM	VKSPGGPGSHVR	394	sp|O75382-4|TRIM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=908	6.3443	3	1256.6027	1256.6027	R	Q	316	328
PSM	RRTTQIINITMTK	395	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=7859	46.19705166666667	3	1671.853036	1670.853892	R	K	1809	1822
PSM	LMSLLTSPHQPPPPPPASASPSAVPNGPQSPK	396	sp|Q96RU3|FNBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:35,30-UNIMOD:21	ms_run[1]:scan=12688	76.46744333333334	3	3281.586416	3279.599916	K	Q	330	362
PSM	RHSEQVANGPTPPPR	397	sp|A6ND36|FA83G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	3-UNIMOD:21	ms_run[1]:scan=2543	15.088165	3	1722.7832	1721.7992	R	R	632	647
PSM	VLAHFRPVEDEDTETQDPK	398	sp|O43745|CHP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:21	ms_run[1]:scan=8584	50.43893833333333	3	2305.028319	2305.026372	R	K	86	105
PSM	RKGEEVTPISAIR	399	sp|Q9Y2J2|E41L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:21	ms_run[1]:scan=6870	40.29548833333334	3	1534.786279	1534.786857	R	H	486	499
PSM	ILMHHIPEQTTQLLK	400	sp|Q9H270|VPS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:35,10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=8023	47.170195	3	1978.903368	1976.919602	K	G	551	566
PSM	RRPEASPVQK	401	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:21	ms_run[1]:scan=648	5.320666666666666	2	1246.619215	1246.618335	R	K	405	415
PSM	RKSEPAVGPPR	402	sp|O94875|SRBS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=3668	21.723698333333335	3	1272.634280	1272.633986	R	G	257	268
PSM	RKSELEFETLK	403	sp|Q5JSH3|WDR44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=9242	54.31333000000001	2	1458.714659	1458.711961	K	T	260	271