MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_NT_JPST000210
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\121102_CRC_T_Fr05.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\121102_CRC_T_Fr05.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q9NXV6|CARF_HUMAN	CDKN2A-interacting protein OS=Homo sapiens OX=9606 GN=CDKN2AIP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	47.0	null		0.05	47.0	2	1	0
PRT	sp|O43583|DENR_HUMAN	Density-regulated protein OS=Homo sapiens OX=9606 GN=DENR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	47.0	null	73-UNIMOD:21	0.14	47.0	4	1	0
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46.0	null	86-UNIMOD:21	0.06	46.0	2	1	0
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46.0	null	120-UNIMOD:21,100-UNIMOD:21,104-UNIMOD:4,102-UNIMOD:21	0.16	46.0	3	2	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46.0	null		0.02	46.0	2	1	0
PRT	sp|Q9UH62|ARMX3_HUMAN	Armadillo repeat-containing X-linked protein 3 OS=Homo sapiens OX=9606 GN=ARMCX3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45.0	null	38-UNIMOD:35,52-UNIMOD:4	0.09	45.0	4	2	0
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	45.0	null	106-UNIMOD:21	0.18	45.0	5	2	0
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44.0	null	1574-UNIMOD:35,157-UNIMOD:21	0.03	44.0	3	3	3
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.03	44.0	6	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	43.0	null	246-UNIMOD:35	0.05	43.0	86	2	0
PRT	sp|P54725-2|RD23A_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null	123-UNIMOD:21,125-UNIMOD:21,128-UNIMOD:21	0.10	43.0	5	1	0
PRT	sp|P09972|ALDOC_HUMAN	Fructose-bisphosphate aldolase C OS=Homo sapiens OX=9606 GN=ALDOC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.07	43.0	1	1	1
PRT	sp|Q14C86-3|GAPD1_HUMAN	Isoform 3 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null	741-UNIMOD:4	0.01	43.0	1	1	1
PRT	sp|Q9Y262-2|EIF3L_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit L OS=Homo sapiens OX=9606 GN=EIF3L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|Q12874|SF3A3_HUMAN	Splicing factor 3A subunit 3 OS=Homo sapiens OX=9606 GN=SF3A3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43.0	null		0.04	43.0	1	1	1
PRT	sp|P10643|CO7_HUMAN	Complement component C7 OS=Homo sapiens OX=9606 GN=C7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	43.0	null	103-UNIMOD:4,109-UNIMOD:4	0.02	43.0	1	1	1
PRT	sp|Q7Z406|MYH14_HUMAN	Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	42.0	null	1934-UNIMOD:35,1451-UNIMOD:35,1088-UNIMOD:35,920-UNIMOD:4,1056-UNIMOD:35,1902-UNIMOD:28	0.08	42.0	13	10	8
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null	57-UNIMOD:21,129-UNIMOD:21,126-UNIMOD:21	0.29	42.0	19	2	0
PRT	sp|Q12797-10|ASPH_HUMAN	Isoform 10 of Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.05	42.0	6	2	1
PRT	sp|P49321|NASP_HUMAN	Nuclear autoantigenic sperm protein OS=Homo sapiens OX=9606 GN=NASP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	477-UNIMOD:21,480-UNIMOD:21,493-UNIMOD:35	0.08	42.0	3	3	3
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	42.0	null	445-UNIMOD:28	0.02	42.0	3	1	0
PRT	sp|Q9P2E9|RRBP1_HUMAN	Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.02	42.0	2	2	2
PRT	sp|O15258|RER1_HUMAN	Protein RER1 OS=Homo sapiens OX=9606 GN=RER1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null	92-UNIMOD:35	0.10	42.0	3	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null	383-UNIMOD:35,507-UNIMOD:4,514-UNIMOD:21	0.08	42.0	4	2	1
PRT	sp|P62258|1433E_HUMAN	14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	235-UNIMOD:35,1-UNIMOD:1	0.13	41.0	2	2	2
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	306-UNIMOD:21	0.08	41.0	6	4	2
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	100-UNIMOD:21,101-UNIMOD:4,126-UNIMOD:21,125-UNIMOD:21	0.26	41.0	11	3	1
PRT	sp|P08648|ITA5_HUMAN	Integrin alpha-5 OS=Homo sapiens OX=9606 GN=ITGA5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	220-UNIMOD:4	0.05	41.0	3	2	1
PRT	sp|Q6V0I7-2|FAT4_HUMAN	Isoform 2 of Protocadherin Fat 4 OS=Homo sapiens OX=9606 GN=FAT4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.01	41.0	2	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.07	41.0	4	2	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null	4346-UNIMOD:35,4348-UNIMOD:35,2412-UNIMOD:35	0.02	41.0	8	5	3
PRT	sp|Q9BY77|PDIP3_HUMAN	Polymerase delta-interacting protein 3 OS=Homo sapiens OX=9606 GN=POLDIP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	179-UNIMOD:28	0.05	41.0	3	1	0
PRT	sp|P23142-2|FBLN1_HUMAN	Isoform A of Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	354-UNIMOD:4,360-UNIMOD:4,367-UNIMOD:4	0.09	41.0	5	3	1
PRT	sp|P26232-3|CTNA2_HUMAN	Isoform 3 of Catenin alpha-2 OS=Homo sapiens OX=9606 GN=CTNNA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	654-UNIMOD:21,657-UNIMOD:21,651-UNIMOD:21	0.04	41.0	3	2	1
PRT	sp|Q9HAW4-2|CLSPN_HUMAN	Isoform 2 of Claspin OS=Homo sapiens OX=9606 GN=CLSPN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	83-UNIMOD:21,699-UNIMOD:4	0.03	41.0	3	2	1
PRT	sp|P01834|IGKC_HUMAN	Immunoglobulin kappa constant OS=Homo sapiens OX=9606 GN=IGKC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	41.0	null		0.20	41.0	2	1	0
PRT	sp|Q15181|IPYR_HUMAN	Inorganic pyrophosphatase OS=Homo sapiens OX=9606 GN=PPA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.08	41.0	1	1	1
PRT	sp|P01892|1A02_HUMAN	HLA class I histocompatibility antigen, A-2 alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	41.0	null	356-UNIMOD:21,359-UNIMOD:21,363-UNIMOD:4	0.07	41.0	2	1	0
PRT	sp|P29966|MARCS_HUMAN	Myristoylated alanine-rich C-kinase substrate OS=Homo sapiens OX=9606 GN=MARCKS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	83-UNIMOD:21,77-UNIMOD:21,81-UNIMOD:21	0.25	40.0	7	4	3
PRT	sp|Q9NQR4|NIT2_HUMAN	Omega-amidase NIT2 OS=Homo sapiens OX=9606 GN=NIT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	76-UNIMOD:4	0.07	40.0	3	1	0
PRT	sp|Q9NUJ1-3|ABHDA_HUMAN	Isoform 3 of Mycophenolic acid acyl-glucuronide esterase, mitochondrial OS=Homo sapiens OX=9606 GN=ABHD10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.10	40.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	1943-UNIMOD:21,1373-UNIMOD:35,1379-UNIMOD:4,988-UNIMOD:4,365-UNIMOD:35,172-UNIMOD:4,1910-UNIMOD:35,1878-UNIMOD:28,1899-UNIMOD:27,1915-UNIMOD:21,1916-UNIMOD:21	0.11	40.0	30	15	8
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	1016-UNIMOD:21,1252-UNIMOD:21,1932-UNIMOD:21	0.02	40.0	3	3	3
PRT	sp|Q5VSL9-4|STRP1_HUMAN	Isoform 4 of Striatin-interacting protein 1 OS=Homo sapiens OX=9606 GN=STRIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	59-UNIMOD:21	0.10	40.0	2	1	0
PRT	sp|Q99567|NUP88_HUMAN	Nuclear pore complex protein Nup88 OS=Homo sapiens OX=9606 GN=NUP88 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	391-UNIMOD:4	0.03	40.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	138-UNIMOD:35	0.05	40.0	7	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	720-UNIMOD:35	0.02	40.0	2	1	0
PRT	sp|Q92805|GOGA1_HUMAN	Golgin subfamily A member 1 OS=Homo sapiens OX=9606 GN=GOLGA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	40.0	null	30-UNIMOD:21,33-UNIMOD:21,37-UNIMOD:35	0.04	40.0	6	1	0
PRT	sp|Q14498-3|RBM39_HUMAN	Isoform 3 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.04	40.0	1	1	1
PRT	sp|P19634|SL9A1_HUMAN	Sodium/hydrogen exchanger 1 OS=Homo sapiens OX=9606 GN=SLC9A1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	764-UNIMOD:35,763-UNIMOD:35,599-UNIMOD:21,602-UNIMOD:21,606-UNIMOD:35	0.04	40.0	12	2	1
PRT	sp|P29972-4|AQP1_HUMAN	Isoform 4 of Aquaporin-1 OS=Homo sapiens OX=9606 GN=AQP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.14	40.0	2	1	0
PRT	sp|Q8N4Q1|MIA40_HUMAN	Mitochondrial intermembrane space import and assembly protein 40 OS=Homo sapiens OX=9606 GN=CHCHD4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.12	40.0	5	1	0
PRT	sp|P56181-2|NDUV3_HUMAN	Isoform 2 of NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFV3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	40.0	null	407-UNIMOD:35	0.04	40.0	2	1	0
PRT	sp|Q05086-2|UBE3A_HUMAN	Isoform I of Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	175-UNIMOD:4,180-UNIMOD:35	0.02	39.0	2	1	0
PRT	sp|Q96EB6-2|SIR1_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-1 OS=Homo sapiens OX=9606 GN=SIRT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.04	39.0	2	1	0
PRT	sp|P24821-5|TENA_HUMAN	Isoform 5 of Tenascin OS=Homo sapiens OX=9606 GN=TNC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	392-UNIMOD:4,394-UNIMOD:4,403-UNIMOD:4,64-UNIMOD:4,72-UNIMOD:21	0.02	39.0	2	2	1
PRT	sp|Q9C086|IN80B_HUMAN	INO80 complex subunit B OS=Homo sapiens OX=9606 GN=INO80B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	1	1	1
PRT	sp|Q5JTV8-2|TOIP1_HUMAN	Isoform 2 of Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	157-UNIMOD:21,154-UNIMOD:21	0.06	39.0	4	1	0
PRT	sp|O43182-5|RHG06_HUMAN	Isoform 5 of Rho GTPase-activating protein 6 OS=Homo sapiens OX=9606 GN=ARHGAP6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	159-UNIMOD:35	0.03	39.0	1	1	1
PRT	sp|Q5JRA6-2|TGO1_HUMAN	Isoform 2 of Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.01	39.0	2	1	0
PRT	sp|Q13177|PAK2_HUMAN	Serine/threonine-protein kinase PAK 2 OS=Homo sapiens OX=9606 GN=PAK2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.05	39.0	2	1	0
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	676-UNIMOD:21,642-UNIMOD:21,529-UNIMOD:21,702-UNIMOD:21,624-UNIMOD:21	0.13	39.0	34	5	1
PRT	sp|P39060-2|COIA1_HUMAN	Isoform 3 of Collagen alpha-1(XVIII) chain OS=Homo sapiens OX=9606 GN=COL18A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	290-UNIMOD:21	0.02	39.0	1	1	1
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	416-UNIMOD:21,417-UNIMOD:21	0.05	39.0	2	1	0
PRT	sp|Q6KC79-2|NIPBL_HUMAN	Isoform 2 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	1743-UNIMOD:35,1754-UNIMOD:4	0.01	39.0	1	1	1
PRT	sp|Q96S99|PKHF1_HUMAN	Pleckstrin homology domain-containing family F member 1 OS=Homo sapiens OX=9606 GN=PLEKHF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	239-UNIMOD:4	0.06	39.0	1	1	1
PRT	sp|Q86YP4-2|P66A_HUMAN	Isoform 2 of Transcriptional repressor p66-alpha OS=Homo sapiens OX=9606 GN=GATAD2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	100-UNIMOD:21,107-UNIMOD:21,114-UNIMOD:21	0.03	39.0	5	1	0
PRT	sp|Q92835-3|SHIP1_HUMAN	Isoform 3 of Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	606-UNIMOD:4	0.04	39.0	2	2	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	276-UNIMOD:35	0.03	39.0	6	2	1
PRT	sp|Q9UNE7|CHIP_HUMAN	E3 ubiquitin-protein ligase CHIP OS=Homo sapiens OX=9606 GN=STUB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	208-UNIMOD:35,211-UNIMOD:35	0.05	39.0	1	1	1
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	20-UNIMOD:35	0.03	39.0	3	3	3
PRT	sp|P68402|PA1B2_HUMAN	Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.10	39.0	2	1	0
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	602-UNIMOD:4,605-UNIMOD:35,589-UNIMOD:35,592-UNIMOD:35	0.06	38.0	10	3	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	38.0	null	369-UNIMOD:4,383-UNIMOD:35,591-UNIMOD:4,369-UNIMOD:385	0.04	38.0	5	2	1
PRT	sp|Q9UIG0-2|BAZ1B_HUMAN	Isoform 2 of Tyrosine-protein kinase BAZ1B OS=Homo sapiens OX=9606 GN=BAZ1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.01	38.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	1	1	1
PRT	sp|Q147X3-2|NAA30_HUMAN	Isoform 2 of N-alpha-acetyltransferase 30 OS=Homo sapiens OX=9606 GN=NAA30	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.06	38.0	2	1	0
PRT	sp|P50993|AT1A2_HUMAN	Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens OX=9606 GN=ATP1A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	372-UNIMOD:4	0.03	38.0	2	2	2
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	470-UNIMOD:35	0.04	38.0	11	3	1
PRT	sp|P45880-2|VDAC2_HUMAN	Isoform 2 of Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens OX=9606 GN=VDAC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	36-UNIMOD:4	0.07	38.0	1	1	1
PRT	sp|P04083|ANXA1_HUMAN	Annexin A1 OS=Homo sapiens OX=9606 GN=ANXA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.08	38.0	5	2	1
PRT	sp|Q86VX9-5|MON1A_HUMAN	Isoform 5 of Vacuolar fusion protein MON1 homolog A OS=Homo sapiens OX=9606 GN=MON1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	56-UNIMOD:21	0.04	38.0	3	1	0
PRT	sp|O76021|RL1D1_HUMAN	Ribosomal L1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=RSL1D1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	317-UNIMOD:21,96-UNIMOD:4	0.07	38.0	2	2	2
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	131-UNIMOD:35	0.18	38.0	8	7	6
PRT	sp|Q9UKF6|CPSF3_HUMAN	Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens OX=9606 GN=CPSF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	655-UNIMOD:4	0.04	38.0	3	2	1
PRT	sp|Q8IUC4-2|RHPN2_HUMAN	Isoform 2 of Rhophilin-2 OS=Homo sapiens OX=9606 GN=RHPN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	463-UNIMOD:21,466-UNIMOD:35,468-UNIMOD:4,465-UNIMOD:21	0.03	38.0	3	1	0
PRT	sp|P23142|FBLN1_HUMAN	Fibulin-1 OS=Homo sapiens OX=9606 GN=FBLN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38.0	null		0.03	38.0	3	1	0
PRT	sp|Q96GN5-5|CDA7L_HUMAN	Isoform 4 of Cell division cycle-associated 7-like protein OS=Homo sapiens OX=9606 GN=CDCA7L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	71-UNIMOD:21	0.05	37.0	1	1	1
PRT	sp|P30279|CCND2_HUMAN	G1/S-specific cyclin-D2 OS=Homo sapiens OX=9606 GN=CCND2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	271-UNIMOD:21	0.07	37.0	2	1	0
PRT	sp|Q14676-4|MDC1_HUMAN	Isoform 4 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	447-UNIMOD:21	0.04	37.0	2	2	2
PRT	sp|Q96TC7-2|RMD3_HUMAN	Isoform 2 of Regulator of microtubule dynamics protein 3 OS=Homo sapiens OX=9606 GN=RMDN3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	64-UNIMOD:21,73-UNIMOD:4	0.06	37.0	2	1	0
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.04	37.0	2	2	2
PRT	sp|P31937|3HIDH_HUMAN	3-hydroxyisobutyrate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBADH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|O43301|HS12A_HUMAN	Heat shock 70 kDa protein 12A OS=Homo sapiens OX=9606 GN=HSPA12A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	263-UNIMOD:21,251-UNIMOD:27	0.07	37.0	32	4	1
PRT	sp|Q9NYF8-2|BCLF1_HUMAN	Isoform 2 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	1	1	1
PRT	sp|O15511|ARPC5_HUMAN	Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	45-UNIMOD:4	0.23	37.0	2	2	2
PRT	sp|P22033|MUTA_HUMAN	Methylmalonyl-CoA mutase, mitochondrial OS=Homo sapiens OX=9606 GN=MUT PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	159-UNIMOD:35	0.02	37.0	1	1	1
PRT	sp|P12111-4|CO6A3_HUMAN	Isoform 4 of Collagen alpha-3(VI) chain OS=Homo sapiens OX=9606 GN=COL6A3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.02	37.0	3	3	3
PRT	sp|Q15293|RCN1_HUMAN	Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	37.0	null		0.05	37.0	6	1	0
PRT	sp|P02787|TRFE_HUMAN	Serotransferrin OS=Homo sapiens OX=9606 GN=TF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	387-UNIMOD:4,396-UNIMOD:4,246-UNIMOD:4,582-UNIMOD:4	0.06	37.0	3	3	3
PRT	sp|O75792|RNH2A_HUMAN	Ribonuclease H2 subunit A OS=Homo sapiens OX=9606 GN=RNASEH2A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|Q0VD83-3|APOBR_HUMAN	Isoform 3 of Apolipoprotein B receptor OS=Homo sapiens OX=9606 GN=APOBR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	476-UNIMOD:35	0.03	37.0	4	2	0
PRT	sp|O14818-2|PSA7_HUMAN	Isoform 2 of Proteasome subunit alpha type-7 OS=Homo sapiens OX=9606 GN=PSMA7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.09	37.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.06	37.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	43-UNIMOD:35,45-UNIMOD:35,1177-UNIMOD:21,1179-UNIMOD:35,1182-UNIMOD:21,1189-UNIMOD:35	0.04	37.0	6	3	0
PRT	sp|Q29RF7|PDS5A_HUMAN	Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens OX=9606 GN=PDS5A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	53-UNIMOD:35,55-UNIMOD:35	0.04	37.0	6	3	2
PRT	sp|Q86YS7|C2CD5_HUMAN	C2 domain-containing protein 5 OS=Homo sapiens OX=9606 GN=C2CD5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	659-UNIMOD:21	0.02	37.0	2	1	0
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	140-UNIMOD:21,151-UNIMOD:4	0.05	37.0	2	1	0
PRT	sp|P67809|YBOX1_HUMAN	Nuclease-sensitive element-binding protein 1 OS=Homo sapiens OX=9606 GN=YBX1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	167-UNIMOD:21,165-UNIMOD:21	0.15	37.0	4	3	2
PRT	sp|Q8WXH0-2|SYNE2_HUMAN	Isoform 2 of Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	766-UNIMOD:35	0.00	37.0	3	2	1
PRT	sp|Q14432|PDE3A_HUMAN	cGMP-inhibited 3',5'-cyclic phosphodiesterase A OS=Homo sapiens OX=9606 GN=PDE3A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null		0.01	37.0	1	1	1
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	694-UNIMOD:35	0.01	37.0	3	1	0
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	37.0	null	579-UNIMOD:28,583-UNIMOD:21	0.03	37.0	9	2	0
PRT	sp|P55060-4|XPO2_HUMAN	Isoform 4 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	5	2	0
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	939-UNIMOD:21,951-UNIMOD:35,220-UNIMOD:21,224-UNIMOD:21	0.05	36.0	2	2	2
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P61966|AP1S1_HUMAN	AP-1 complex subunit sigma-1A OS=Homo sapiens OX=9606 GN=AP1S1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.11	36.0	2	1	0
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	1
PRT	sp|P62633-8|CNBP_HUMAN	Isoform 8 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	60-UNIMOD:4,68-UNIMOD:4,71-UNIMOD:4	0.09	36.0	1	1	1
PRT	sp|O94760-2|DDAH1_HUMAN	Isoform 2 of N(G),N(G)-dimethylarginine dimethylaminohydrolase 1 OS=Homo sapiens OX=9606 GN=DDAH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	2	1	0
PRT	sp|Q15005|SPCS2_HUMAN	Signal peptidase complex subunit 2 OS=Homo sapiens OX=9606 GN=SPCS2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	151-UNIMOD:35	0.08	36.0	2	1	0
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	363-UNIMOD:21,1106-UNIMOD:21,1115-UNIMOD:21,1110-UNIMOD:21,610-UNIMOD:21	0.03	36.0	7	4	2
PRT	sp|O94887-3|FARP2_HUMAN	Isoform 3 of FERM, ARHGEF and pleckstrin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FARP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	439-UNIMOD:21	0.03	36.0	1	1	1
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	1196-UNIMOD:4,1992-UNIMOD:21	0.02	36.0	5	5	5
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	4	3	2
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	1389-UNIMOD:4,2262-UNIMOD:4	0.04	36.0	8	7	6
PRT	sp|P55196-1|AFAD_HUMAN	Isoform 2 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	1725-UNIMOD:4,1679-UNIMOD:21,1681-UNIMOD:21	0.02	36.0	4	2	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	1620-UNIMOD:35,3902-UNIMOD:35,2806-UNIMOD:4,1418-UNIMOD:35,2357-UNIMOD:35	0.06	36.0	28	17	11
PRT	sp|Q86VM9-2|ZCH18_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	97-UNIMOD:4,59-UNIMOD:21	0.08	36.0	4	4	3
PRT	sp|Q92851-7|CASPA_HUMAN	Isoform 7 of Caspase-10 OS=Homo sapiens OX=9606 GN=CASP10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	169-UNIMOD:4,174-UNIMOD:4	0.06	36.0	2	1	0
PRT	sp|P23229-4|ITA6_HUMAN	Isoform Alpha-6X2A of Integrin alpha-6 OS=Homo sapiens OX=9606 GN=ITGA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	621-UNIMOD:4,627-UNIMOD:4	0.03	36.0	2	2	2
PRT	sp|O43264|ZW10_HUMAN	Centromere/kinetochore protein zw10 homolog OS=Homo sapiens OX=9606 GN=ZW10 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q96K21-4|ANCHR_HUMAN	Isoform 4 of Abscission/NoCut checkpoint regulator OS=Homo sapiens OX=9606 GN=ZFYVE19	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	3	1	0
PRT	sp|Q9UPT8|ZC3H4_HUMAN	Zinc finger CCCH domain-containing protein 4 OS=Homo sapiens OX=9606 GN=ZC3H4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	481-UNIMOD:35,1104-UNIMOD:21,1114-UNIMOD:21	0.04	36.0	2	2	2
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	44-UNIMOD:35	0.08	36.0	1	1	1
PRT	sp|P11413|G6PD_HUMAN	Glucose-6-phosphate 1-dehydrogenase OS=Homo sapiens OX=9606 GN=G6PD PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|Q8WU90|ZC3HF_HUMAN	Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null		0.07	36.0	2	2	2
PRT	sp|P18859|ATP5J_HUMAN	ATP synthase-coupling factor 6, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.19	36.0	1	1	1
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	886-UNIMOD:21	0.02	36.0	3	3	3
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	2	2	2
PRT	sp|Q9ULU4-4|PKCB1_HUMAN	Isoform 4 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	56-UNIMOD:21,58-UNIMOD:35	0.03	36.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	161-UNIMOD:4,171-UNIMOD:4	0.06	36.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	360-UNIMOD:21,362-UNIMOD:21	0.01	36.0	3	2	1
PRT	sp|P84090|ERH_HUMAN	Enhancer of rudimentary homolog OS=Homo sapiens OX=9606 GN=ERH PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	28-UNIMOD:4,33-UNIMOD:4,29-UNIMOD:35	0.17	36.0	3	1	0
PRT	sp|Q96LR5|UB2E2_HUMAN	Ubiquitin-conjugating enzyme E2 E2 OS=Homo sapiens OX=9606 GN=UBE2E2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	2094-UNIMOD:4,717-UNIMOD:4	0.02	36.0	6	4	3
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	990-UNIMOD:35,1356-UNIMOD:35,1917-UNIMOD:35	0.05	36.0	16	7	2
PRT	sp|P26640-2|SYVC_HUMAN	Isoform 2 of Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.06	36.0	1	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	782-UNIMOD:21	0.03	36.0	3	2	1
PRT	sp|Q9UM54-5|MYO6_HUMAN	Isoform 5 of Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	5	1	0
PRT	sp|Q96HE7|ERO1A_HUMAN	ERO1-like protein alpha OS=Homo sapiens OX=9606 GN=ERO1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	131-UNIMOD:4	0.07	36.0	2	2	2
PRT	sp|P30101|PDIA3_HUMAN	Protein disulfide-isomerase A3 OS=Homo sapiens OX=9606 GN=PDIA3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	6	3	1
PRT	sp|P24821|TENA_HUMAN	Tenascin OS=Homo sapiens OX=9606 GN=TNC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36.0	null	392-UNIMOD:385,392-UNIMOD:4,394-UNIMOD:4,403-UNIMOD:4	0.01	36.0	1	1	0
PRT	sp|P54725|RD23A_HUMAN	UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	36.0	null	123-UNIMOD:21,120-UNIMOD:27	0.09	36.0	3	1	0
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	607-UNIMOD:21,772-UNIMOD:21	0.03	35.0	4	2	1
PRT	sp|Q5VWQ8-3|DAB2P_HUMAN	Isoform 3 of Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	259-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	113-UNIMOD:21,128-UNIMOD:4	0.03	35.0	3	1	0
PRT	sp|O60238-2|BNI3L_HUMAN	Isoform 2 of BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like OS=Homo sapiens OX=9606 GN=BNIP3L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	78-UNIMOD:21	0.09	35.0	1	1	1
PRT	sp|P61224-3|RAP1B_HUMAN	Isoform 3 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	92-UNIMOD:35	0.08	35.0	38	1	0
PRT	sp|P13796|PLSL_HUMAN	Plastin-2 OS=Homo sapiens OX=9606 GN=LCP1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	58-UNIMOD:35,12-UNIMOD:35	0.05	35.0	3	2	1
PRT	sp|P63104|1433Z_HUMAN	14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.14	35.0	3	2	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	631-UNIMOD:21,623-UNIMOD:21	0.03	35.0	2	1	0
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	499-UNIMOD:21,503-UNIMOD:35	0.02	35.0	9	1	0
PRT	sp|O43396|TXNL1_HUMAN	Thioredoxin-like protein 1 OS=Homo sapiens OX=9606 GN=TXNL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.06	35.0	2	1	0
PRT	sp|O00193|SMAP_HUMAN	Small acidic protein OS=Homo sapiens OX=9606 GN=SMAP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	88-UNIMOD:35	0.09	35.0	3	1	0
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	2	1	0
PRT	sp|Q99613-2|EIF3C_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	1	1	1
PRT	sp|Q9UBU9-2|NXF1_HUMAN	Isoform 2 of Nuclear RNA export factor 1 OS=Homo sapiens OX=9606 GN=NXF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	61-UNIMOD:35	0.05	35.0	1	1	1
PRT	sp|Q5VZ89-7|DEN4C_HUMAN	Isoform 2 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	953-UNIMOD:21	0.01	35.0	7	1	0
PRT	sp|P09884|DPOLA_HUMAN	DNA polymerase alpha catalytic subunit OS=Homo sapiens OX=9606 GN=POLA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null		0.02	35.0	4	1	0
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P42566-2|EPS15_HUMAN	Isoform 2 of Epidermal growth factor receptor substrate 15 OS=Homo sapiens OX=9606 GN=EPS15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|P78527-2|PRKDC_HUMAN	Isoform 2 of DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	3206-UNIMOD:35	0.01	35.0	1	1	1
PRT	sp|Q9Y4L1|HYOU1_HUMAN	Hypoxia up-regulated protein 1 OS=Homo sapiens OX=9606 GN=HYOU1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	3	3	3
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	255-UNIMOD:21,226-UNIMOD:21,224-UNIMOD:27	0.08	35.0	36	5	1
PRT	sp|Q6P3S1|DEN1B_HUMAN	DENN domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DENND1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.02	35.0	2	1	0
PRT	sp|Q13442|HAP28_HUMAN	28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens OX=9606 GN=PDAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	1	1	1
PRT	sp|Q92625|ANS1A_HUMAN	Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	622-UNIMOD:21,633-UNIMOD:4,641-UNIMOD:35	0.02	35.0	1	1	1
PRT	sp|Q9BY89-2|K1671_HUMAN	Isoform 2 of Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	115-UNIMOD:21,119-UNIMOD:35,128-UNIMOD:4,103-UNIMOD:21,105-UNIMOD:21,110-UNIMOD:21	0.10	35.0	5	1	0
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	270-UNIMOD:4	0.08	35.0	2	1	0
PRT	sp|O43399-6|TPD54_HUMAN	Isoform 6 of Tumor protein D54 OS=Homo sapiens OX=9606 GN=TPD52L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.10	35.0	1	1	1
PRT	sp|Q9NYV4-2|CDK12_HUMAN	Isoform 2 of Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.01	35.0	1	1	1
PRT	sp|P09327-2|VILI_HUMAN	Isoform 2 of Villin-1 OS=Homo sapiens OX=9606 GN=VIL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.04	35.0	2	1	0
PRT	sp|P36871|PGM1_HUMAN	Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	160-UNIMOD:4	0.08	35.0	3	3	3
PRT	sp|Q9HBH5|RDH14_HUMAN	Retinol dehydrogenase 14 OS=Homo sapiens OX=9606 GN=RDH14 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.05	35.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	2753-UNIMOD:21	0.01	35.0	3	3	3
PRT	sp|Q03701|CEBPZ_HUMAN	CCAAT/enhancer-binding protein zeta OS=Homo sapiens OX=9606 GN=CEBPZ PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	629-UNIMOD:21,644-UNIMOD:35	0.03	35.0	2	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=HIST1H1E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	35.0	2	1	0
PRT	sp|P67870|CSK2B_HUMAN	Casein kinase II subunit beta OS=Homo sapiens OX=9606 GN=CSNK2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	23-UNIMOD:4	0.08	35.0	1	1	1
PRT	sp|Q9Y4G2|PKHM1_HUMAN	Pleckstrin homology domain-containing family M member 1 OS=Homo sapiens OX=9606 GN=PLEKHM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	280-UNIMOD:21,284-UNIMOD:4,288-UNIMOD:35,290-UNIMOD:4	0.02	35.0	1	1	1
PRT	sp|P42765|THIM_HUMAN	3-ketoacyl-CoA thiolase, mitochondrial OS=Homo sapiens OX=9606 GN=ACAA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	203-UNIMOD:35	0.05	34.0	2	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.12	34.0	3	3	3
PRT	sp|Q9NUQ8-2|ABCF3_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 3 OS=Homo sapiens OX=9606 GN=ABCF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q86XL3|ANKL2_HUMAN	Ankyrin repeat and LEM domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ANKLE2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	646-UNIMOD:35	0.02	34.0	2	1	0
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	79-UNIMOD:35	0.04	34.0	4	2	0
PRT	sp|P55884|EIF3B_HUMAN	Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	3	2	1
PRT	sp|Q99707-2|METH_HUMAN	Isoform 2 of Methionine synthase OS=Homo sapiens OX=9606 GN=MTR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1074-UNIMOD:35	0.01	34.0	1	1	1
PRT	sp|P62633-7|CNBP_HUMAN	Isoform 7 of Cellular nucleic acid-binding protein OS=Homo sapiens OX=9606 GN=CNBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	50-UNIMOD:4,57-UNIMOD:4,60-UNIMOD:4	0.09	34.0	2	1	0
PRT	sp|O43237-2|DC1L2_HUMAN	Isoform 2 of Cytoplasmic dynein 1 light intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1LI2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	108-UNIMOD:35,114-UNIMOD:4	0.05	34.0	2	1	0
PRT	sp|Q96M32|KAD7_HUMAN	Adenylate kinase 7 OS=Homo sapiens OX=9606 GN=AK7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q14697-2|GANAB_HUMAN	Isoform 2 of Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|O43493-4|TGON2_HUMAN	Isoform 4 of Trans-Golgi network integral membrane protein 2 OS=Homo sapiens OX=9606 GN=TGOLN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	70-UNIMOD:21,68-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|Q4VCS5-2|AMOT_HUMAN	Isoform 2 of Angiomotin OS=Homo sapiens OX=9606 GN=AMOT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	305-UNIMOD:21,303-UNIMOD:21	0.03	34.0	2	1	0
PRT	sp|Q8WWV3-3|RT4I1_HUMAN	Isoform 3 of Reticulon-4-interacting protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=RTN4IP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	128-UNIMOD:35,130-UNIMOD:4	0.07	34.0	2	1	0
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	2	2	2
PRT	sp|P25940|CO5A3_HUMAN	Collagen alpha-3(V) chain OS=Homo sapiens OX=9606 GN=COL5A3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	351-UNIMOD:35	0.01	34.0	1	1	1
PRT	sp|Q9NR99|MXRA5_HUMAN	Matrix-remodeling-associated protein 5 OS=Homo sapiens OX=9606 GN=MXRA5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	2324-UNIMOD:4	0.01	34.0	2	2	2
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	504-UNIMOD:4,505-UNIMOD:4	0.02	34.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	185-UNIMOD:35,1443-UNIMOD:21,913-UNIMOD:35	0.05	34.0	6	5	4
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	229-UNIMOD:4	0.04	34.0	1	1	1
PRT	sp|Q9H8L6|MMRN2_HUMAN	Multimerin-2 OS=Homo sapiens OX=9606 GN=MMRN2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	2	2
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	347-UNIMOD:35,426-UNIMOD:21	0.08	34.0	3	2	1
PRT	sp|Q13439-3|GOGA4_HUMAN	Isoform 3 of Golgin subfamily A member 4 OS=Homo sapiens OX=9606 GN=GOLGA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	2	1	0
PRT	sp|P02760|AMBP_HUMAN	Protein AMBP OS=Homo sapiens OX=9606 GN=AMBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	337-UNIMOD:4	0.05	34.0	2	1	0
PRT	sp|P54753|EPHB3_HUMAN	Ephrin type-B receptor 3 OS=Homo sapiens OX=9606 GN=EPHB3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q76FK4-2|NOL8_HUMAN	Isoform 2 of Nucleolar protein 8 OS=Homo sapiens OX=9606 GN=NOL8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	2	2	2
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	591-UNIMOD:21,604-UNIMOD:4,772-UNIMOD:4	0.02	34.0	3	3	3
PRT	sp|O75676-2|KS6A4_HUMAN	Isoform 2 of Ribosomal protein S6 kinase alpha-4 OS=Homo sapiens OX=9606 GN=RPS6KA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	10-UNIMOD:4,1-UNIMOD:35	0.02	34.0	2	2	2
PRT	sp|Q9H0W8-2|SMG9_HUMAN	Isoform 2 of Protein SMG9 OS=Homo sapiens OX=9606 GN=SMG9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	118-UNIMOD:21,117-UNIMOD:21	0.05	34.0	2	1	0
PRT	sp|Q15287-3|RNPS1_HUMAN	Isoform 3 of RNA-binding protein with serine-rich domain 1 OS=Homo sapiens OX=9606 GN=RNPS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|P50402|EMD_HUMAN	Emerin OS=Homo sapiens OX=9606 GN=EMD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	1011-UNIMOD:4,176-UNIMOD:4	0.02	34.0	3	3	2
PRT	sp|P55957|BID_HUMAN	BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	2	1	0
PRT	sp|Q13765|NACA_HUMAN	Nascent polypeptide-associated complex subunit alpha OS=Homo sapiens OX=9606 GN=NACA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.07	34.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	249-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|O75369-5|FLNB_HUMAN	Isoform 5 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	604-UNIMOD:4,2057-UNIMOD:4	0.02	34.0	4	3	2
PRT	sp|Q709C8-3|VP13C_HUMAN	Isoform 3 of Vacuolar protein sorting-associated protein 13C OS=Homo sapiens OX=9606 GN=VPS13C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1329-UNIMOD:4	0.00	34.0	1	1	1
PRT	sp|Q6AI12|ANR40_HUMAN	Ankyrin repeat domain-containing protein 40 OS=Homo sapiens OX=9606 GN=ANKRD40 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	93-UNIMOD:35	0.06	34.0	1	1	1
PRT	sp|Q12792-4|TWF1_HUMAN	Isoform 4 of Twinfilin-1 OS=Homo sapiens OX=9606 GN=TWF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	2	1	0
PRT	sp|Q00535-2|CDK5_HUMAN	Isoform 2 of Cyclin-dependent-like kinase 5 OS=Homo sapiens OX=9606 GN=CDK5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	3	1	0
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null		0.02	34.0	9	1	0
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	208-UNIMOD:21,211-UNIMOD:21	0.09	34.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	352-UNIMOD:35	0.09	34.0	5	4	3
PRT	sp|Q15427|SF3B4_HUMAN	Splicing factor 3B subunit 4 OS=Homo sapiens OX=9606 GN=SF3B4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|P53367-3|ARFP1_HUMAN	Isoform 3 of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.10	34.0	1	1	1
PRT	sp|Q9BWS9-3|CHID1_HUMAN	Isoform 3 of Chitinase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHID1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|P60033|CD81_HUMAN	CD81 antigen OS=Homo sapiens OX=9606 GN=CD81 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.09	34.0	1	1	1
PRT	sp|P30622-2|CLIP1_HUMAN	Isoform 3 of CAP-Gly domain-containing linker protein 1 OS=Homo sapiens OX=9606 GN=CLIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.01	34.0	2	1	0
PRT	sp|Q9HCY8|S10AE_HUMAN	Protein S100-A14 OS=Homo sapiens OX=9606 GN=S100A14 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.15	34.0	1	1	1
PRT	sp|P14780|MMP9_HUMAN	Matrix metalloproteinase-9 OS=Homo sapiens OX=9606 GN=MMP9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	256-UNIMOD:4	0.03	34.0	5	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=HIST1H1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	18-UNIMOD:21,2-UNIMOD:1	0.09	34.0	11	3	2
PRT	sp|Q9C0F1|CEP44_HUMAN	Centrosomal protein of 44 kDa OS=Homo sapiens OX=9606 GN=CEP44 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	324-UNIMOD:21	0.07	34.0	1	1	1
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	339-UNIMOD:21,351-UNIMOD:4	0.03	34.0	5	1	0
PRT	sp|Q6NSI3|FA53A_HUMAN	Protein FAM53A OS=Homo sapiens OX=9606 GN=FAM53A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	303-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|P01024|CO3_HUMAN	Complement C3 OS=Homo sapiens OX=9606 GN=C3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1158-UNIMOD:4	0.03	34.0	3	3	3
PRT	sp|P46060|RAGP1_HUMAN	Ran GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=RANGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.03	34.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	77-UNIMOD:4,86-UNIMOD:4,58-UNIMOD:4,414-UNIMOD:28,416-UNIMOD:4	0.10	34.0	18	4	3
PRT	sp|Q15022|SUZ12_HUMAN	Polycomb protein SUZ12 OS=Homo sapiens OX=9606 GN=SUZ12 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1888-UNIMOD:35,1889-UNIMOD:4,1895-UNIMOD:4,908-UNIMOD:4,914-UNIMOD:4,921-UNIMOD:4,2111-UNIMOD:4,2128-UNIMOD:35,2131-UNIMOD:4	0.02	34.0	3	3	3
PRT	sp|P30291-2|WEE1_HUMAN	Isoform 2 of Wee1-like protein kinase OS=Homo sapiens OX=9606 GN=WEE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	2	1	0
PRT	sp|Q8ND24|RN214_HUMAN	RING finger protein 214 OS=Homo sapiens OX=9606 GN=RNF214 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	1	1	1
PRT	sp|Q9Y383-3|LC7L2_HUMAN	Isoform 3 of Putative RNA-binding protein Luc7-like 2 OS=Homo sapiens OX=9606 GN=LUC7L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|Q9UM54|MYO6_HUMAN	Unconventional myosin-VI OS=Homo sapiens OX=9606 GN=MYO6 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	2	1	0
PRT	sp|P01112|RASH_HUMAN	GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null	111-UNIMOD:35	0.07	34.0	4	1	0
PRT	sp|Q9P289|STK26_HUMAN	Serine/threonine-protein kinase 26 OS=Homo sapiens OX=9606 GN=STK26 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null	300-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|Q9NZU5|LMCD1_HUMAN	LIM and cysteine-rich domains protein 1 OS=Homo sapiens OX=9606 GN=LMCD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	52-UNIMOD:385,52-UNIMOD:4,58-UNIMOD:4	0.05	34.0	1	1	1
PRT	sp|Q7Z333|SETX_HUMAN	Probable helicase senataxin OS=Homo sapiens OX=9606 GN=SETX PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null		0.01	34.0	2	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	101-UNIMOD:21	0.24	33.0	9	3	1
PRT	sp|P29144|TPP2_HUMAN	Tripeptidyl-peptidase 2 OS=Homo sapiens OX=9606 GN=TPP2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	209-UNIMOD:4	0.01	33.0	2	1	0
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q96BZ8|LENG1_HUMAN	Leukocyte receptor cluster member 1 OS=Homo sapiens OX=9606 GN=LENG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.06	33.0	1	1	1
PRT	sp|Q86US8-3|EST1A_HUMAN	Isoform 3 of Telomerase-binding protein EST1A OS=Homo sapiens OX=9606 GN=SMG6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q9NZM1-2|MYOF_HUMAN	Isoform 2 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	8	4	2
PRT	sp|Q14980-4|NUMA1_HUMAN	Isoform 4 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q14766-3|LTBP1_HUMAN	Isoform 3 of Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	1198-UNIMOD:4,1049-UNIMOD:4,1057-UNIMOD:4	0.02	33.0	5	2	1
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q14376-2|GALE_HUMAN	Isoform 2 of UDP-glucose 4-epimerase OS=Homo sapiens OX=9606 GN=GALE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	2	1	0
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.04	33.0	1	1	1
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|P46736-5|BRCC3_HUMAN	Isoform 5 of Lys-63-specific deubiquitinase BRCC36 OS=Homo sapiens OX=9606 GN=BRCC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	35-UNIMOD:35,38-UNIMOD:4	0.07	33.0	1	1	1
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q9HAS0|NJMU_HUMAN	Protein Njmu-R1 OS=Homo sapiens OX=9606 GN=C17orf75 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null		0.04	33.0	3	1	0
PRT	sp|Q8TEQ6|GEMI5_HUMAN	Gem-associated protein 5 OS=Homo sapiens OX=9606 GN=GEMIN5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	766-UNIMOD:35	0.02	33.0	2	2	2
PRT	sp|Q8NAF0|ZN579_HUMAN	Zinc finger protein 579 OS=Homo sapiens OX=9606 GN=ZNF579 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	2	1	0
PRT	sp|O95104-2|SFR15_HUMAN	Isoform 2 of Splicing factor, arginine/serine-rich 15 OS=Homo sapiens OX=9606 GN=SCAF4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	2	1	0
PRT	sp|Q02790|FKBP4_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP4 OS=Homo sapiens OX=9606 GN=FKBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	3	1	0
PRT	sp|Q8TE04|PANK1_HUMAN	Pantothenate kinase 1 OS=Homo sapiens OX=9606 GN=PANK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	1	1	1
PRT	sp|Q96QE3-2|ATAD5_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 5 OS=Homo sapiens OX=9606 GN=ATAD5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	2	1	0
PRT	sp|P78559|MAP1A_HUMAN	Microtubule-associated protein 1A OS=Homo sapiens OX=9606 GN=MAP1A PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	612-UNIMOD:21,644-UNIMOD:21	0.01	33.0	3	2	1
PRT	sp|Q9UDY2-4|ZO2_HUMAN	Isoform C2 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	246-UNIMOD:4,243-UNIMOD:21	0.06	33.0	4	3	2
PRT	sp|Q2NKX8|ERC6L_HUMAN	DNA excision repair protein ERCC-6-like OS=Homo sapiens OX=9606 GN=ERCC6L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.01	33.0	1	1	1
PRT	sp|Q09160|1A80_HUMAN	HLA class I histocompatibility antigen, A-80 alpha chain OS=Homo sapiens OX=9606 GN=HLA-A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	356-UNIMOD:21,359-UNIMOD:21,363-UNIMOD:4	0.07	33.0	3	2	1
PRT	sp|Q99426-2|TBCB_HUMAN	Isoform 2 of Tubulin-folding cofactor B OS=Homo sapiens OX=9606 GN=TBCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	32-UNIMOD:4	0.10	33.0	1	1	1
PRT	sp|Q9Y5S1|TRPV2_HUMAN	Transient receptor potential cation channel subfamily V member 2 OS=Homo sapiens OX=9606 GN=TRPV2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	832-UNIMOD:35,3769-UNIMOD:35	0.01	33.0	3	3	2
PRT	sp|Q5EBL4-3|RIPL1_HUMAN	Isoform 3 of RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	108-UNIMOD:21	0.12	33.0	1	1	0
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	208-UNIMOD:35,209-UNIMOD:21,438-UNIMOD:21	0.05	33.0	2	2	2
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	194-UNIMOD:4	0.03	33.0	2	2	2
PRT	sp|A7KAX9-2|RHG32_HUMAN	Isoform 2 of Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	357-UNIMOD:21	0.01	33.0	1	1	0
PRT	sp|P21796|VDAC1_HUMAN	Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens OX=9606 GN=VDAC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|Q9UJA5-4|TRM6_HUMAN	Isoform 4 of tRNA (adenine(58)-N(1))-methyltransferase non-catalytic subunit TRM6 OS=Homo sapiens OX=9606 GN=TRMT6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	306-UNIMOD:21,302-UNIMOD:21	0.06	33.0	2	1	0
PRT	sp|Q9H6Z4-3|RANB3_HUMAN	Isoform 3 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	160-UNIMOD:4,181-UNIMOD:4	0.06	33.0	2	2	2
PRT	sp|Q86UE4|LYRIC_HUMAN	Protein LYRIC OS=Homo sapiens OX=9606 GN=MTDH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	426-UNIMOD:21	0.03	33.0	13	1	0
PRT	sp|Q15154-4|PCM1_HUMAN	Isoform 4 of Pericentriolar material 1 protein OS=Homo sapiens OX=9606 GN=PCM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	644-UNIMOD:21,1794-UNIMOD:21	0.02	33.0	3	2	1
PRT	sp|Q96K49-2|TM87B_HUMAN	Isoform 2 of Transmembrane protein 87B OS=Homo sapiens OX=9606 GN=TMEM87B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	493-UNIMOD:21	0.04	33.0	2	1	0
PRT	sp|Q13409-6|DC1I2_HUMAN	Isoform 2F of Cytoplasmic dynein 1 intermediate chain 2 OS=Homo sapiens OX=9606 GN=DYNC1I2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.05	33.0	2	2	2
PRT	sp|Q9BTE3-2|MCMBP_HUMAN	Isoform 2 of Mini-chromosome maintenance complex-binding protein OS=Homo sapiens OX=9606 GN=MCMBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	174-UNIMOD:35	0.02	33.0	3	1	0
PRT	sp|P62424|RL7A_HUMAN	60S ribosomal protein L7a OS=Homo sapiens OX=9606 GN=RPL7A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	199-UNIMOD:4	0.06	33.0	1	1	1
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.14	33.0	1	1	1
PRT	sp|P48735-2|IDHP_HUMAN	Isoform 2 of Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	350-UNIMOD:4,359-UNIMOD:35	0.04	33.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	425-UNIMOD:35	0.06	33.0	3	2	1
PRT	sp|O75534-2|CSDE1_HUMAN	Isoform 2 of Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	1	1	0
PRT	sp|O43491-4|E41L2_HUMAN	Isoform 4 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	232-UNIMOD:4	0.02	33.0	1	1	1
PRT	sp|O00264|PGRC1_HUMAN	Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	173-UNIMOD:27,181-UNIMOD:21	0.22	33.0	2	2	0
PRT	sp|Q09028|RBBP4_HUMAN	Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.04	33.0	1	1	1
PRT	sp|P51532|SMCA4_HUMAN	Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	33.0	null	712-UNIMOD:28	0.01	33.0	2	1	0
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P23327|SRCH_HUMAN	Sarcoplasmic reticulum histidine-rich calcium-binding protein OS=Homo sapiens OX=9606 GN=HRC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	567-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q12824-2|SNF5_HUMAN	Isoform B of SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 OS=Homo sapiens OX=9606 GN=SMARCB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.11	32.0	2	2	2
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.14	32.0	4	2	1
PRT	sp|Q92673|SORL_HUMAN	Sortilin-related receptor OS=Homo sapiens OX=9606 GN=SORL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1534-UNIMOD:4,1540-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q92620|PRP16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens OX=9606 GN=DHX38 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9H9C1-2|SPE39_HUMAN	Isoform 2 of Spermatogenesis-defective protein 39 homolog OS=Homo sapiens OX=9606 GN=VIPAS39	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	3	2	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.04	32.0	4	1	0
PRT	sp|Q9H0P0-3|5NT3A_HUMAN	Isoform 4 of Cytosolic 5'-nucleotidase 3A OS=Homo sapiens OX=9606 GN=NT5C3A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P01112-2|RASH_HUMAN	Isoform 2 of GTPase HRas OS=Homo sapiens OX=9606 GN=HRAS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	111-UNIMOD:35	0.08	32.0	17	1	0
PRT	sp|Q9C0D5|TANC1_HUMAN	Protein TANC1 OS=Homo sapiens OX=9606 GN=TANC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	433-UNIMOD:21	0.03	32.0	9	1	0
PRT	sp|Q8IWF6|DEN6A_HUMAN	Protein DENND6A OS=Homo sapiens OX=9606 GN=DENND6A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	2	1	0
PRT	sp|Q9H0S4-2|DDX47_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	4	1	0
PRT	sp|Q8NBJ4-2|GOLM1_HUMAN	Isoform 2 of Golgi membrane protein 1 OS=Homo sapiens OX=9606 GN=GOLM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q8IWE2-2|NXP20_HUMAN	Isoform 2 of Protein NOXP20 OS=Homo sapiens OX=9606 GN=FAM114A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|O14526-3|FCHO1_HUMAN	Isoform 3 of F-BAR domain only protein 1 OS=Homo sapiens OX=9606 GN=FCHO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q99871-3|HAUS7_HUMAN	Isoform 3 of HAUS augmin-like complex subunit 7 OS=Homo sapiens OX=9606 GN=HAUS7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|P22694-10|KAPCB_HUMAN	Isoform 10 of cAMP-dependent protein kinase catalytic subunit beta OS=Homo sapiens OX=9606 GN=PRKACB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|P20645|MPRD_HUMAN	Cation-dependent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=M6PR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	2	1	0
PRT	sp|Q9UQ35-2|SRRM2_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	377-UNIMOD:21,398-UNIMOD:21	0.01	32.0	1	1	1
PRT	sp|P13866-2|SC5A1_HUMAN	Isoform 2 of Sodium/glucose cotransporter 1 OS=Homo sapiens OX=9606 GN=SLC5A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q9Y2W6-3|TDRKH_HUMAN	Isoform 2 of Tudor and KH domain-containing protein OS=Homo sapiens OX=9606 GN=TDRKH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	3	1	0
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1119-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|Q9NPL8|TIDC1_HUMAN	Complex I assembly factor TIMMDC1, mitochondrial OS=Homo sapiens OX=9606 GN=TIMMDC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	2	1	0
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	375-UNIMOD:35,376-UNIMOD:21,390-UNIMOD:21	0.04	32.0	3	1	0
PRT	sp|Q99623|PHB2_HUMAN	Prohibitin-2 OS=Homo sapiens OX=9606 GN=PHB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	971-UNIMOD:21,979-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P62750|RL23A_HUMAN	60S ribosomal protein L23a OS=Homo sapiens OX=9606 GN=RPL23A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|Q8NFI4|F10A5_HUMAN	Putative protein FAM10A5 OS=Homo sapiens OX=9606 GN=ST13P5 PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	220-UNIMOD:35	0.04	32.0	4	1	0
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	23-UNIMOD:21,31-UNIMOD:4,461-UNIMOD:21,456-UNIMOD:21	0.06	32.0	5	3	2
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	4	3	2
PRT	sp|Q03013-3|GSTM4_HUMAN	Isoform 3 of Glutathione S-transferase Mu 4 OS=Homo sapiens OX=9606 GN=GSTM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.09	32.0	1	1	1
PRT	sp|P15408-3|FOSL2_HUMAN	Isoform 3 of Fos-related antigen 2 OS=Homo sapiens OX=9606 GN=FOSL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q93008-1|USP9X_HUMAN	Isoform 2 of Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1956-UNIMOD:35	0.01	32.0	8	1	0
PRT	sp|Q92859-3|NEO1_HUMAN	Isoform 3 of Neogenin OS=Homo sapiens OX=9606 GN=NEO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	61-UNIMOD:21	0.07	32.0	3	1	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.06	32.0	1	1	1
PRT	sp|Q9Y6X4|F169A_HUMAN	Soluble lamin-associated protein of 75 kDa OS=Homo sapiens OX=9606 GN=FAM169A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	497-UNIMOD:35,499-UNIMOD:35	0.05	32.0	2	2	2
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	2	1	0
PRT	sp|P33993-2|MCM7_HUMAN	Isoform 2 of DNA replication licensing factor MCM7 OS=Homo sapiens OX=9606 GN=MCM7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P02774-2|VTDB_HUMAN	Isoform 2 of Vitamin D-binding protein OS=Homo sapiens OX=9606 GN=GC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	253-UNIMOD:4,254-UNIMOD:4,262-UNIMOD:4	0.05	32.0	1	1	1
PRT	sp|Q02410-2|APBA1_HUMAN	Isoform 2 of Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	557-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|P40939|ECHA_HUMAN	Trifunctional enzyme subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=HADHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	322-UNIMOD:4	0.04	32.0	3	2	1
PRT	sp|Q9H7D0|DOCK5_HUMAN	Dedicator of cytokinesis protein 5 OS=Homo sapiens OX=9606 GN=DOCK5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1800-UNIMOD:21,1805-UNIMOD:21	0.01	32.0	4	1	0
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q9Y5T5-4|UBP16_HUMAN	Isoform 4 of Ubiquitin carboxyl-terminal hydrolase 16 OS=Homo sapiens OX=9606 GN=USP16	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	105-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|O14646-2|CHD1_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=CHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1027-UNIMOD:35	0.01	32.0	1	1	1
PRT	sp|Q7Z3J2-2|CP062_HUMAN	Isoform 2 of UPF0505 protein C16orf62 OS=Homo sapiens OX=9606 GN=C16orf62	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	2	2	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	2	2
PRT	sp|Q8IYQ7|THNS1_HUMAN	Threonine synthase-like 1 OS=Homo sapiens OX=9606 GN=THNSL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	203-UNIMOD:4	0.02	32.0	1	1	1
PRT	sp|P02452|CO1A1_HUMAN	Collagen alpha-1(I) chain OS=Homo sapiens OX=9606 GN=COL1A1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	70-UNIMOD:4,75-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|P05198|IF2A_HUMAN	Eukaryotic translation initiation factor 2 subunit 1 OS=Homo sapiens OX=9606 GN=EIF2S1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|O94956-3|SO2B1_HUMAN	Isoform 3 of Solute carrier organic anion transporter family member 2B1 OS=Homo sapiens OX=9606 GN=SLCO2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	130-UNIMOD:35	0.02	32.0	3	1	0
PRT	sp|Q9Y3F4|STRAP_HUMAN	Serine-threonine kinase receptor-associated protein OS=Homo sapiens OX=9606 GN=STRAP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	32.0	null	2-UNIMOD:1	0.29	32.0	2	2	1
PRT	sp|O95218|ZRAB2_HUMAN	Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	153-UNIMOD:21	0.11	32.0	7	2	1
PRT	sp|Q7Z3K6|MIER3_HUMAN	Mesoderm induction early response protein 3 OS=Homo sapiens OX=9606 GN=MIER3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	150-UNIMOD:4,156-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|P50579|MAP2_HUMAN	Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1	0.05	32.0	1	1	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	53-UNIMOD:28	0.04	32.0	3	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|Q6DD87|ZN787_HUMAN	Zinc finger protein 787 OS=Homo sapiens OX=9606 GN=ZNF787 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	3	1	0
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	2	1	0
PRT	sp|B4DJY2|TM233_HUMAN	Transmembrane protein 233 OS=Homo sapiens OX=9606 GN=TMEM233 PE=3 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.14	31.0	1	1	1
PRT	sp|P29590-4|PML_HUMAN	Isoform PML-6 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	518-UNIMOD:21,527-UNIMOD:21	0.05	31.0	4	2	1
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	3	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.08	31.0	3	2	1
PRT	sp|Q9H4E7|DEFI6_HUMAN	Differentially expressed in FDCP 6 homolog OS=Homo sapiens OX=9606 GN=DEF6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	69-UNIMOD:35	0.03	31.0	2	1	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|O14776-2|TCRG1_HUMAN	Isoform 2 of Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	617-UNIMOD:21,623-UNIMOD:35	0.01	31.0	2	1	0
PRT	sp|Q4G0J3|LARP7_HUMAN	La-related protein 7 OS=Homo sapiens OX=9606 GN=LARP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	338-UNIMOD:21,337-UNIMOD:21	0.03	31.0	2	1	0
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q6P158-3|DHX57_HUMAN	Isoform 3 of Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P07737|PROF1_HUMAN	Profilin-1 OS=Homo sapiens OX=9606 GN=PFN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	86-UNIMOD:35	0.11	31.0	4	1	0
PRT	sp|P49790-2|NU153_HUMAN	Isoform 2 of Nuclear pore complex protein Nup153 OS=Homo sapiens OX=9606 GN=NUP153	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	172-UNIMOD:21,188-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|Q8IWZ8|SUGP1_HUMAN	SURP and G-patch domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SUGP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	3	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q9HB21-2|PKHA1_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family A member 1 OS=Homo sapiens OX=9606 GN=PLEKHA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	163-UNIMOD:4	0.04	31.0	1	1	1
PRT	sp|Q9H4Z3|PCIF1_HUMAN	Phosphorylated CTD-interacting factor 1 OS=Homo sapiens OX=9606 GN=PCIF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q9ULZ3-3|ASC_HUMAN	Isoform 3 of Apoptosis-associated speck-like protein containing a CARD OS=Homo sapiens OX=9606 GN=PYCARD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	1	1	1
PRT	sp|Q92667-2|AKAP1_HUMAN	Isoform 2 of A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9Y2L1|RRP44_HUMAN	Exosome complex exonuclease RRP44 OS=Homo sapiens OX=9606 GN=DIS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q96RL1-3|UIMC1_HUMAN	Isoform 3 of BRCA1-A complex subunit RAP80 OS=Homo sapiens OX=9606 GN=UIMC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q96TA1-2|NIBL1_HUMAN	Isoform 2 of Niban-like protein 1 OS=Homo sapiens OX=9606 GN=FAM129B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	359-UNIMOD:35,678-UNIMOD:21,683-UNIMOD:21	0.05	31.0	4	2	0
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	616-UNIMOD:21,624-UNIMOD:21,634-UNIMOD:4,629-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|P62306|RUXF_HUMAN	Small nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=SNRPF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	84-UNIMOD:35	0.16	31.0	20	2	0
PRT	sp|Q96T23-3|RSF1_HUMAN	Isoform 3 of Remodeling and spacing factor 1 OS=Homo sapiens OX=9606 GN=RSF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	272-UNIMOD:21,352-UNIMOD:21	0.04	31.0	3	3	3
PRT	sp|Q16181-2|SEPT7_HUMAN	Isoform 2 of Septin-7 OS=Homo sapiens OX=9606 GN=SEPT7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	3	1	0
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	32-UNIMOD:35	0.06	31.0	1	1	1
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	16-UNIMOD:35	0.03	31.0	1	1	1
PRT	sp|Q96HF1|SFRP2_HUMAN	Secreted frizzled-related protein 2 OS=Homo sapiens OX=9606 GN=SFRP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	190-UNIMOD:4,186-UNIMOD:35	0.05	31.0	2	1	0
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	200-UNIMOD:4	0.02	31.0	4	1	0
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	819-UNIMOD:35,823-UNIMOD:35	0.01	31.0	2	1	0
PRT	sp|Q96QK1|VPS35_HUMAN	Vacuolar protein sorting-associated protein 35 OS=Homo sapiens OX=9606 GN=VPS35 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|P08183-2|MDR1_HUMAN	Isoform 2 of Multidrug resistance protein 1 OS=Homo sapiens OX=9606 GN=ABCB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	589-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|P02649|APOE_HUMAN	Apolipoprotein E OS=Homo sapiens OX=9606 GN=APOE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q8IY67-3|RAVR1_HUMAN	Isoform 3 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.19	31.0	1	1	1
PRT	sp|Q8N2F6-6|ARM10_HUMAN	Isoform 6 of Armadillo repeat-containing protein 10 OS=Homo sapiens OX=9606 GN=ARMC10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	42-UNIMOD:21	0.11	31.0	1	1	1
PRT	sp|Q76I76|SSH2_HUMAN	Protein phosphatase Slingshot homolog 2 OS=Homo sapiens OX=9606 GN=SSH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	708-UNIMOD:21,721-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q9Y2Q0-3|AT8A1_HUMAN	Isoform 3 of Phospholipid-transporting ATPase IA OS=Homo sapiens OX=9606 GN=ATP8A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	29-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	283-UNIMOD:35	0.02	31.0	2	1	0
PRT	sp|Q53GQ0|DHB12_HUMAN	Very-long-chain 3-oxoacyl-CoA reductase OS=Homo sapiens OX=9606 GN=HSD17B12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.05	31.0	1	1	1
PRT	sp|Q9BV36-5|MELPH_HUMAN	Isoform 5 of Melanophilin OS=Homo sapiens OX=9606 GN=MLPH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q9ULG6-3|CCPG1_HUMAN	Isoform 3 of Cell cycle progression protein 1 OS=Homo sapiens OX=9606 GN=CCPG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	184-UNIMOD:21,190-UNIMOD:21	0.08	31.0	3	2	1
PRT	sp|P30876|RPB2_HUMAN	DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens OX=9606 GN=POLR2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q00341-2|VIGLN_HUMAN	Isoform 2 of Vigilin OS=Homo sapiens OX=9606 GN=HDLBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q9Y266|NUDC_HUMAN	Nuclear migration protein nudC OS=Homo sapiens OX=9606 GN=NUDC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	143-UNIMOD:28	0.08	31.0	2	2	2
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	133-UNIMOD:35,214-UNIMOD:21,106-UNIMOD:28,113-UNIMOD:21	0.07	31.0	7	6	5
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	293-UNIMOD:35,555-UNIMOD:21	0.03	31.0	2	2	2
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	15-UNIMOD:21	0.03	31.0	2	1	0
PRT	sp|Q9Y5P4-2|C43BP_HUMAN	Isoform 2 of Collagen type IV alpha-3-binding protein OS=Homo sapiens OX=9606 GN=COL4A3BP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q6P6C2-3|ALKB5_HUMAN	Isoform 3 of RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	58-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q9NRF8|PYRG2_HUMAN	CTP synthase 2 OS=Homo sapiens OX=9606 GN=CTPS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|O95425|SVIL_HUMAN	Supervillin OS=Homo sapiens OX=9606 GN=SVIL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31.0	null	671-UNIMOD:385,671-UNIMOD:4,672-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|Q93008|USP9X_HUMAN	Probable ubiquitin carboxyl-terminal hydrolase FAF-X OS=Homo sapiens OX=9606 GN=USP9X PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	1956-UNIMOD:35	0.01	31.0	3	1	0
PRT	sp|P50750-2|CDK9_HUMAN	Isoform 2 of Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	55-UNIMOD:21	0.09	31.0	1	1	1
PRT	sp|O75475|PSIP1_HUMAN	PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31.0	null	202-UNIMOD:28,204-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|Q9NPQ8|RIC8A_HUMAN	Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	426-UNIMOD:35,436-UNIMOD:21,441-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q8IVL1|NAV2_HUMAN	Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31.0	null	1797-UNIMOD:28,1799-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q9H2K8|TAOK3_HUMAN	Serine/threonine-protein kinase TAO3 OS=Homo sapiens OX=9606 GN=TAOK3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	795-UNIMOD:4	0.02	31.0	1	1	1
PRT	sp|P35523|CLCN1_HUMAN	Chloride channel protein 1 OS=Homo sapiens OX=9606 GN=CLCN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	636-UNIMOD:21,642-UNIMOD:21,645-UNIMOD:21,646-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q9C0C9|UBE2O_HUMAN	(E3-independent) E2 ubiquitin-conjugating enzyme OS=Homo sapiens OX=9606 GN=UBE2O PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1285-UNIMOD:35,1288-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	2202-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q9NX24|NHP2_HUMAN	H/ACA ribonucleoprotein complex subunit 2 OS=Homo sapiens OX=9606 GN=NHP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	18-UNIMOD:4	0.12	30.0	2	1	0
PRT	sp|P13798|ACPH_HUMAN	Acylamino-acid-releasing enzyme OS=Homo sapiens OX=9606 GN=APEH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9NQL2-2|RRAGD_HUMAN	Isoform 2 of Ras-related GTP-binding protein D OS=Homo sapiens OX=9606 GN=RRAGD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	277-UNIMOD:4,278-UNIMOD:21	0.02	30.0	2	2	1
PRT	sp|P53621|COPA_HUMAN	Coatomer subunit alpha OS=Homo sapiens OX=9606 GN=COPA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O00479|HMGN4_HUMAN	High mobility group nucleosome-binding domain-containing protein 4 OS=Homo sapiens OX=9606 GN=HMGN4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	80-UNIMOD:21	0.20	30.0	2	1	0
PRT	sp|O96019-2|ACL6A_HUMAN	Isoform 2 of Actin-like protein 6A OS=Homo sapiens OX=9606 GN=ACTL6A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	12-UNIMOD:35	0.04	30.0	2	1	0
PRT	sp|O00499-9|BIN1_HUMAN	Isoform BIN1-10-13 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	47-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q9H1H9-3|KI13A_HUMAN	Isoform 3 of Kinesin-like protein KIF13A OS=Homo sapiens OX=9606 GN=KIF13A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9UBW7|ZMYM2_HUMAN	Zinc finger MYM-type protein 2 OS=Homo sapiens OX=9606 GN=ZMYM2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P46939|UTRO_HUMAN	Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	2707-UNIMOD:35,2700-UNIMOD:35	0.00	30.0	3	1	0
PRT	sp|P14618-3|KPYM_HUMAN	Isoform 3 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	67-UNIMOD:21,66-UNIMOD:21	0.10	30.0	4	2	0
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	491-UNIMOD:35,494-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	21-UNIMOD:21,36-UNIMOD:4	0.06	30.0	4	3	2
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1451-UNIMOD:21	0.02	30.0	2	2	2
PRT	sp|P07203|GPX1_HUMAN	Glutathione peroxidase 1 OS=Homo sapiens OX=9606 GN=GPX1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	144-UNIMOD:35	0.09	30.0	4	1	0
PRT	sp|P49189-2|AL9A1_HUMAN	Isoform 2 of 4-trimethylaminobutyraldehyde dehydrogenase OS=Homo sapiens OX=9606 GN=ALDH9A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	24-UNIMOD:35,26-UNIMOD:4	0.04	30.0	2	1	0
PRT	sp|Q6P4A8|PLBL1_HUMAN	Phospholipase B-like 1 OS=Homo sapiens OX=9606 GN=PLBD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	489-UNIMOD:4	0.03	30.0	1	1	1
PRT	sp|Q9Y5S9-2|RBM8A_HUMAN	Isoform 2 of RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.10	30.0	1	1	0
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	583-UNIMOD:21	0.04	30.0	2	2	2
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.12	30.0	4	2	1
PRT	sp|Q96CN9|GCC1_HUMAN	GRIP and coiled-coil domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GCC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P39656-2|OST48_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	108-UNIMOD:4	0.04	30.0	2	1	0
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	143-UNIMOD:21,160-UNIMOD:4	0.01	30.0	3	1	0
PRT	sp|Q96RG2-4|PASK_HUMAN	Isoform 3 of PAS domain-containing serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=PASK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	843-UNIMOD:21,859-UNIMOD:4	0.02	30.0	1	1	1
PRT	sp|Q96S66-4|CLCC1_HUMAN	Isoform 4 of Chloride channel CLIC-like protein 1 OS=Homo sapiens OX=9606 GN=CLCC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	324-UNIMOD:21	0.08	30.0	1	1	1
PRT	sp|O00116|ADAS_HUMAN	Alkyldihydroxyacetonephosphate synthase, peroxisomal OS=Homo sapiens OX=9606 GN=AGPS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P01042-3|KNG1_HUMAN	Isoform 3 of Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	292-UNIMOD:4,296-UNIMOD:21,304-UNIMOD:4,290-UNIMOD:21,291-UNIMOD:21,293-UNIMOD:21	0.05	30.0	7	1	0
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P04114|APOB_HUMAN	Apolipoprotein B-100 OS=Homo sapiens OX=9606 GN=APOB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	3	3	3
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	109-UNIMOD:35	0.16	30.0	1	1	0
PRT	sp|P55145|MANF_HUMAN	Mesencephalic astrocyte-derived neurotrophic factor OS=Homo sapiens OX=9606 GN=MANF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	75-UNIMOD:4	0.08	30.0	1	1	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	459-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q9H6A9-3|PCX3_HUMAN	Isoform 3 of Pecanex-like protein 3 OS=Homo sapiens OX=9606 GN=PCNX3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	796-UNIMOD:21	0.02	30.0	1	1	0
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	166-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q9BUJ2-2|HNRL1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	0
PRT	sp|Q9UKY1|ZHX1_HUMAN	Zinc fingers and homeoboxes protein 1 OS=Homo sapiens OX=9606 GN=ZHX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	630-UNIMOD:35,640-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P78318|IGBP1_HUMAN	Immunoglobulin-binding protein 1 OS=Homo sapiens OX=9606 GN=IGBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.08	30.0	2	2	2
PRT	sp|Q86UK7-2|ZN598_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZNF598 OS=Homo sapiens OX=9606 GN=ZNF598	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	988-UNIMOD:35,994-UNIMOD:21	0.03	30.0	4	2	1
PRT	sp|Q9UNS1-2|TIM_HUMAN	Isoform 2 of Protein timeless homolog OS=Homo sapiens OX=9606 GN=TIMELESS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P08575-4|PTPRC_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens OX=9606 GN=PTPRC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	449-UNIMOD:4	0.01	30.0	1	1	0
PRT	sp|Q9UJV9|DDX41_HUMAN	Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens OX=9606 GN=DDX41 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	3	1	0
PRT	sp|Q6P4Q7|CNNM4_HUMAN	Metal transporter CNNM4 OS=Homo sapiens OX=9606 GN=CNNM4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	514-UNIMOD:35	0.02	30.0	1	1	1
PRT	sp|Q9ULT8|HECD1_HUMAN	E3 ubiquitin-protein ligase HECTD1 OS=Homo sapiens OX=9606 GN=HECTD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q9UHB6-5|LIMA1_HUMAN	Isoform 5 of LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9H4A3-2|WNK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|P17275|JUNB_HUMAN	Transcription factor jun-B OS=Homo sapiens OX=9606 GN=JUNB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	255-UNIMOD:21,259-UNIMOD:21,263-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	585-UNIMOD:21,586-UNIMOD:21	0.03	30.0	6	1	0
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	819-UNIMOD:21,820-UNIMOD:21	0.01	30.0	3	1	0
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	140-UNIMOD:21,148-UNIMOD:21	0.03	30.0	2	1	0
PRT	sp|P00738|HPT_HUMAN	Haptoglobin OS=Homo sapiens OX=9606 GN=HP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	2	2	2
PRT	sp|P07951|TPM2_HUMAN	Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.14	30.0	3	3	3
PRT	sp|O94763-2|RMP_HUMAN	Isoform 2 of Unconventional prefoldin RPB5 interactor 1 OS=Homo sapiens OX=9606 GN=URI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|P24666-4|PPAC_HUMAN	Isoform 4 of Low molecular weight phosphotyrosine protein phosphatase OS=Homo sapiens OX=9606 GN=ACP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.17	30.0	1	1	1
PRT	sp|O15397-2|IPO8_HUMAN	Isoform 2 of Importin-8 OS=Homo sapiens OX=9606 GN=IPO8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|O15269|SPTC1_HUMAN	Serine palmitoyltransferase 1 OS=Homo sapiens OX=9606 GN=SPTLC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9Y4E1-3|WAC2C_HUMAN	Isoform 3 of WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	2	2
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.13	30.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	3	2	1
PRT	sp|P61224|RAP1B_HUMAN	Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	111-UNIMOD:35	0.08	30.0	5	1	0
PRT	sp|P08575|PTPRC_HUMAN	Receptor-type tyrosine-protein phosphatase C OS=Homo sapiens OX=9606 GN=PTPRC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	610-UNIMOD:4	0.01	30.0	1	1	0
PRT	sp|Q9UBC2|EP15R_HUMAN	Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	132-UNIMOD:4	0.04	30.0	1	1	1
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	4729-UNIMOD:35	0.00	30.0	3	1	0
PRT	sp|Q9Y2X7|GIT1_HUMAN	ARF GTPase-activating protein GIT1 OS=Homo sapiens OX=9606 GN=GIT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	388-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	164-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|A7KAX9|RHG32_HUMAN	Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	706-UNIMOD:21	0.01	30.0	1	1	0
PRT	sp|P51636-2|CAV2_HUMAN	Isoform Beta of Caveolin-2 OS=Homo sapiens OX=9606 GN=CAV2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:21	0.13	30.0	1	1	1
PRT	sp|Q9H0S4|DDX47_HUMAN	Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens OX=9606 GN=DDX47 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	0
PRT	sp|O95831-6|AIFM1_HUMAN	Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|Q2M3G4|SHRM1_HUMAN	Protein Shroom1 OS=Homo sapiens OX=9606 GN=SHROOM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P12004|PCNA_HUMAN	Proliferating cell nuclear antigen OS=Homo sapiens OX=9606 GN=PCNA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|Q9Y6G5|COMDA_HUMAN	COMM domain-containing protein 10 OS=Homo sapiens OX=9606 GN=COMMD10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|Q6IA17|SIGIR_HUMAN	Single Ig IL-1-related receptor OS=Homo sapiens OX=9606 GN=SIGIRR PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	333-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|Q7Z2W4-3|ZCCHV_HUMAN	Isoform 3 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9Y282-2|ERGI3_HUMAN	Isoform 2 of Endoplasmic reticulum-Golgi intermediate compartment protein 3 OS=Homo sapiens OX=9606 GN=ERGIC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	142-UNIMOD:4,145-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|P20810-4|ICAL_HUMAN	Isoform 4 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	287-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|Q13148|TADBP_HUMAN	TAR DNA-binding protein 43 OS=Homo sapiens OX=9606 GN=TARDBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	198-UNIMOD:4,202-UNIMOD:35,85-UNIMOD:35	0.06	29.0	4	2	1
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.12	29.0	9	1	0
PRT	sp|P00367|DHE3_HUMAN	Glutamate dehydrogenase 1, mitochondrial OS=Homo sapiens OX=9606 GN=GLUD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P05026-2|AT1B1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit beta-1 OS=Homo sapiens OX=9606 GN=ATP1B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	121-UNIMOD:35,126-UNIMOD:4	0.06	29.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	3	2	1
PRT	sp|O94925-2|GLSK_HUMAN	Isoform 2 of Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.09	29.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	418-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P11277-3|SPTB1_HUMAN	Isoform 3 of Spectrin beta chain, erythrocytic OS=Homo sapiens OX=9606 GN=SPTB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q969T4|UB2E3_HUMAN	Ubiquitin-conjugating enzyme E2 E3 OS=Homo sapiens OX=9606 GN=UBE2E3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	494-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.00	29.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	3	2	1
PRT	sp|P49368-2|TCPG_HUMAN	Isoform 2 of T-complex protein 1 subunit gamma OS=Homo sapiens OX=9606 GN=CCT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|O75122-2|CLAP2_HUMAN	Isoform 2 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	2	1	0
PRT	sp|Q92841-1|DDX17_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens OX=9606 GN=DDX17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9BT09|CNPY3_HUMAN	Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.07	29.0	1	1	1
PRT	sp|P16070-18|CD44_HUMAN	Isoform 18 of CD44 antigen OS=Homo sapiens OX=9606 GN=CD44	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	323-UNIMOD:35	0.05	29.0	1	1	1
PRT	sp|Q99536-3|VAT1_HUMAN	Isoform 3 of Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	0
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	2	2	2
PRT	sp|Q92932-2|PTPR2_HUMAN	Isoform 2 of Receptor-type tyrosine-protein phosphatase N2 OS=Homo sapiens OX=9606 GN=PTPRN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9Y5M8|SRPRB_HUMAN	Signal recognition particle receptor subunit beta OS=Homo sapiens OX=9606 GN=SRPRB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q5SRH9-2|TT39A_HUMAN	Isoform 2 of Tetratricopeptide repeat protein 39A OS=Homo sapiens OX=9606 GN=TTC39A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	113-UNIMOD:4	0.07	29.0	1	1	1
PRT	sp|Q96JI7-2|SPTCS_HUMAN	Isoform 2 of Spatacsin OS=Homo sapiens OX=9606 GN=SPG11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	325-UNIMOD:35	0.01	29.0	1	1	0
PRT	sp|P61978-3|HNRPK_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	27-UNIMOD:35	0.06	29.0	4	2	1
PRT	sp|Q9UJC3-2|HOOK1_HUMAN	Isoform 2 of Protein Hook homolog 1 OS=Homo sapiens OX=9606 GN=HOOK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P16219|ACADS_HUMAN	Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9UBB4-2|ATX10_HUMAN	Isoform 2 of Ataxin-10 OS=Homo sapiens OX=9606 GN=ATXN10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|O14530-2|TXND9_HUMAN	Isoform 2 of Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	39-UNIMOD:35	0.06	29.0	2	1	0
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	337-UNIMOD:35	0.02	29.0	2	1	0
PRT	sp|Q15545|TAF7_HUMAN	Transcription initiation factor TFIID subunit 7 OS=Homo sapiens OX=9606 GN=TAF7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	264-UNIMOD:21,279-UNIMOD:35	0.07	29.0	1	1	1
PRT	sp|P13674-3|P4HA1_HUMAN	Isoform 3 of Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	2	2	2
PRT	sp|A6NDU8|CE051_HUMAN	UPF0600 protein C5orf51 OS=Homo sapiens OX=9606 GN=C5orf51 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q96HR8-2|NAF1_HUMAN	Isoform 2 of H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	315-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|O95785-2|WIZ_HUMAN	Isoform 2 of Protein Wiz OS=Homo sapiens OX=9606 GN=WIZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	249-UNIMOD:21	0.02	29.0	2	1	0
PRT	sp|Q16204|CCDC6_HUMAN	Coiled-coil domain-containing protein 6 OS=Homo sapiens OX=9606 GN=CCDC6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	670-UNIMOD:4,677-UNIMOD:21,686-UNIMOD:4,588-UNIMOD:4	0.09	29.0	4	4	4
PRT	sp|P37173|TGFR2_HUMAN	TGF-beta receptor type-2 OS=Homo sapiens OX=9606 GN=TGFBR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	551-UNIMOD:21,552-UNIMOD:4	0.03	29.0	2	1	0
PRT	sp|Q9Y2D5-5|AKAP2_HUMAN	Isoform 2 of A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	84-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|Q96JJ7|TMX3_HUMAN	Protein disulfide-isomerase TMX3 OS=Homo sapiens OX=9606 GN=TMX3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.03	29.0	1	1	1
PRT	sp|Q9NZJ9|NUDT4_HUMAN	Diphosphoinositol polyphosphate phosphohydrolase 2 OS=Homo sapiens OX=9606 GN=NUDT4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.08	29.0	1	1	1
PRT	sp|Q9HC84|MUC5B_HUMAN	Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.00	29.0	1	1	1
PRT	sp|Q6ZV73-2|FGD6_HUMAN	Isoform 2 of FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens OX=9606 GN=FGD6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	1197-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	357-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q96B36-2|AKTS1_HUMAN	Isoform 2 of Proline-rich AKT1 substrate 1 OS=Homo sapiens OX=9606 GN=AKT1S1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.13	29.0	1	1	1
PRT	sp|Q9Y4W2-4|LAS1L_HUMAN	Isoform 4 of Ribosomal biogenesis protein LAS1L OS=Homo sapiens OX=9606 GN=LAS1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	238-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|Q8TEP8|CE192_HUMAN	Centrosomal protein of 192 kDa OS=Homo sapiens OX=9606 GN=CEP192 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	565-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	2	1	0
PRT	sp|Q6P1J9|CDC73_HUMAN	Parafibromin OS=Homo sapiens OX=9606 GN=CDC73 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P41567|EIF1_HUMAN	Eukaryotic translation initiation factor 1 OS=Homo sapiens OX=9606 GN=EIF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.13	29.0	1	1	0
PRT	sp|O95202|LETM1_HUMAN	Mitochondrial proton/calcium exchanger protein OS=Homo sapiens OX=9606 GN=LETM1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	2325-UNIMOD:21	0.01	29.0	2	2	2
PRT	sp|Q14690|RRP5_HUMAN	Protein RRP5 homolog OS=Homo sapiens OX=9606 GN=PDCD11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	871-UNIMOD:35,872-UNIMOD:35,881-UNIMOD:35,812-UNIMOD:35	0.03	29.0	3	2	1
PRT	sp|O60303|K0556_HUMAN	Protein KIAA0556 OS=Homo sapiens OX=9606 GN=KIAA0556 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	453-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q08AD1-2|CAMP2_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 2 OS=Homo sapiens OX=9606 GN=CAMSAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	1121-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|O14976-2|GAK_HUMAN	Isoform 2 of Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	612-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|O95810|CAVN2_HUMAN	Caveolae-associated protein 2 OS=Homo sapiens OX=9606 GN=CAVIN2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P46777|RL5_HUMAN	60S ribosomal protein L5 OS=Homo sapiens OX=9606 GN=RPL5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	212-UNIMOD:35	0.04	29.0	3	1	0
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	133-UNIMOD:21	0.09	29.0	3	1	0
PRT	sp|Q92835|SHIP1_HUMAN	Phosphatidylinositol 3,4,5-trisphosphate 5-phosphatase 1 OS=Homo sapiens OX=9606 GN=INPP5D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	819-UNIMOD:4	0.01	29.0	1	1	0
PRT	sp|Q12830|BPTF_HUMAN	Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q6P158|DHX57_HUMAN	Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	142-UNIMOD:4,143-UNIMOD:4	0.01	29.0	1	1	1
PRT	sp|P07910|HNRPC_HUMAN	Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	233-UNIMOD:21	0.07	29.0	3	1	0
PRT	sp|P09960|LKHA4_HUMAN	Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	1	1	0
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	29.0	null	333-UNIMOD:28,345-UNIMOD:4	0.02	29.0	4	1	0
PRT	sp|Q13287|NMI_HUMAN	N-myc-interactor OS=Homo sapiens OX=9606 GN=NMI PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	1-UNIMOD:1,1-UNIMOD:35	0.05	29.0	2	1	0
PRT	sp|Q13243|SRSF5_HUMAN	Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null		0.05	29.0	1	1	0
PRT	sp|Q92614|MY18A_HUMAN	Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	1755-UNIMOD:35,1759-UNIMOD:35	0.01	29.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P09493-8|TPM1_HUMAN	Isoform 8 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	125-UNIMOD:35,578-UNIMOD:21,580-UNIMOD:21	0.02	28.0	3	2	1
PRT	sp|Q8IXS6|PALM2_HUMAN	Paralemmin-2 OS=Homo sapiens OX=9606 GN=PALM2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|P62269|RS18_HUMAN	40S ribosomal protein S18 OS=Homo sapiens OX=9606 GN=RPS18 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	5	2	0
PRT	sp|Q9BSL1|UBAC1_HUMAN	Ubiquitin-associated domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBAC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	183-UNIMOD:35	0.03	28.0	3	1	0
PRT	sp|O15417|TNC18_HUMAN	Trinucleotide repeat-containing gene 18 protein OS=Homo sapiens OX=9606 GN=TNRC18 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	2543-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P05023-3|AT1A1_HUMAN	Isoform 3 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	642-UNIMOD:35	0.03	28.0	2	2	2
PRT	sp|P51659-3|DHB4_HUMAN	Isoform 3 of Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens OX=9606 GN=HSD17B4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P11177-3|ODPB_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=PDHB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P31948-3|STIP1_HUMAN	Isoform 3 of Stress-induced-phosphoprotein 1 OS=Homo sapiens OX=9606 GN=STIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	393-UNIMOD:4,396-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9UH65|SWP70_HUMAN	Switch-associated protein 70 OS=Homo sapiens OX=9606 GN=SWAP70 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	70-UNIMOD:35	0.03	28.0	2	1	0
PRT	sp|Q9BSA9|TM175_HUMAN	Endosomal/lysosomal potassium channel TMEM175 OS=Homo sapiens OX=9606 GN=TMEM175 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	32-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|B2RTY4-3|MYO9A_HUMAN	Isoform 3 of Unconventional myosin-IXa OS=Homo sapiens OX=9606 GN=MYO9A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	152-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q07065|CKAP4_HUMAN	Cytoskeleton-associated protein 4 OS=Homo sapiens OX=9606 GN=CKAP4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P41208|CETN2_HUMAN	Centrin-2 OS=Homo sapiens OX=9606 GN=CETN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	1	1	1
PRT	sp|Q04206-2|TF65_HUMAN	Isoform 2 of Transcription factor p65 OS=Homo sapiens OX=9606 GN=RELA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	92-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	289-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P12956-2|XRCC6_HUMAN	Isoform 2 of X-ray repair cross-complementing protein 6 OS=Homo sapiens OX=9606 GN=XRCC6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	3	1	0
PRT	sp|P10619-2|PPGB_HUMAN	Isoform 2 of Lysosomal protective protein OS=Homo sapiens OX=9606 GN=CTSA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	239-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	143-UNIMOD:35	0.03	28.0	2	1	0
PRT	sp|Q16698-2|DECR_HUMAN	Isoform 2 of 2,4-dienoyl-CoA reductase, mitochondrial OS=Homo sapiens OX=9606 GN=DECR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	114-UNIMOD:35	0.05	28.0	3	1	0
PRT	sp|O43615|TIM44_HUMAN	Mitochondrial import inner membrane translocase subunit TIM44 OS=Homo sapiens OX=9606 GN=TIMM44 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P42285|MTREX_HUMAN	Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	53-UNIMOD:4,17-UNIMOD:35,26-UNIMOD:35	0.16	28.0	2	2	2
PRT	sp|P55039|DRG2_HUMAN	Developmentally-regulated GTP-binding protein 2 OS=Homo sapiens OX=9606 GN=DRG2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	223-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P09960-3|LKHA4_HUMAN	Isoform 3 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	3	1	0
PRT	sp|O43592|XPOT_HUMAN	Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	244-UNIMOD:4,246-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q12846-2|STX4_HUMAN	Isoform 2 of Syntaxin-4 OS=Homo sapiens OX=9606 GN=STX4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q9UGY1|NOL12_HUMAN	Nucleolar protein 12 OS=Homo sapiens OX=9606 GN=NOL12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	2	2	2
PRT	sp|Q86X53|ERIC1_HUMAN	Glutamate-rich protein 1 OS=Homo sapiens OX=9606 GN=ERICH1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P84157-2|MXRA7_HUMAN	Isoform 2 of Matrix-remodeling-associated protein 7 OS=Homo sapiens OX=9606 GN=MXRA7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q16543|CDC37_HUMAN	Hsp90 co-chaperone Cdc37 OS=Homo sapiens OX=9606 GN=CDC37 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	1	0
PRT	sp|P25685|DNJB1_HUMAN	DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	47-UNIMOD:27	0.04	28.0	2	1	0
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	28-UNIMOD:35,37-UNIMOD:4	0.02	28.0	2	1	0
PRT	sp|Q8N573-3|OXR1_HUMAN	Isoform 3 of Oxidation resistance protein 1 OS=Homo sapiens OX=9606 GN=OXR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q9UDY4|DNJB4_HUMAN	DnaJ homolog subfamily B member 4 OS=Homo sapiens OX=9606 GN=DNAJB4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|O43143|DHX15_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens OX=9606 GN=DHX15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	3	1	0
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P48751-2|B3A3_HUMAN	Isoform CAE3 of Anion exchange protein 3 OS=Homo sapiens OX=9606 GN=SLC4A3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q96S38-2|KS6C1_HUMAN	Isoform 2 of Ribosomal protein S6 kinase delta-1 OS=Homo sapiens OX=9606 GN=RPS6KC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	411-UNIMOD:21,415-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q15185-4|TEBP_HUMAN	Isoform 4 of Prostaglandin E synthase 3 OS=Homo sapiens OX=9606 GN=PTGES3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|P19105|ML12A_HUMAN	Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.07	28.0	5	1	0
PRT	sp|Q53EQ6-2|TIGD5_HUMAN	Isoform 2 of Tigger transposable element-derived protein 5 OS=Homo sapiens OX=9606 GN=TIGD5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	147-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	917-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P04843|RPN1_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens OX=9606 GN=RPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	5	1	0
PRT	sp|O00767|ACOD_HUMAN	Acyl-CoA desaturase OS=Homo sapiens OX=9606 GN=SCD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q969E4|TCAL3_HUMAN	Transcription elongation factor A protein-like 3 OS=Homo sapiens OX=9606 GN=TCEAL3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	118-UNIMOD:21,121-UNIMOD:21	0.09	28.0	2	1	0
PRT	sp|A5D8V6|VP37C_HUMAN	Vacuolar protein sorting-associated protein 37C OS=Homo sapiens OX=9606 GN=VPS37C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	118-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|P52434-3|RPAB3_HUMAN	Isoform 3 of DNA-directed RNA polymerases I, II, and III subunit RPABC3 OS=Homo sapiens OX=9606 GN=POLR2H	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|Q9H4A4|AMPB_HUMAN	Aminopeptidase B OS=Homo sapiens OX=9606 GN=RNPEP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q8IWD4|CC117_HUMAN	Coiled-coil domain-containing protein 117 OS=Homo sapiens OX=9606 GN=CCDC117 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	81-UNIMOD:4	0.09	28.0	3	2	1
PRT	sp|Q06124-3|PTN11_HUMAN	Isoform 3 of Tyrosine-protein phosphatase non-receptor type 11 OS=Homo sapiens OX=9606 GN=PTPN11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q99615-2|DNJC7_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 7 OS=Homo sapiens OX=9606 GN=DNAJC7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	261-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	7	1	0
PRT	sp|P35237|SPB6_HUMAN	Serpin B6 OS=Homo sapiens OX=9606 GN=SERPINB6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	282-UNIMOD:35	0.03	28.0	5	1	0
PRT	sp|O60281-2|ZN292_HUMAN	Isoform 2 of Zinc finger protein 292 OS=Homo sapiens OX=9606 GN=ZNF292	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	108-UNIMOD:4	0.00	28.0	1	1	1
PRT	sp|O94906|PRP6_HUMAN	Pre-mRNA-processing factor 6 OS=Homo sapiens OX=9606 GN=PRPF6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	2	2
PRT	sp|P11047|LAMC1_HUMAN	Laminin subunit gamma-1 OS=Homo sapiens OX=9606 GN=LAMC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1291-UNIMOD:35	0.01	28.0	2	1	0
PRT	sp|Q9Y2Q3-4|GSTK1_HUMAN	Isoform 4 of Glutathione S-transferase kappa 1 OS=Homo sapiens OX=9606 GN=GSTK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.09	28.0	1	1	1
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	2	2
PRT	sp|P80303-2|NUCB2_HUMAN	Isoform 2 of Nucleobindin-2 OS=Homo sapiens OX=9606 GN=NUCB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	287-UNIMOD:35,290-UNIMOD:35	0.03	28.0	3	1	0
PRT	sp|Q15723-4|ELF2_HUMAN	Isoform 4 of ETS-related transcription factor Elf-2 OS=Homo sapiens OX=9606 GN=ELF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	215-UNIMOD:21,218-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q68DH5|LMBD2_HUMAN	LMBR1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=LMBRD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	287-UNIMOD:35	0.02	28.0	2	1	0
PRT	sp|P02730-2|B3AT_HUMAN	Isoform 2 of Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	820-UNIMOD:4	0.02	28.0	9	1	0
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	112-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	691-UNIMOD:35	0.01	28.0	2	1	0
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	734-UNIMOD:21,738-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|P23083|HV102_HUMAN	Immunoglobulin heavy variable 1-2 OS=Homo sapiens OX=9606 GN=IGHV1-2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	115-UNIMOD:4	0.10	28.0	1	1	1
PRT	sp|A6NK89|RASFA_HUMAN	Ras association domain-containing protein 10 OS=Homo sapiens OX=9606 GN=RASSF10 PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P53992-2|SC24C_HUMAN	Isoform 2 of Protein transport protein Sec24C OS=Homo sapiens OX=9606 GN=SEC24C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q5VT52-5|RPRD2_HUMAN	Isoform 5 of Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	708-UNIMOD:21,712-UNIMOD:35,713-UNIMOD:35,724-UNIMOD:35,704-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|O75116|ROCK2_HUMAN	Rho-associated protein kinase 2 OS=Homo sapiens OX=9606 GN=ROCK2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	2	1	0
PRT	sp|P49810-2|PSN2_HUMAN	Isoform 2 of Presenilin-2 OS=Homo sapiens OX=9606 GN=PSEN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|P11171-7|41_HUMAN	Isoform 7 of Protein 4.1 OS=Homo sapiens OX=9606 GN=EPB41	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	95-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q13113|PDZ1I_HUMAN	PDZK1-interacting protein 1 OS=Homo sapiens OX=9606 GN=PDZK1IP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	92-UNIMOD:21	0.16	28.0	1	1	1
PRT	sp|P29218-2|IMPA1_HUMAN	Isoform 2 of Inositol monophosphatase 1 OS=Homo sapiens OX=9606 GN=IMPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.07	28.0	1	1	1
PRT	sp|Q9ULW0|TPX2_HUMAN	Targeting protein for Xklp2 OS=Homo sapiens OX=9606 GN=TPX2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	121-UNIMOD:21,17-UNIMOD:35	0.09	28.0	6	5	4
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	4	2	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P01857|IGHG1_HUMAN	Immunoglobulin heavy constant gamma 1 OS=Homo sapiens OX=9606 GN=IGHG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|P12955-3|PEPD_HUMAN	Isoform 3 of Xaa-Pro dipeptidase OS=Homo sapiens OX=9606 GN=PEPD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	414-UNIMOD:4,415-UNIMOD:35,418-UNIMOD:4	0.03	28.0	1	1	1
PRT	sp|Q9UBC2-4|EP15R_HUMAN	Isoform 4 of Epidermal growth factor receptor substrate 15-like 1 OS=Homo sapiens OX=9606 GN=EPS15L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	229-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9H2G2-2|SLK_HUMAN	Isoform 2 of STE20-like serine/threonine-protein kinase OS=Homo sapiens OX=9606 GN=SLK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	571-UNIMOD:21,608-UNIMOD:35	0.03	28.0	3	2	1
PRT	sp|Q8TER5-2|ARH40_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 40 OS=Homo sapiens OX=9606 GN=ARHGEF40	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|P07948-2|LYN_HUMAN	Isoform 2 of Tyrosine-protein kinase Lyn OS=Homo sapiens OX=9606 GN=LYN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	447-UNIMOD:4,455-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|Q9Y2J2-4|E41L3_HUMAN	Isoform 4 of Band 4.1-like protein 3 OS=Homo sapiens OX=9606 GN=EPB41L3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	124-UNIMOD:4	0.04	28.0	2	2	2
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|Q6PIU2|NCEH1_HUMAN	Neutral cholesterol ester hydrolase 1 OS=Homo sapiens OX=9606 GN=NCEH1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|Q13576-3|IQGA2_HUMAN	Isoform 3 of Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	4	1	0
PRT	sp|Q13813|SPTN1_HUMAN	Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q8TAQ2|SMRC2_HUMAN	SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	377-UNIMOD:35,387-UNIMOD:21,388-UNIMOD:35	0.03	28.0	1	1	1
PRT	sp|P02751|FINC_HUMAN	Fibronectin OS=Homo sapiens OX=9606 GN=FN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28.0	null	2288-UNIMOD:385,2288-UNIMOD:4,2295-UNIMOD:4	0.01	28.0	2	1	0
PRT	sp|Q8IV56|PRR15_HUMAN	Proline-rich protein 15 OS=Homo sapiens OX=9606 GN=PRR15 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	49-UNIMOD:21	0.26	28.0	1	1	1
PRT	sp|O75534|CSDE1_HUMAN	Cold shock domain-containing protein E1 OS=Homo sapiens OX=9606 GN=CSDE1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	0
PRT	sp|Q5UIP0|RIF1_HUMAN	Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	1616-UNIMOD:21,1619-UNIMOD:4	0.01	28.0	1	1	1
PRT	sp|Q6P6C2|ALKB5_HUMAN	RNA demethylase ALKBH5 OS=Homo sapiens OX=9606 GN=ALKBH5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	378-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|P20962|PTMS_HUMAN	Parathymosin OS=Homo sapiens OX=9606 GN=PTMS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|P54578-2|UBP14_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 14 OS=Homo sapiens OX=9606 GN=USP14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	222-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q13630|FCL_HUMAN	GDP-L-fucose synthase OS=Homo sapiens OX=9606 GN=TSTA3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q8IVF2-3|AHNK2_HUMAN	Isoform 3 of Protein AHNAK2 OS=Homo sapiens OX=9606 GN=AHNAK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	194-UNIMOD:21	0.00	27.0	1	1	1
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	950-UNIMOD:21,957-UNIMOD:35	0.01	27.0	5	1	0
PRT	sp|O95881|TXD12_HUMAN	Thioredoxin domain-containing protein 12 OS=Homo sapiens OX=9606 GN=TXNDC12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|P46379-2|BAG6_HUMAN	Isoform 2 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q15746-4|MYLK_HUMAN	Isoform 3B of Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1369-UNIMOD:21	0.02	27.0	2	2	2
PRT	sp|Q14195|DPYL3_HUMAN	Dihydropyrimidinase-related protein 3 OS=Homo sapiens OX=9606 GN=DPYSL3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P60660-2|MYL6_HUMAN	Isoform Smooth muscle of Myosin light polypeptide 6 OS=Homo sapiens OX=9606 GN=MYL6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	2	1	0
PRT	sp|O94979-3|SC31A_HUMAN	Isoform 3 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	532-UNIMOD:21,527-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|P23497-7|SP100_HUMAN	Isoform 7 of Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	196-UNIMOD:21,203-UNIMOD:4	0.05	27.0	1	1	1
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	601-UNIMOD:35	0.05	27.0	4	3	2
PRT	sp|Q5T7N2|LITD1_HUMAN	LINE-1 type transposase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=L1TD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O14879|IFIT3_HUMAN	Interferon-induced protein with tetratricopeptide repeats 3 OS=Homo sapiens OX=9606 GN=IFIT3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9UBE0-2|SAE1_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	2	2	2
PRT	sp|O75581|LRP6_HUMAN	Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens OX=9606 GN=LRP6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q96KQ7-2|EHMT2_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase EHMT2 OS=Homo sapiens OX=9606 GN=EHMT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	766-UNIMOD:35	0.01	27.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1359-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q9BXK5-4|B2L13_HUMAN	Isoform 3 of Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P25490|TYY1_HUMAN	Transcriptional repressor protein YY1 OS=Homo sapiens OX=9606 GN=YY1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	4	1	0
PRT	sp|O75153|CLU_HUMAN	Clustered mitochondria protein homolog OS=Homo sapiens OX=9606 GN=CLUH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P02788-2|TRFL_HUMAN	Isoform DeltaLf of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	206-UNIMOD:4	0.04	27.0	2	2	2
PRT	sp|P09493-2|TPM1_HUMAN	Isoform 2 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	1	1	1
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P31431|SDC4_HUMAN	Syndecan-4 OS=Homo sapiens OX=9606 GN=SDC4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.15	27.0	2	2	2
PRT	sp|Q13619-2|CUL4A_HUMAN	Isoform 2 of Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P25686-2|DNJB2_HUMAN	Isoform 2 of DnaJ homolog subfamily B member 2 OS=Homo sapiens OX=9606 GN=DNAJB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q12904|AIMP1_HUMAN	Aminoacyl tRNA synthase complex-interacting multifunctional protein 1 OS=Homo sapiens OX=9606 GN=AIMP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q5T5P2-3|SKT_HUMAN	Isoform 3 of Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P26440-2|IVD_HUMAN	Isoform 2 of Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=IVD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	224-UNIMOD:4,231-UNIMOD:4	0.04	27.0	1	1	0
PRT	sp|Q8WX93-4|PALLD_HUMAN	Isoform 4 of Palladin OS=Homo sapiens OX=9606 GN=PALLD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9H9H4|VP37B_HUMAN	Vacuolar protein sorting-associated protein 37B OS=Homo sapiens OX=9606 GN=VPS37B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	124-UNIMOD:35	0.04	27.0	1	1	1
PRT	sp|Q8WW22-3|DNJA4_HUMAN	Isoform 3 of DnaJ homolog subfamily A member 4 OS=Homo sapiens OX=9606 GN=DNAJA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	332-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|Q9Y5A7-2|NUB1_HUMAN	Isoform 2 of NEDD8 ultimate buster 1 OS=Homo sapiens OX=9606 GN=NUB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	299-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|P02675|FIBB_HUMAN	Fibrinogen beta chain OS=Homo sapiens OX=9606 GN=FGB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	220-UNIMOD:35,223-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|Q9UNZ2-6|NSF1C_HUMAN	Isoform 4 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|Q00587-2|BORG5_HUMAN	Isoform 2 of Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	99-UNIMOD:35,113-UNIMOD:21,106-UNIMOD:21	0.05	27.0	2	1	0
PRT	sp|Q9UBI9|HDC_HUMAN	Headcase protein homolog OS=Homo sapiens OX=9606 GN=HECA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	368-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|P15924-3|DESP_HUMAN	Isoform DSPIa of Desmoplakin OS=Homo sapiens OX=9606 GN=DSP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	599-UNIMOD:35	0.01	27.0	2	1	0
PRT	sp|Q9NVM6|DJC17_HUMAN	DnaJ homolog subfamily C member 17 OS=Homo sapiens OX=9606 GN=DNAJC17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|Q9P253|VPS18_HUMAN	Vacuolar protein sorting-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=VPS18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	741-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|O43768-8|ENSA_HUMAN	Isoform 8 of Alpha-endosulfine OS=Homo sapiens OX=9606 GN=ENSA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.14	27.0	1	1	1
PRT	sp|Q0ZGT2-4|NEXN_HUMAN	Isoform 4 of Nexilin OS=Homo sapiens OX=9606 GN=NEXN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	351-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	151-UNIMOD:21,155-UNIMOD:21	0.02	27.0	10	1	0
PRT	sp|Q9H4A5-2|GLP3L_HUMAN	Isoform 2 of Golgi phosphoprotein 3-like OS=Homo sapiens OX=9606 GN=GOLPH3L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.07	27.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|O15085|ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	639-UNIMOD:35	0.01	27.0	1	1	1
PRT	sp|O94885|SASH1_HUMAN	SAM and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SASH1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	169-UNIMOD:21,184-UNIMOD:35	0.03	27.0	2	2	2
PRT	sp|Q9BY42|RTF2_HUMAN	Protein RTF2 homolog OS=Homo sapiens OX=9606 GN=RTFDC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q5T0W9|FA83B_HUMAN	Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	845-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P42224-2|STAT1_HUMAN	Isoform Beta of Signal transducer and activator of transcription 1-alpha/beta OS=Homo sapiens OX=9606 GN=STAT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P01591|IGJ_HUMAN	Immunoglobulin J chain OS=Homo sapiens OX=9606 GN=JCHAIN PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	267-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q6IA86-4|ELP2_HUMAN	Isoform 4 of Elongator complex protein 2 OS=Homo sapiens OX=9606 GN=ELP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P05166|PCCB_HUMAN	Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P02751-12|FINC_HUMAN	Isoform 12 of Fibronectin OS=Homo sapiens OX=9606 GN=FN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	2	2
PRT	sp|Q07020-2|RL18_HUMAN	Isoform 2 of 60S ribosomal protein L18 OS=Homo sapiens OX=9606 GN=RPL18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P50395-2|GDIB_HUMAN	Isoform 2 of Rab GDP dissociation inhibitor beta OS=Homo sapiens OX=9606 GN=GDI2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	157-UNIMOD:4	0.04	27.0	1	1	1
PRT	sp|P05091-2|ALDH2_HUMAN	Isoform 2 of Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	797-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|P25705-3|ATPA_HUMAN	Isoform 3 of ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	51-UNIMOD:35	0.03	27.0	1	1	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	tRNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P23634-5|AT2B4_HUMAN	Isoform ZK of Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens OX=9606 GN=ATP2B4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8IUI8-2|CRLF3_HUMAN	Isoform 2 of Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	2	1	0
PRT	sp|P29536-2|LMOD1_HUMAN	Isoform 2 of Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q9Y3A4|RRP7A_HUMAN	Ribosomal RNA-processing protein 7 homolog A OS=Homo sapiens OX=9606 GN=RRP7A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	177-UNIMOD:35	0.05	27.0	1	1	1
PRT	sp|Q14684-2|RRP1B_HUMAN	Isoform 2 of Ribosomal RNA processing protein 1 homolog B OS=Homo sapiens OX=9606 GN=RRP1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	368-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|O75822-3|EIF3J_HUMAN	Isoform 3 of Eukaryotic translation initiation factor 3 subunit J OS=Homo sapiens OX=9606 GN=EIF3J	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.06	27.0	2	1	0
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	153-UNIMOD:4	0.07	27.0	1	1	1
PRT	sp|Q9Y281-3|COF2_HUMAN	Isoform 3 of Cofilin-2 OS=Homo sapiens OX=9606 GN=CFL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|Q9UHD2|TBK1_HUMAN	Serine/threonine-protein kinase TBK1 OS=Homo sapiens OX=9606 GN=TBK1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	414-UNIMOD:35	0.02	27.0	2	1	0
PRT	sp|P25815|S100P_HUMAN	Protein S100-P OS=Homo sapiens OX=9606 GN=S100P PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.15	27.0	1	1	1
PRT	sp|O15460-2|P4HA2_HUMAN	Isoform IIa of Prolyl 4-hydroxylase subunit alpha-2 OS=Homo sapiens OX=9606 GN=P4HA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	345-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|Q86VM9|ZCH18_HUMAN	Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	0
PRT	sp|Q9NZM1|MYOF_HUMAN	Myoferlin OS=Homo sapiens OX=9606 GN=MYOF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.01	27.0	1	1	0
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	3	1	0
PRT	sp|O75190|DNJB6_HUMAN	DnaJ homolog subfamily B member 6 OS=Homo sapiens OX=9606 GN=DNAJB6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	48-UNIMOD:28	0.04	27.0	1	1	0
PRT	sp|Q4VCS5|AMOT_HUMAN	Angiomotin OS=Homo sapiens OX=9606 GN=AMOT PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	717-UNIMOD:21	0.02	27.0	1	1	0
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	34-UNIMOD:27,38-UNIMOD:35	0.07	27.0	1	1	1
PRT	sp|O43586|PPIP1_HUMAN	Proline-serine-threonine phosphatase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PSTPIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	3	1	0
PRT	sp|A5YM69|ARG35_HUMAN	Rho guanine nucleotide exchange factor 35 OS=Homo sapiens OX=9606 GN=ARHGEF35 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	184-UNIMOD:21,186-UNIMOD:4	0.05	27.0	2	1	0
PRT	sp|Q96JI7|SPTCS_HUMAN	Spatacsin OS=Homo sapiens OX=9606 GN=SPG11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	325-UNIMOD:35	0.01	27.0	1	1	0
PRT	sp|Q9NTK5|OLA1_HUMAN	Obg-like ATPase 1 OS=Homo sapiens OX=9606 GN=OLA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|Q53TN4|CYBR1_HUMAN	Cytochrome b reductase 1 OS=Homo sapiens OX=9606 GN=CYBRD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	249-UNIMOD:35,257-UNIMOD:35,260-UNIMOD:21	0.09	27.0	1	1	1
PRT	sp|Q15031|SYLM_HUMAN	Probable leucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=LARS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9UBT2-2|SAE2_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q86V48-2|LUZP1_HUMAN	Isoform 2 of Leucine zipper protein 1 OS=Homo sapiens OX=9606 GN=LUZP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q14692|BMS1_HUMAN	Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens OX=9606 GN=BMS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	7	1	0
PRT	sp|P80723-2|BASP1_HUMAN	Isoform 2 of Brain acid soluble protein 1 OS=Homo sapiens OX=9606 GN=BASP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	2	2	2
PRT	sp|P78356|PI42B_HUMAN	Phosphatidylinositol 5-phosphate 4-kinase type-2 beta OS=Homo sapiens OX=9606 GN=PIP4K2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	296-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|Q96L93-6|KI16B_HUMAN	Isoform 5 of Kinesin-like protein KIF16B OS=Homo sapiens OX=9606 GN=KIF16B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P67936-2|TPM4_HUMAN	Isoform 2 of Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	342-UNIMOD:21,339-UNIMOD:21	0.07	26.0	2	1	0
PRT	sp|Q86YQ8-2|CPNE8_HUMAN	Isoform 2 of Copine-8 OS=Homo sapiens OX=9606 GN=CPNE8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	2	1	0
PRT	sp|Q9BV68-2|RN126_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens OX=9606 GN=RNF126	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	32-UNIMOD:4	0.05	26.0	1	1	1
PRT	sp|O43586-2|PPIP1_HUMAN	Isoform 2 of Proline-serine-threonine phosphatase-interacting protein 1 OS=Homo sapiens OX=9606 GN=PSTPIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	3	1	0
PRT	sp|P50995-2|ANX11_HUMAN	Isoform 2 of Annexin A11 OS=Homo sapiens OX=9606 GN=ANXA11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	768-UNIMOD:35,203-UNIMOD:35	0.03	26.0	4	3	2
PRT	sp|Q86U86-5|PB1_HUMAN	Isoform 5 of Protein polybromo-1 OS=Homo sapiens OX=9606 GN=PBRM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1059-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|Q12864|CAD17_HUMAN	Cadherin-17 OS=Homo sapiens OX=9606 GN=CDH17 PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9Y696|CLIC4_HUMAN	Chloride intracellular channel protein 4 OS=Homo sapiens OX=9606 GN=CLIC4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	234-UNIMOD:4	0.05	26.0	3	1	0
PRT	sp|Q9H6S3-2|ES8L2_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|Q5VT25-3|MRCKA_HUMAN	Isoform 3 of Serine/threonine-protein kinase MRCK alpha OS=Homo sapiens OX=9606 GN=CDC42BPA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P06730|IF4E_HUMAN	Eukaryotic translation initiation factor 4E OS=Homo sapiens OX=9606 GN=EIF4E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	101-UNIMOD:35	0.06	26.0	2	1	0
PRT	sp|A7E2Y1|MYH7B_HUMAN	Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|O43852-15|CALU_HUMAN	Isoform 15 of Calumenin OS=Homo sapiens OX=9606 GN=CALU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	46-UNIMOD:35	0.09	26.0	1	1	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	134-UNIMOD:35	0.02	26.0	2	1	0
PRT	sp|Q63HR2-5|TNS2_HUMAN	Isoform 5 of Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q16877-2|F264_HUMAN	Isoform 2 of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens OX=9606 GN=PFKFB4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	192-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|P38159-2|RBMX_HUMAN	Isoform 2 of RNA-binding motif protein, X chromosome OS=Homo sapiens OX=9606 GN=RBMX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q05655|KPCD_HUMAN	Protein kinase C delta type OS=Homo sapiens OX=9606 GN=PRKCD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9Y3B7-2|RM11_HUMAN	Isoform 2 of 39S ribosomal protein L11, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|Q6UB99|ANR11_HUMAN	Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	818-UNIMOD:4	0.00	26.0	1	1	1
PRT	sp|O75348|VATG1_HUMAN	V-type proton ATPase subunit G 1 OS=Homo sapiens OX=9606 GN=ATP6V1G1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	2	2	2
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	448-UNIMOD:21,582-UNIMOD:35	0.04	26.0	4	2	1
PRT	sp|Q00722-3|PLCB2_HUMAN	Isoform 3 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2 OS=Homo sapiens OX=9606 GN=PLCB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P02775|CXCL7_HUMAN	Platelet basic protein OS=Homo sapiens OX=9606 GN=PPBP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|Q93062-4|RBPMS_HUMAN	Isoform D of RNA-binding protein with multiple splicing OS=Homo sapiens OX=9606 GN=RBPMS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|P19971|TYPH_HUMAN	Thymidine phosphorylase OS=Homo sapiens OX=9606 GN=TYMP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q9Y3Y2-4|CHTOP_HUMAN	Isoform 3 of Chromatin target of PRMT1 protein OS=Homo sapiens OX=9606 GN=CHTOP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	178-UNIMOD:35	0.07	26.0	1	1	1
PRT	sp|P04233-2|HG2A_HUMAN	Isoform 2 of HLA class II histocompatibility antigen gamma chain OS=Homo sapiens OX=9606 GN=CD74	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q63ZY3-3|KANK2_HUMAN	Isoform 3 of KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	573-UNIMOD:21,568-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	330-UNIMOD:35	0.03	26.0	2	1	0
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|Q02817|MUC2_HUMAN	Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	4771-UNIMOD:4,4779-UNIMOD:4	0.00	26.0	1	1	1
PRT	sp|Q6N022|TEN4_HUMAN	Teneurin-4 OS=Homo sapiens OX=9606 GN=TENM4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	830-UNIMOD:4,834-UNIMOD:35,838-UNIMOD:4	0.01	26.0	1	1	1
PRT	sp|P49747-2|COMP_HUMAN	Isoform 2 of Cartilage oligomeric matrix protein OS=Homo sapiens OX=9606 GN=COMP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	318-UNIMOD:4	0.02	26.0	3	1	0
PRT	sp|Q9UBQ0|VPS29_HUMAN	Vacuolar protein sorting-associated protein 29 OS=Homo sapiens OX=9606 GN=VPS29 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	630-UNIMOD:35	0.04	26.0	3	2	1
PRT	sp|Q13451|FKBP5_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP5 OS=Homo sapiens OX=9606 GN=FKBP5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	443-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q9NZA1-3|CLIC5_HUMAN	Isoform 3 of Chloride intracellular channel protein 5 OS=Homo sapiens OX=9606 GN=CLIC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q9HB71-3|CYBP_HUMAN	Isoform 3 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	163-UNIMOD:35	0.06	26.0	4	1	0
PRT	sp|Q12830-4|BPTF_HUMAN	Isoform 4 of Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens OX=9606 GN=BPTF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.00	26.0	1	1	1
PRT	sp|P54619-2|AAKG1_HUMAN	Isoform 2 of 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens OX=9606 GN=PRKAG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|P56937-3|DHB7_HUMAN	Isoform 3 of 3-keto-steroid reductase OS=Homo sapiens OX=9606 GN=HSD17B7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	267-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	709-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|Q9NWT6|HIF1N_HUMAN	Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens OX=9606 GN=HIF1AN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	1	1	1
PRT	sp|Q8WWF6|DNJB3_HUMAN	DnaJ homolog subfamily B member 3 OS=Homo sapiens OX=9606 GN=DNAJB3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	0
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q9H4A6|GOLP3_HUMAN	Golgi phosphoprotein 3 OS=Homo sapiens OX=9606 GN=GOLPH3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q86U44|MTA70_HUMAN	N6-adenosine-methyltransferase catalytic subunit OS=Homo sapiens OX=9606 GN=METTL3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	48-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q69YQ0-2|CYTSA_HUMAN	Isoform 2 of Cytospin-A OS=Homo sapiens OX=9606 GN=SPECC1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	796-UNIMOD:35,378-UNIMOD:21	0.05	26.0	2	2	2
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	293-UNIMOD:35	0.04	26.0	1	1	0
PRT	sp|Q9UJ70|NAGK_HUMAN	N-acetyl-D-glucosamine kinase OS=Homo sapiens OX=9606 GN=NAGK PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q96A65|EXOC4_HUMAN	Exocyst complex component 4 OS=Homo sapiens OX=9606 GN=EXOC4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q8TDY2-2|RBCC1_HUMAN	Isoform 2 of RB1-inducible coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=RB1CC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	261-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9H9S4|CB39L_HUMAN	Calcium-binding protein 39-like OS=Homo sapiens OX=9606 GN=CAB39L PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P11586|C1TC_HUMAN	C-1-tetrahydrofolate synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=MTHFD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	3	3	3
PRT	sp|Q8NFD5-4|ARI1B_HUMAN	Isoform 4 of AT-rich interactive domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ARID1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	992-UNIMOD:21,994-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|P61106|RAB14_HUMAN	Ras-related protein Rab-14 OS=Homo sapiens OX=9606 GN=RAB14 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q07866-8|KLC1_HUMAN	Isoform S of Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	516-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|P55082-2|MFAP3_HUMAN	Isoform 2 of Microfibril-associated glycoprotein 3 OS=Homo sapiens OX=9606 GN=MFAP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q1ED39|KNOP1_HUMAN	Lysine-rich nucleolar protein 1 OS=Homo sapiens OX=9606 GN=KNOP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	3	1	0
PRT	sp|O15305-2|PMM2_HUMAN	Isoform 2 of Phosphomannomutase 2 OS=Homo sapiens OX=9606 GN=PMM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.11	26.0	1	1	1
PRT	sp|Q9Y285-2|SYFA_HUMAN	Isoform 2 of Phenylalanine--tRNA ligase alpha subunit OS=Homo sapiens OX=9606 GN=FARSA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	132-UNIMOD:35	0.03	26.0	2	1	0
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	1570-UNIMOD:21	0.01	26.0	3	1	0
PRT	sp|P15924|DESP_HUMAN	Desmoplakin OS=Homo sapiens OX=9606 GN=DSP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	57-UNIMOD:4,62-UNIMOD:35	0.01	26.0	2	1	0
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	378-UNIMOD:28	0.04	26.0	4	2	0
PRT	sp|P53999|TCP4_HUMAN	Activated RNA polymerase II transcriptional coactivator p15 OS=Homo sapiens OX=9606 GN=SUB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	115-UNIMOD:27	0.09	26.0	3	1	0
PRT	sp|Q5EBL4|RIPL1_HUMAN	RILP-like protein 1 OS=Homo sapiens OX=9606 GN=RILPL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	259-UNIMOD:21	0.07	26.0	1	1	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	104-UNIMOD:21,108-UNIMOD:35	0.16	26.0	1	1	0
PRT	sp|P13645|K1C10_HUMAN	Keratin, type I cytoskeletal 10 OS=Homo sapiens OX=9606 GN=KRT10 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q08170|SRSF4_HUMAN	Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	0
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	1132-UNIMOD:21	0.01	26.0	3	2	1
PRT	sp|Q12906-4|ILF3_HUMAN	Isoform 4 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	486-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|Q6P1R4|DUS1L_HUMAN	tRNA-dihydrouridine(16/17) synthase [NAD(P)(+)]-like OS=Homo sapiens OX=9606 GN=DUS1L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9NPB8|GPCP1_HUMAN	Glycerophosphocholine phosphodiesterase GPCPD1 OS=Homo sapiens OX=9606 GN=GPCPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P49006|MRP_HUMAN	MARCKS-related protein OS=Homo sapiens OX=9606 GN=MARCKSL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	864-UNIMOD:21,866-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|P56182|RRP1_HUMAN	Ribosomal RNA processing protein 1 homolog A OS=Homo sapiens OX=9606 GN=RRP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q8TE77-4|SSH3_HUMAN	Isoform 4 of Protein phosphatase Slingshot homolog 3 OS=Homo sapiens OX=9606 GN=SSH3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	70-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|P98160|PGBM_HUMAN	Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	344-UNIMOD:4,350-UNIMOD:4	0.00	25.0	3	1	0
PRT	sp|O15169-2|AXIN1_HUMAN	Isoform 2 of Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	249-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|Q03164-2|KMT2A_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1537-UNIMOD:4	0.00	25.0	1	1	1
PRT	sp|P81605|DCD_HUMAN	Dermcidin OS=Homo sapiens OX=9606 GN=DCD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|O75607|NPM3_HUMAN	Nucleoplasmin-3 OS=Homo sapiens OX=9606 GN=NPM3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	79-UNIMOD:4	0.07	25.0	1	1	1
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	10	1	0
PRT	sp|O95433-2|AHSA1_HUMAN	Isoform 2 of Activator of 90 kDa heat shock protein ATPase homolog 1 OS=Homo sapiens OX=9606 GN=AHSA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	136-UNIMOD:35	0.05	25.0	3	1	0
PRT	sp|P13797-3|PLST_HUMAN	Isoform 3 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	220-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q12805-2|FBLN3_HUMAN	Isoform 2 of EGF-containing fibulin-like extracellular matrix protein 1 OS=Homo sapiens OX=9606 GN=EFEMP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	40-UNIMOD:4,47-UNIMOD:4	0.03	25.0	1	1	1
PRT	sp|P57764|GSDMD_HUMAN	Gasdermin-D OS=Homo sapiens OX=9606 GN=GSDMD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q86WJ1-5|CHD1L_HUMAN	Isoform 5 of Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens OX=9606 GN=CHD1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9Y4D7-2|PLXD1_HUMAN	Isoform 2 of Plexin-D1 OS=Homo sapiens OX=9606 GN=PLXND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9HD20-3|AT131_HUMAN	Isoform C of Manganese-transporting ATPase 13A1 OS=Homo sapiens OX=9606 GN=ATP13A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9BRK5-4|CAB45_HUMAN	Isoform 4 of 45 kDa calcium-binding protein OS=Homo sapiens OX=9606 GN=SDF4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	0
PRT	sp|Q9Y496|KIF3A_HUMAN	Kinesin-like protein KIF3A OS=Homo sapiens OX=9606 GN=KIF3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	195-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q9UMZ2-6|SYNRG_HUMAN	Isoform 5 of Synergin gamma OS=Homo sapiens OX=9606 GN=SYNRG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9NZ08|ERAP1_HUMAN	Endoplasmic reticulum aminopeptidase 1 OS=Homo sapiens OX=9606 GN=ERAP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	692-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.14	25.0	2	2	2
PRT	sp|P63261|ACTG_HUMAN	Actin, cytoplasmic 2 OS=Homo sapiens OX=9606 GN=ACTG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	158-UNIMOD:4,162-UNIMOD:35,1753-UNIMOD:35	0.01	25.0	6	3	2
PRT	sp|O14647-2|CHD2_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P49750-3|YLPM1_HUMAN	Isoform 3 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|P02647|APOA1_HUMAN	Apolipoprotein A-I OS=Homo sapiens OX=9606 GN=APOA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9H444|CHM4B_HUMAN	Charged multivesicular body protein 4b OS=Homo sapiens OX=9606 GN=CHMP4B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q99795|GPA33_HUMAN	Cell surface A33 antigen OS=Homo sapiens OX=9606 GN=GPA33 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P12270|TPR_HUMAN	Nucleoprotein TPR OS=Homo sapiens OX=9606 GN=TPR PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	2	2	2
PRT	sp|Q9H9B1|EHMT1_HUMAN	Histone-lysine N-methyltransferase EHMT1 OS=Homo sapiens OX=9606 GN=EHMT1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q2M389|WASC4_HUMAN	WASH complex subunit 4 OS=Homo sapiens OX=9606 GN=WASHC4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1156-UNIMOD:21,1154-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q9BRZ2|TRI56_HUMAN	E3 ubiquitin-protein ligase TRIM56 OS=Homo sapiens OX=9606 GN=TRIM56 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q8TCT9-5|HM13_HUMAN	Isoform 5 of Minor histocompatibility antigen H13 OS=Homo sapiens OX=9606 GN=HM13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	3	1	0
PRT	sp|Q96P47-5|AGAP3_HUMAN	Isoform 5 of Arf-GAP with GTPase, ANK repeat and PH domain-containing protein 3 OS=Homo sapiens OX=9606 GN=AGAP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|P09455|RET1_HUMAN	Retinol-binding protein 1 OS=Homo sapiens OX=9606 GN=RBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	2	1	0
PRT	sp|Q01995|TAGL_HUMAN	Transgelin OS=Homo sapiens OX=9606 GN=TAGLN PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q8N7H5-3|PAF1_HUMAN	Isoform 3 of RNA polymerase II-associated factor 1 homolog OS=Homo sapiens OX=9606 GN=PAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9NY33-4|DPP3_HUMAN	Isoform 4 of Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=DPP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	146-UNIMOD:4,148-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q8NF91-4|SYNE1_HUMAN	Isoform 4 of Nesprin-1 OS=Homo sapiens OX=9606 GN=SYNE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	5515-UNIMOD:35	0.00	25.0	1	1	1
PRT	sp|P51114-2|FXR1_HUMAN	Isoform 2 of Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|Q9NVA2|SEP11_HUMAN	Septin-11 OS=Homo sapiens OX=9606 GN=SEPT11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q9UI36-2|DACH1_HUMAN	Isoform 2 of Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	441-UNIMOD:21,445-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q13510-3|ASAH1_HUMAN	Isoform 3 of Acid ceramidase OS=Homo sapiens OX=9606 GN=ASAH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|P33527-8|MRP1_HUMAN	Isoform 8 of Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	288-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q96RT1-7|ERBIN_HUMAN	Isoform 7 of Erbin OS=Homo sapiens OX=9606 GN=ERBIN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	642-UNIMOD:21,658-UNIMOD:4	0.02	25.0	1	1	0
PRT	sp|P24844-2|MYL9_HUMAN	Isoform 2 of Myosin regulatory light polypeptide 9 OS=Homo sapiens OX=9606 GN=MYL9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	88-UNIMOD:35	0.10	25.0	3	1	0
PRT	sp|O60493-2|SNX3_HUMAN	Isoform 2 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	2	1	0
PRT	sp|P50990-3|TCPQ_HUMAN	Isoform 3 of T-complex protein 1 subunit theta OS=Homo sapiens OX=9606 GN=CCT8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	203-UNIMOD:35,312-UNIMOD:35	0.05	25.0	3	2	1
PRT	sp|Q8TDB6|DTX3L_HUMAN	E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	437-UNIMOD:21,439-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9BZE4-3|NOG1_HUMAN	Isoform 3 of Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9H3R5|CENPH_HUMAN	Centromere protein H OS=Homo sapiens OX=9606 GN=CENPH PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q9BZJ0-2|CRNL1_HUMAN	Isoform 2 of Crooked neck-like protein 1 OS=Homo sapiens OX=9606 GN=CRNKL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	2	2	2
PRT	sp|P78310-5|CXAR_HUMAN	Isoform 5 of Coxsackievirus and adenovirus receptor OS=Homo sapiens OX=9606 GN=CXADR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	146-UNIMOD:4	0.10	25.0	2	2	2
PRT	sp|Q6IQ23-3|PKHA7_HUMAN	Isoform 3 of Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	477-UNIMOD:21,481-UNIMOD:21,137-UNIMOD:21,143-UNIMOD:21	0.04	25.0	4	2	1
PRT	sp|P49441|INPP_HUMAN	Inositol polyphosphate 1-phosphatase OS=Homo sapiens OX=9606 GN=INPP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	97-UNIMOD:4	0.04	25.0	1	1	1
PRT	sp|P13671|CO6_HUMAN	Complement component C6 OS=Homo sapiens OX=9606 GN=C6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	158-UNIMOD:4,164-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q5JTD0-2|TJAP1_HUMAN	Isoform 2 of Tight junction-associated protein 1 OS=Homo sapiens OX=9606 GN=TJAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	2	2	2
PRT	sp|Q9NWS8-2|RMND1_HUMAN	Isoform 2 of Required for meiotic nuclear division protein 1 homolog OS=Homo sapiens OX=9606 GN=RMND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q99504-2|EYA3_HUMAN	Isoform 2 of Eyes absent homolog 3 OS=Homo sapiens OX=9606 GN=EYA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	143-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|Q9Y333|LSM2_HUMAN	U6 snRNA-associated Sm-like protein LSm2 OS=Homo sapiens OX=9606 GN=LSM2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.13	25.0	1	1	1
PRT	sp|Q96EI5|TCAL4_HUMAN	Transcription elongation factor A protein-like 4 OS=Homo sapiens OX=9606 GN=TCEAL4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	18-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|P63208|SKP1_HUMAN	S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|P0CB38|PAB4L_HUMAN	Polyadenylate-binding protein 4-like OS=Homo sapiens OX=9606 GN=PABPC4L PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q96M89-2|CC138_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 138 OS=Homo sapiens OX=9606 GN=CCDC138	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|O00305-4|CACB4_HUMAN	Isoform 4 of Voltage-dependent L-type calcium channel subunit beta-4 OS=Homo sapiens OX=9606 GN=CACNB4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	51-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q6H8Q1-8|ABLM2_HUMAN	Isoform 8 of Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q6H8Q1-4|ABLM2_HUMAN	Isoform 4 of Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|P55011-3|S12A2_HUMAN	Isoform 2 of Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q96EP1-5|CHFR_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase CHFR OS=Homo sapiens OX=9606 GN=CHFR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	287-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q8NE01|CNNM3_HUMAN	Metal transporter CNNM3 OS=Homo sapiens OX=9606 GN=CNNM3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P55789|ALR_HUMAN	FAD-linked sulfhydryl oxidase ALR OS=Homo sapiens OX=9606 GN=GFER PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	26-UNIMOD:35,27-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|Q14938-6|NFIX_HUMAN	Isoform 6 of Nuclear factor 1 X-type OS=Homo sapiens OX=9606 GN=NFIX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	278-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|Q99715-4|COCA1_HUMAN	Isoform 4 of Collagen alpha-1(XII) chain OS=Homo sapiens OX=9606 GN=COL12A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|P10606|COX5B_HUMAN	Cytochrome c oxidase subunit 5B, mitochondrial OS=Homo sapiens OX=9606 GN=COX5B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	31-UNIMOD:35	0.16	25.0	1	1	1
PRT	sp|O75128-2|COBL_HUMAN	Isoform 2 of Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	258-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	153-UNIMOD:21,257-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|P82094|TMF1_HUMAN	TATA element modulatory factor OS=Homo sapiens OX=9606 GN=TMF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	646-UNIMOD:35	0.02	25.0	2	2	2
PRT	sp|P00492|HPRT_HUMAN	Hypoxanthine-guanine phosphoribosyltransferase OS=Homo sapiens OX=9606 GN=HPRT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	106-UNIMOD:4	0.06	25.0	2	1	0
PRT	sp|Q9Y376|CAB39_HUMAN	Calcium-binding protein 39 OS=Homo sapiens OX=9606 GN=CAB39 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P23141-3|EST1_HUMAN	Isoform 3 of Liver carboxylesterase 1 OS=Homo sapiens OX=9606 GN=CES1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q8NHM5-4|KDM2B_HUMAN	Isoform 4 of Lysine-specific demethylase 2B OS=Homo sapiens OX=9606 GN=KDM2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	906-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P07951-2|TPM2_HUMAN	Isoform 2 of Tropomyosin beta chain OS=Homo sapiens OX=9606 GN=TPM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P62987|RL40_HUMAN	Ubiquitin-60S ribosomal protein L40 OS=Homo sapiens OX=9606 GN=UBA52 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.13	25.0	1	1	1
PRT	sp|O60234|GMFG_HUMAN	Glia maturation factor gamma OS=Homo sapiens OX=9606 GN=GMFG PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|Q9Y230-2|RUVB2_HUMAN	Isoform 2 of RuvB-like 2 OS=Homo sapiens OX=9606 GN=RUVBL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	123-UNIMOD:35	0.03	25.0	1	1	1
PRT	sp|Q9BTU6|P4K2A_HUMAN	Phosphatidylinositol 4-kinase type 2-alpha OS=Homo sapiens OX=9606 GN=PI4K2A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	47-UNIMOD:21,51-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q13123|RED_HUMAN	Protein Red OS=Homo sapiens OX=9606 GN=IK PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	394-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|Q9BPX5|ARP5L_HUMAN	Actin-related protein 2/3 complex subunit 5-like protein OS=Homo sapiens OX=9606 GN=ARPC5L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|Q9NYU2-2|UGGG1_HUMAN	Isoform 2 of UDP-glucose:glycoprotein glucosyltransferase 1 OS=Homo sapiens OX=9606 GN=UGGT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	924-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|O75223-3|GGCT_HUMAN	Isoform 3 of Gamma-glutamylcyclotransferase OS=Homo sapiens OX=9606 GN=GGCT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	1	1	1
PRT	sp|Q4G0N4-2|NAKD2_HUMAN	Isoform 2 of NAD kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=NADK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P20591-2|MX1_HUMAN	Isoform 2 of Interferon-induced GTP-binding protein Mx1 OS=Homo sapiens OX=9606 GN=MX1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|P61978|HNRPK_HUMAN	Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens OX=9606 GN=HNRNPK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	0
PRT	sp|P09525|ANXA4_HUMAN	Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	173-UNIMOD:28	0.04	25.0	1	1	1
PRT	sp|Q92538|GBF1_HUMAN	Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	659-UNIMOD:21,661-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|P52907|CAZA1_HUMAN	F-actin-capping protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=CAPZA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	2-UNIMOD:1	0.10	25.0	3	2	1
PRT	sp|P02730|B3AT_HUMAN	Band 3 anion transport protein OS=Homo sapiens OX=9606 GN=SLC4A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	885-UNIMOD:4	0.02	25.0	3	1	0
PRT	sp|Q6IQ23|PKHA7_HUMAN	Pleckstrin homology domain-containing family A member 7 OS=Homo sapiens OX=9606 GN=PLEKHA7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	569-UNIMOD:21	0.02	25.0	3	1	0
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	0
PRT	sp|Q9H6S3|ES8L2_HUMAN	Epidermal growth factor receptor kinase substrate 8-like protein 2 OS=Homo sapiens OX=9606 GN=EPS8L2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	0
PRT	sp|Q9NSK0|KLC4_HUMAN	Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	155-UNIMOD:28	0.02	25.0	1	1	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	347-UNIMOD:35	0.03	25.0	2	1	0
PRT	sp|P13569|CFTR_HUMAN	Cystic fibrosis transmembrane conductance regulator OS=Homo sapiens OX=9606 GN=CFTR PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	491-UNIMOD:27	0.02	25.0	2	1	0
PRT	sp|P26440|IVD_HUMAN	Isovaleryl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=IVD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	254-UNIMOD:4,261-UNIMOD:4	0.03	25.0	2	1	0
PRT	sp|Q8N9T8|KRI1_HUMAN	Protein KRI1 homolog OS=Homo sapiens OX=9606 GN=KRI1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q9H6A9|PCX3_HUMAN	Pecanex-like protein 3 OS=Homo sapiens OX=9606 GN=PCNX3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	1909-UNIMOD:21	0.01	25.0	1	1	0
PRT	sp|Q9HCM2|PLXA4_HUMAN	Plexin-A4 OS=Homo sapiens OX=9606 GN=PLXNA4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	1522-UNIMOD:4,1526-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P09622-2|DLDH_HUMAN	Isoform 2 of Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|Q8WUH1|CHUR_HUMAN	Protein Churchill OS=Homo sapiens OX=9606 GN=CHURC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q9NR28-2|DBLOH_HUMAN	Isoform 2 of Diablo homolog, mitochondrial OS=Homo sapiens OX=9606 GN=DIABLO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	2	2	2
PRT	sp|Q9UH92-3|MLX_HUMAN	Isoform Beta of Max-like protein X OS=Homo sapiens OX=9606 GN=MLX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	44-UNIMOD:21	0.12	24.0	1	1	1
PRT	sp|Q9UQN3-2|CHM2B_HUMAN	Isoform 2 of Charged multivesicular body protein 2b OS=Homo sapiens OX=9606 GN=CHMP2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P30040|ERP29_HUMAN	Endoplasmic reticulum resident protein 29 OS=Homo sapiens OX=9606 GN=ERP29 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1382-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q6UB35-2|C1TM_HUMAN	Isoform 2 of Monofunctional C1-tetrahydrofolate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=MTHFD1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q15020-4|SART3_HUMAN	Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P28838-2|AMPL_HUMAN	Isoform 2 of Cytosol aminopeptidase OS=Homo sapiens OX=9606 GN=LAP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O60885|BRD4_HUMAN	Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8IWB7|WDFY1_HUMAN	WD repeat and FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=WDFY1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	287-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q9UGN4-3|CLM8_HUMAN	Isoform 3 of CMRF35-like molecule 8 OS=Homo sapiens OX=9606 GN=CD300A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.13	24.0	1	1	1
PRT	sp|Q14651|PLSI_HUMAN	Plastin-1 OS=Homo sapiens OX=9606 GN=PLS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O43293|DAPK3_HUMAN	Death-associated protein kinase 3 OS=Homo sapiens OX=9606 GN=DAPK3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	2	2	2
PRT	sp|Q96SQ9|CP2S1_HUMAN	Cytochrome P450 2S1 OS=Homo sapiens OX=9606 GN=CYP2S1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	515-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|P00325-2|ADH1B_HUMAN	Isoform 2 of Alcohol dehydrogenase 1B OS=Homo sapiens OX=9606 GN=ADH1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	201-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q99996-5|AKAP9_HUMAN	Isoform 5 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	3064-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P56537|IF6_HUMAN	Eukaryotic translation initiation factor 6 OS=Homo sapiens OX=9606 GN=EIF6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q9UNF1-2|MAGD2_HUMAN	Isoform 2 of Melanoma-associated antigen D2 OS=Homo sapiens OX=9606 GN=MAGED2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|Q9P2N6-8|KANL3_HUMAN	Isoform 8 of KAT8 regulatory NSL complex subunit 3 OS=Homo sapiens OX=9606 GN=KANSL3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	309-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q05823-2|RN5A_HUMAN	Isoform 2 of 2-5A-dependent ribonuclease OS=Homo sapiens OX=9606 GN=RNASEL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q5BKZ1-3|ZN326_HUMAN	Isoform 3 of DBIRD complex subunit ZNF326 OS=Homo sapiens OX=9606 GN=ZNF326	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	272-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|Q9UKX7-2|NUP50_HUMAN	Isoform 2 of Nuclear pore complex protein Nup50 OS=Homo sapiens OX=9606 GN=NUP50	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q8N8A6|DDX51_HUMAN	ATP-dependent RNA helicase DDX51 OS=Homo sapiens OX=9606 GN=DDX51 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O75398-5|DEAF1_HUMAN	Isoform 4 of Deformed epidermal autoregulatory factor 1 homolog OS=Homo sapiens OX=9606 GN=DEAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	176-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|O43169|CYB5B_HUMAN	Cytochrome b5 type B OS=Homo sapiens OX=9606 GN=CYB5B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.09	24.0	1	1	1
PRT	sp|Q9NPG1|FZD3_HUMAN	Frizzled-3 OS=Homo sapiens OX=9606 GN=FZD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	561-UNIMOD:21,567-UNIMOD:35	0.04	24.0	1	1	1
PRT	sp|O14656|TOR1A_HUMAN	Torsin-1A OS=Homo sapiens OX=9606 GN=TOR1A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P09326|CD48_HUMAN	CD48 antigen OS=Homo sapiens OX=9606 GN=CD48 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	144-UNIMOD:35,148-UNIMOD:4	0.05	24.0	1	1	1
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|P61011-2|SRP54_HUMAN	Isoform 2 of Signal recognition particle 54 kDa protein OS=Homo sapiens OX=9606 GN=SRP54	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q99816-2|TS101_HUMAN	Isoform 2 of Tumor susceptibility gene 101 protein OS=Homo sapiens OX=9606 GN=TSG101	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|Q8IY22-3|CMIP_HUMAN	Isoform 3 of C-Maf-inducing protein OS=Homo sapiens OX=9606 GN=CMIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q6PGP7|TTC37_HUMAN	Tetratricopeptide repeat protein 37 OS=Homo sapiens OX=9606 GN=TTC37 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q10713|MPPA_HUMAN	Mitochondrial-processing peptidase subunit alpha OS=Homo sapiens OX=9606 GN=PMPCA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	183-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	467-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q9C0E8-3|LNP_HUMAN	Isoform 3 of Endoplasmic reticulum junction formation protein lunapark OS=Homo sapiens OX=9606 GN=LNPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	59-UNIMOD:21	0.09	24.0	1	1	1
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.14	24.0	1	1	1
PRT	sp|Q13228-3|SBP1_HUMAN	Isoform 3 of Methanethiol oxidase OS=Homo sapiens OX=9606 GN=SELENBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9HBB8-2|CDHR5_HUMAN	Isoform 2 of Cadherin-related family member 5 OS=Homo sapiens OX=9606 GN=CDHR5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	549-UNIMOD:35,560-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|A5YKK6-3|CNOT1_HUMAN	Isoform 3 of CCR4-NOT transcription complex subunit 1 OS=Homo sapiens OX=9606 GN=CNOT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q8N3C0-3|ASCC3_HUMAN	Isoform 2 of Activating signal cointegrator 1 complex subunit 3 OS=Homo sapiens OX=9606 GN=ASCC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.12	24.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	355-UNIMOD:21,361-UNIMOD:35	0.05	24.0	1	1	0
PRT	sp|Q9ULX3|NOB1_HUMAN	RNA-binding protein NOB1 OS=Homo sapiens OX=9606 GN=NOB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	24.0	null	224-UNIMOD:4,216-UNIMOD:28	0.04	24.0	2	1	0
PRT	sp|P36776-3|LONM_HUMAN	Isoform 3 of Lon protease homolog, mitochondrial OS=Homo sapiens OX=9606 GN=LONP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P39748-2|FEN1_HUMAN	Isoform FENMIT of Flap endonuclease 1 OS=Homo sapiens OX=9606 GN=FEN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q5T3I0|GPTC4_HUMAN	G patch domain-containing protein 4 OS=Homo sapiens OX=9606 GN=GPATCH4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q96GM8-2|TOE1_HUMAN	Isoform 2 of Target of EGR1 protein 1 OS=Homo sapiens OX=9606 GN=TOE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	291-UNIMOD:4,294-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	394-UNIMOD:21,397-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	388-UNIMOD:21,390-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q8IY33-3|MILK2_HUMAN	Isoform 3 of MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q9NZ43-2|USE1_HUMAN	Isoform 2 of Vesicle transport protein USE1 OS=Homo sapiens OX=9606 GN=USE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	135-UNIMOD:35	0.12	24.0	1	1	1
PRT	sp|Q15742-2|NAB2_HUMAN	Isoform 2 of NGFI-A-binding protein 2 OS=Homo sapiens OX=9606 GN=NAB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	159-UNIMOD:21,162-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q92630|DYRK2_HUMAN	Dual specificity tyrosine-phosphorylation-regulated kinase 2 OS=Homo sapiens OX=9606 GN=DYRK2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	44-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q6GQQ9-2|OTU7B_HUMAN	Isoform 2 of OTU domain-containing protein 7B OS=Homo sapiens OX=9606 GN=OTUD7B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	467-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|O95721|SNP29_HUMAN	Synaptosomal-associated protein 29 OS=Homo sapiens OX=9606 GN=SNAP29 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|Q13085-3|ACACA_HUMAN	Isoform 3 of Acetyl-CoA carboxylase 1 OS=Homo sapiens OX=9606 GN=ACACA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1219-UNIMOD:4	0.00	24.0	1	1	1
PRT	sp|P31150|GDIA_HUMAN	Rab GDP dissociation inhibitor alpha OS=Homo sapiens OX=9606 GN=GDI1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	202-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q96BP3-2|PPWD1_HUMAN	Isoform 2 of Peptidylprolyl isomerase domain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=PPWD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8NBF6-2|AVL9_HUMAN	Isoform 2 of Late secretory pathway protein AVL9 homolog OS=Homo sapiens OX=9606 GN=AVL9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9Y4C1|KDM3A_HUMAN	Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	2	1	0
PRT	sp|Q6UY01-3|LRC31_HUMAN	Isoform 3 of Leucine-rich repeat-containing protein 31 OS=Homo sapiens OX=9606 GN=LRRC31	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	8-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q5T8I3-2|F102B_HUMAN	Isoform 2 of Protein FAM102B OS=Homo sapiens OX=9606 GN=FAM102B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q96EK6|GNA1_HUMAN	Glucosamine 6-phosphate N-acetyltransferase OS=Homo sapiens OX=9606 GN=GNPNAT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	128-UNIMOD:4	0.07	24.0	1	1	1
PRT	sp|Q8WWQ0|PHIP_HUMAN	PH-interacting protein OS=Homo sapiens OX=9606 GN=PHIP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1281-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q96N77-2|ZN641_HUMAN	Isoform 2 of Zinc finger protein 641 OS=Homo sapiens OX=9606 GN=ZNF641	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	177-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q13586-2|STIM1_HUMAN	Isoform 2 of Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P04899-6|GNAI2_HUMAN	Isoform 6 of Guanine nucleotide-binding protein G(i) subunit alpha-2 OS=Homo sapiens OX=9606 GN=GNAI2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	1
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P02545|LMNA_HUMAN	Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	472-UNIMOD:28	0.02	24.0	1	1	1
PRT	sp|Q12797|ASPH_HUMAN	Aspartyl/asparaginyl beta-hydroxylase OS=Homo sapiens OX=9606 GN=ASPH PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|Q9UPN3|MACF1_HUMAN	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.00	24.0	1	1	0
PRT	sp|O75369|FLNB_HUMAN	Filamin-B OS=Homo sapiens OX=9606 GN=FLNB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	24.0	null	604-UNIMOD:4	0.01	24.0	2	1	0
PRT	sp|Q92667|AKAP1_HUMAN	A-kinase anchor protein 1, mitochondrial OS=Homo sapiens OX=9606 GN=AKAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P20810|ICAL_HUMAN	Calpastatin OS=Homo sapiens OX=9606 GN=CAST PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	560-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q14766|LTBP1_HUMAN	Latent-transforming growth factor beta-binding protein 1 OS=Homo sapiens OX=9606 GN=LTBP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1577-UNIMOD:4	0.01	24.0	1	1	0
PRT	sp|Q13263|TIF1B_HUMAN	Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	439-UNIMOD:21	0.04	24.0	1	1	0
PRT	sp|O94925|GLSK_HUMAN	Glutaminase kidney isoform, mitochondrial OS=Homo sapiens OX=9606 GN=GLS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	281-UNIMOD:35,248-UNIMOD:35	0.08	24.0	3	3	3
PRT	sp|Q8TF46|DI3L1_HUMAN	DIS3-like exonuclease 1 OS=Homo sapiens OX=9606 GN=DIS3L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	482-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|Q9BUJ2|HNRL1_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|Q9Y5S9|RBM8A_HUMAN	RNA-binding protein 8A OS=Homo sapiens OX=9606 GN=RBM8A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.10	24.0	1	1	0
PRT	sp|Q9BRK5|CAB45_HUMAN	45 kDa calcium-binding protein OS=Homo sapiens OX=9606 GN=SDF4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|P09622|DLDH_HUMAN	Dihydrolipoyl dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=DLD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	0
PRT	sp|O14530|TXND9_HUMAN	Thioredoxin domain-containing protein 9 OS=Homo sapiens OX=9606 GN=TXNDC9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	39-UNIMOD:35	0.05	24.0	1	1	0
PRT	sp|Q8IXQ4|GPAM1_HUMAN	GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	102-UNIMOD:28,105-UNIMOD:21	0.06	24.0	3	1	0
PRT	sp|P36955|PEDF_HUMAN	Pigment epithelium-derived factor OS=Homo sapiens OX=9606 GN=SERPINF1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P01042|KNG1_HUMAN	Kininogen-1 OS=Homo sapiens OX=9606 GN=KNG1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	328-UNIMOD:4,332-UNIMOD:21,340-UNIMOD:4	0.03	24.0	2	1	0
PRT	sp|P01009|A1AT_HUMAN	Alpha-1-antitrypsin OS=Homo sapiens OX=9606 GN=SERPINA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	2	1	0
PRT	sp|Q92845|KIFA3_HUMAN	Kinesin-associated protein 3 OS=Homo sapiens OX=9606 GN=KIFAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	692-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P38606|VATA_HUMAN	V-type proton ATPase catalytic subunit A OS=Homo sapiens OX=9606 GN=ATP6V1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	296-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q86YT6|MIB1_HUMAN	E3 ubiquitin-protein ligase MIB1 OS=Homo sapiens OX=9606 GN=MIB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	486-UNIMOD:28	0.01	24.0	1	1	1
PRT	sp|P84077|ARF1_HUMAN	ADP-ribosylation factor 1 OS=Homo sapiens OX=9606 GN=ARF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	134-UNIMOD:35	0.09	24.0	1	1	1
PRT	sp|Q02543|RL18A_HUMAN	60S ribosomal protein L18a OS=Homo sapiens OX=9606 GN=RPL18A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	64-UNIMOD:4	0.09	24.0	1	1	1
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	289-UNIMOD:28,291-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q14517|FAT1_HUMAN	Protocadherin Fat 1 OS=Homo sapiens OX=9606 GN=FAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.00	24.0	1	1	1
PRT	sp|Q96RT6|CTGE2_HUMAN	cTAGE family member 2 OS=Homo sapiens OX=9606 GN=CTAGE1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q7Z3J2|CP062_HUMAN	UPF0505 protein C16orf62 OS=Homo sapiens OX=9606 GN=C16orf62 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	0
PRT	sp|Q99536|VAT1_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens OX=9606 GN=VAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.05	24.0	1	1	0
PRT	sp|Q9P2J2|TUTLA_HUMAN	Protein turtle homolog A OS=Homo sapiens OX=9606 GN=IGSF9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	795-UNIMOD:21,800-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1094-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q96AE4|FUBP1_HUMAN	Far upstream element-binding protein 1 OS=Homo sapiens OX=9606 GN=FUBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|O15438|MRP3_HUMAN	Canalicular multispecific organic anion transporter 2 OS=Homo sapiens OX=9606 GN=ABCC3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	908-UNIMOD:21,912-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9BY89|K1671_HUMAN	Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1602-UNIMOD:21,1612-UNIMOD:35,1621-UNIMOD:4	0.02	24.0	1	1	0
PRT	sp|Q6WKZ4|RFIP1_HUMAN	Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	315-UNIMOD:21,318-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|P07954-2|FUMH_HUMAN	Isoform Cytoplasmic of Fumarate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=FH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y4G6|TLN2_HUMAN	Talin-2 OS=Homo sapiens OX=9606 GN=TLN2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|P68036-2|UB2L3_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 L3 OS=Homo sapiens OX=9606 GN=UBE2L3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q99704-3|DOK1_HUMAN	Isoform 3 of Docking protein 1 OS=Homo sapiens OX=9606 GN=DOK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	130-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|O00429-7|DNM1L_HUMAN	Isoform 7 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2601-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	549-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q14247|SRC8_HUMAN	Src substrate cortactin OS=Homo sapiens OX=9606 GN=CTTN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	401-UNIMOD:21,405-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q96EZ8-3|MCRS1_HUMAN	Isoform 3 of Microspherule protein 1 OS=Homo sapiens OX=9606 GN=MCRS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	95-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q8TF05-2|PP4R1_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 4 regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PPP4R1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	520-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O14981-2|BTAF1_HUMAN	Isoform 2 of TATA-binding protein-associated factor 172 OS=Homo sapiens OX=9606 GN=BTAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	370-UNIMOD:4,380-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q14254|FLOT2_HUMAN	Flotillin-2 OS=Homo sapiens OX=9606 GN=FLOT2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q07955-3|SRSF1_HUMAN	Isoform ASF-3 of Serine/arginine-rich splicing factor 1 OS=Homo sapiens OX=9606 GN=SRSF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q8NE86-3|MCU_HUMAN	Isoform 3 of Calcium uniporter protein, mitochondrial OS=Homo sapiens OX=9606 GN=MCU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	280-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|O15144|ARPC2_HUMAN	Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	4	1	0
PRT	sp|O00204-2|ST2B1_HUMAN	Isoform 2 of Sulfotransferase family cytosolic 2B member 1 OS=Homo sapiens OX=9606 GN=SULT2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O60291-4|MGRN1_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase MGRN1 OS=Homo sapiens OX=9606 GN=MGRN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q8WU20|FRS2_HUMAN	Fibroblast growth factor receptor substrate 2 OS=Homo sapiens OX=9606 GN=FRS2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9H4G0-4|E41L1_HUMAN	Isoform 4 of Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	435-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P01011|AACT_HUMAN	Alpha-1-antichymotrypsin OS=Homo sapiens OX=9606 GN=SERPINA3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	261-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q16363-2|LAMA4_HUMAN	Isoform 2 of Laminin subunit alpha-4 OS=Homo sapiens OX=9606 GN=LAMA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9BZE9-4|ASPC1_HUMAN	Isoform 4 of Tether containing UBX domain for GLUT4 OS=Homo sapiens OX=9606 GN=ASPSCR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q15024|EXOS7_HUMAN	Exosome complex component RRP42 OS=Homo sapiens OX=9606 GN=EXOSC7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	189-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|O75844|FACE1_HUMAN	CAAX prenyl protease 1 homolog OS=Homo sapiens OX=9606 GN=ZMPSTE24 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	300-UNIMOD:35	0.05	23.0	2	2	2
PRT	sp|Q14166|TTL12_HUMAN	Tubulin--tyrosine ligase-like protein 12 OS=Homo sapiens OX=9606 GN=TTLL12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q14203-5|DCTN1_HUMAN	Isoform 5 of Dynactin subunit 1 OS=Homo sapiens OX=9606 GN=DCTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	657-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|P29350|PTN6_HUMAN	Tyrosine-protein phosphatase non-receptor type 6 OS=Homo sapiens OX=9606 GN=PTPN6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q4V328-3|GRAP1_HUMAN	Isoform 3 of GRIP1-associated protein 1 OS=Homo sapiens OX=9606 GN=GRIPAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9UHB9-3|SRP68_HUMAN	Isoform 3 of Signal recognition particle subunit SRP68 OS=Homo sapiens OX=9606 GN=SRP68	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|P57740-2|NU107_HUMAN	Isoform 2 of Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q13242|SRSF9_HUMAN	Serine/arginine-rich splicing factor 9 OS=Homo sapiens OX=9606 GN=SRSF9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	138-UNIMOD:4	0.06	23.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|O75821|EIF3G_HUMAN	Eukaryotic translation initiation factor 3 subunit G OS=Homo sapiens OX=9606 GN=EIF3G PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	139-UNIMOD:4,146-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|P51991-2|ROA3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A3 OS=Homo sapiens OX=9606 GN=HNRNPA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8N8V4|ANS4B_HUMAN	Ankyrin repeat and SAM domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ANKS4B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|P33908-2|MA1A1_HUMAN	Isoform 2 of Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA OS=Homo sapiens OX=9606 GN=MAN1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|O75808|CAN15_HUMAN	Calpain-15 OS=Homo sapiens OX=9606 GN=CAPN15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q14149|MORC3_HUMAN	MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q15291-2|RBBP5_HUMAN	Isoform 2 of Retinoblastoma-binding protein 5 OS=Homo sapiens OX=9606 GN=RBBP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P62699|YPEL5_HUMAN	Protein yippee-like 5 OS=Homo sapiens OX=9606 GN=YPEL5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.12	23.0	1	1	1
PRT	sp|Q99538-3|LGMN_HUMAN	Isoform 3 of Legumain OS=Homo sapiens OX=9606 GN=LGMN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	219-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P08195-2|4F2_HUMAN	Isoform 2 of 4F2 cell-surface antigen heavy chain OS=Homo sapiens OX=9606 GN=SLC3A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O14678|ABCD4_HUMAN	ATP-binding cassette sub-family D member 4 OS=Homo sapiens OX=9606 GN=ABCD4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q71UI9-3|H2AV_HUMAN	Isoform 3 of Histone H2A.V OS=Homo sapiens OX=9606 GN=H2AFV	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.12	23.0	1	1	1
PRT	sp|P08621-2|RU17_HUMAN	Isoform 2 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	307-UNIMOD:35	0.09	23.0	1	1	1
PRT	sp|A0AVT1-2|UBA6_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 6 OS=Homo sapiens OX=9606 GN=UBA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	18-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|P30419|NMT1_HUMAN	Glycylpeptide N-tetradecanoyltransferase 1 OS=Homo sapiens OX=9606 GN=NMT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1020-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	909-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9NZD8-2|SPG21_HUMAN	Isoform 2 of Maspardin OS=Homo sapiens OX=9606 GN=SPG21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|O75717|WDHD1_HUMAN	WD repeat and HMG-box DNA-binding protein 1 OS=Homo sapiens OX=9606 GN=WDHD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	364-UNIMOD:35,365-UNIMOD:35	0.03	23.0	2	2	2
PRT	sp|P48643-2|TCPE_HUMAN	Isoform 2 of T-complex protein 1 subunit epsilon OS=Homo sapiens OX=9606 GN=CCT5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q02218-3|ODO1_HUMAN	Isoform 3 of 2-oxoglutarate dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=OGDH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P10645|CMGA_HUMAN	Chromogranin-A OS=Homo sapiens OX=9606 GN=CHGA PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q5T1M5-2|FKB15_HUMAN	Isoform 2 of FK506-binding protein 15 OS=Homo sapiens OX=9606 GN=FKBP15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q96Q89-4|KI20B_HUMAN	Isoform 4 of Kinesin-like protein KIF20B OS=Homo sapiens OX=9606 GN=KIF20B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	205-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P02549-2|SPTA1_HUMAN	Isoform 2 of Spectrin alpha chain, erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.00	23.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|O95786-2|DDX58_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX58 OS=Homo sapiens OX=9606 GN=DDX58	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	383-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q70EL1-6|UBP54_HUMAN	Isoform 3 of Inactive ubiquitin carboxyl-terminal hydrolase 54 OS=Homo sapiens OX=9606 GN=USP54	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9H6Z4-2|RANB3_HUMAN	Isoform 2 of Ran-binding protein 3 OS=Homo sapiens OX=9606 GN=RANBP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	219-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q8IXW5-2|RPAP2_HUMAN	Isoform 2 of Putative RNA polymerase II subunit B1 CTD phosphatase RPAP2 OS=Homo sapiens OX=9606 GN=RPAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	488-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P16278-3|BGAL_HUMAN	Isoform 3 of Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q13501-2|SQSTM_HUMAN	Isoform 2 of Sequestosome-1 OS=Homo sapiens OX=9606 GN=SQSTM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	198-UNIMOD:21,205-UNIMOD:4,206-UNIMOD:4,227-UNIMOD:35	0.09	23.0	1	1	1
PRT	sp|A0FGR8-5|ESYT2_HUMAN	Isoform 5 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	145-UNIMOD:21,146-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q15637-5|SF01_HUMAN	Isoform 5 of Splicing factor 1 OS=Homo sapiens OX=9606 GN=SF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	205-UNIMOD:21,207-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	213-UNIMOD:21,217-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q14562|DHX8_HUMAN	ATP-dependent RNA helicase DHX8 OS=Homo sapiens OX=9606 GN=DHX8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	133-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|P17844-2|DDX5_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P21980|TGM2_HUMAN	Protein-glutamine gamma-glutamyltransferase 2 OS=Homo sapiens OX=9606 GN=TGM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9BY43|CHM4A_HUMAN	Charged multivesicular body protein 4a OS=Homo sapiens OX=9606 GN=CHMP4A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96PY5|FMNL2_HUMAN	Formin-like protein 2 OS=Homo sapiens OX=9606 GN=FMNL2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	406-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P61225|RAP2B_HUMAN	Ras-related protein Rap-2b OS=Homo sapiens OX=9606 GN=RAP2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	111-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|Q15386|UBE3C_HUMAN	Ubiquitin-protein ligase E3C OS=Homo sapiens OX=9606 GN=UBE3C PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q9BRD0-2|BUD13_HUMAN	Isoform 2 of BUD13 homolog OS=Homo sapiens OX=9606 GN=BUD13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q58FF7|H90B3_HUMAN	Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens OX=9606 GN=HSP90AB3P PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	2033-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	4339-UNIMOD:28	0.00	23.0	1	1	1
PRT	sp|Q06210|GFPT1_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P12814|ACTN1_HUMAN	Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	419-UNIMOD:28	0.02	23.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	260-UNIMOD:4,261-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|O43516|WIPF1_HUMAN	WAS/WASL-interacting protein family member 1 OS=Homo sapiens OX=9606 GN=WIPF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	446-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|Q6H8Q1|ABLM2_HUMAN	Actin-binding LIM protein 2 OS=Homo sapiens OX=9606 GN=ABLIM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P39656|OST48_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 48 kDa subunit OS=Homo sapiens OX=9606 GN=DDOST PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	145-UNIMOD:4	0.03	23.0	1	1	0
PRT	sp|Q05086|UBE3A_HUMAN	Ubiquitin-protein ligase E3A OS=Homo sapiens OX=9606 GN=UBE3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	198-UNIMOD:4,203-UNIMOD:35	0.02	23.0	1	1	0
PRT	sp|Q8IUI8|CRLF3_HUMAN	Cytokine receptor-like factor 3 OS=Homo sapiens OX=9606 GN=CRLF3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	0
PRT	sp|O60739|EIF1B_HUMAN	Eukaryotic translation initiation factor 1b OS=Homo sapiens OX=9606 GN=EIF1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.13	23.0	1	1	0
PRT	sp|Q8TCT9|HM13_HUMAN	Minor histocompatibility antigen H13 OS=Homo sapiens OX=9606 GN=HM13 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	151-UNIMOD:27	0.03	23.0	2	1	0
PRT	sp|Q96K49|TM87B_HUMAN	Transmembrane protein 87B OS=Homo sapiens OX=9606 GN=TMEM87B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	494-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|Q9BPX3|CND3_HUMAN	Condensin complex subunit 3 OS=Homo sapiens OX=9606 GN=NCAPG PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	966-UNIMOD:4,973-UNIMOD:21,986-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q9Y4K1|CRBG1_HUMAN	Beta/gamma crystallin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CRYBG1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	359-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|P35442|TSP2_HUMAN	Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	764-UNIMOD:28	0.01	23.0	1	1	1
PRT	sp|Q8N6N3|CA052_HUMAN	UPF0690 protein C1orf52 OS=Homo sapiens OX=9606 GN=C1orf52 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null		0.10	23.0	1	1	1
PRT	sp|Q9UI14|PRAF1_HUMAN	Prenylated Rab acceptor protein 1 OS=Homo sapiens OX=9606 GN=RABAC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.09	23.0	1	1	1
PRT	sp|Q9Y6N7|ROBO1_HUMAN	Roundabout homolog 1 OS=Homo sapiens OX=9606 GN=ROBO1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	1545-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q96RT1|ERBIN_HUMAN	Erbin OS=Homo sapiens OX=9606 GN=ERBIN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	648-UNIMOD:21,658-UNIMOD:4,644-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q5VX71-3|SUSD4_HUMAN	Isoform 3 of Sushi domain-containing protein 4 OS=Homo sapiens OX=9606 GN=SUSD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	280-UNIMOD:4,286-UNIMOD:21,287-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q9H0A0|NAT10_HUMAN	RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.01	23.0	1	1	0
PRT	sp|Q14697|GANAB_HUMAN	Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	187-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P50851|LRBA_HUMAN	Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	979-UNIMOD:21,982-UNIMOD:4	0.01	23.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	NAGDLAPAGGAASASTDEAADAESGTR	1	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	47		ms_run[2]:scan=9845	50.95	2	2432.0688	2432.0688	R	N	42	69
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	2	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	47	6-UNIMOD:21	ms_run[1]:scan=8954	46.729213333333334	3	2797.240584	2796.233859	K	K	68	94
PSM	DQQPSGSEGEDDDAEAALKK	3	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46	5-UNIMOD:21	ms_run[2]:scan=7108	37.632	2	2168.8747	2168.8747	K	E	82	102
PSM	SQSLPHSATVTLGGTSDPSTLSSSALSER	4	sp|Q8WUA7-3|TB22A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46	3-UNIMOD:21	ms_run[2]:scan=16833	86.266	3	2952.3714	2952.3714	R	E	118	147
PSM	WSLEDDDDDEDDPAEAEK	5	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46		ms_run[2]:scan=13537	68.985	2	2092.7869	2092.7869	K	E	198	216
PSM	MAEGGSGDVDDAGDCSGAR	6	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45	1-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=2005	12.585	2	1841.6792	1841.6792	K	Y	38	57
PSM	YGPADVEDTTGSGATDSK	7	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=7796	41.019	2	1769.7592	1769.7592	K	D	79	97
PSM	AAEINGEVDDDDAGGEWR	8	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=11987	61.18	2	1917.7977	1917.7977	R	L	1355	1373
PSM	LYGSAGPPPTGEEDTAEKDEL	9	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=12778	65.211	2	2174.9855	2174.9855	K	-	634	655
PSM	DPDAQPGGELMLGGTDSK	10	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:35	ms_run[2]:scan=10804	55.441	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	11	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:35	ms_run[2]:scan=12082	61.649	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	12	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	11-UNIMOD:35	ms_run[2]:scan=13893	70.797	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	13	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=12953	66.045	2	1786.8043	1786.8043	R	Y	236	254
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	14	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	4-UNIMOD:21	ms_run[2]:scan=8341	43.815	3	3001.2673	3001.2673	R	E	120	150
PSM	GVVPLAGTDGETTTQGLDGLSER	15	sp|P09972|ALDOC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=17267	88.776	2	2272.1183	2272.1183	K	C	112	135
PSM	LQELESCSGLGSTSDDTDVR	16	sp|Q14C86-3|GAPD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43	7-UNIMOD:4	ms_run[2]:scan=11986	61.177	2	2167.9539	2167.9539	R	E	735	755
PSM	QLEVYTSGGDPESVAGEYGR	17	sp|Q9Y262-2|EIF3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=14856	75.716	2	2112.96	2112.9600	R	H	195	215
PSM	WQPDTEEEYEDSSGNVVNK	18	sp|Q12874|SF3A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=11912	60.844	2	2224.9397	2224.9397	R	K	471	490
PSM	YGPADVEDTTGSGATDSK	19	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	43		ms_run[2]:scan=7566	39.93	2	1769.7592	1769.7592	K	D	79	97
PSM	SLVCNGDSDCDEDSADEDR	20	sp|P10643|CO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	43	4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=5684	30.839713333333336	2	2158.774267	2157.769886	K	C	100	119
PSM	AQAELENVSGALNEAESK	21	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=15432	78.692	2	1858.8909	1858.8908	R	T	1302	1320
PSM	DPDAQPGGELMLGGTDSK	22	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	11-UNIMOD:35	ms_run[2]:scan=10592	54.419	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	23	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	11-UNIMOD:35	ms_run[2]:scan=11661	59.622	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	24	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	11-UNIMOD:35	ms_run[2]:scan=11872	60.64	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	25	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	11-UNIMOD:35	ms_run[2]:scan=13283	67.76	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	26	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	11-UNIMOD:35	ms_run[2]:scan=16334	83.469	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	27	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	11-UNIMOD:35	ms_run[2]:scan=17083	87.702	2	1802.7993	1802.7993	R	Y	236	254
PSM	GDQPAASGDSDDDEPPPLPR	28	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=9320	48.416	2	2034.8767	2034.8767	R	L	48	68
PSM	LGIYDADGDGDFDVDDAK	29	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=17056	87.562	2	1899.801	1899.8010	K	V	58	76
PSM	LSVEESEAAGDGVDTK	30	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=8352	43.867	2	1605.737	1605.7370	K	V	427	443
PSM	QGAEGAPSPNYDDDDDER	31	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=5203	28.509	2	1949.7511	1949.7511	R	A	445	463
PSM	TAGPLESSETEEASQLK	32	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=11326	57.979	2	1775.8425	1775.8425	R	E	1334	1351
PSM	VDPSLMEDSDDGPSLPTK	33	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	6-UNIMOD:35	ms_run[2]:scan=11709	59.857	2	1917.8514	1917.8514	K	Q	87	105
PSM	YDAFGEDSSSAMGVENR	34	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	12-UNIMOD:35	ms_run[2]:scan=9802	50.754	2	1849.7425	1849.7425	R	A	372	389
PSM	AQVTELEDELTAAEDAK	35	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=19149	99.972	2	1831.8687	1831.8687	R	L	1563	1580
PSM	DNLTLWTSDMQGDGEEQNK	36	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	10-UNIMOD:35	ms_run[2]:scan=14759	75.217	2	2195.9277	2195.9277	R	E	226	245
PSM	DPDAQPGGELMLGGTDSK	37	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	11-UNIMOD:35	ms_run[2]:scan=15364	78.359	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	38	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	11-UNIMOD:35	ms_run[2]:scan=16152	82.455	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	39	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	11-UNIMOD:35	ms_run[2]:scan=19117	99.769	2	1802.7993	1802.7993	R	Y	236	254
PSM	EEEAIQLDGLNASQIR	40	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=17024	87.377	2	1784.8905	1784.8905	R	E	52	68
PSM	GDQPAASGDSDDDEPPPLPR	41	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=9536	49.477	2	2034.8767	2034.8767	R	L	48	68
PSM	GPPQEEEEEEDEEEEATK	42	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=6924	36.683	2	2102.8288	2102.8288	R	E	202	220
PSM	GPPQEEEEEEDEEEEATK	43	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7121	37.697	2	2102.8288	2102.8288	R	E	202	220
PSM	LLESSLSSSEGEEPVEYK	44	sp|P08648|ITA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=13573	69.157	2	1981.9368	1981.9368	R	S	120	138
PSM	LSDAGQYLCQAGDDSNSNK	45	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	9-UNIMOD:4	ms_run[2]:scan=10502	53.978	2	2041.8647	2041.8647	R	K	212	231
PSM	LSQVNESDADDEDNYGAR	46	sp|Q6V0I7-2|FAT4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=7073	37.47	2	1996.8246	1996.8246	K	L	3111	3129
PSM	LVQDVANNTNEEAGDGTTTATVLAR	47	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=12821	65.419	2	2559.2413	2559.2413	K	S	97	122
PSM	LYGSAGPPPTGEEDTAEKDEL	48	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=12183	62.181	2	2174.9855	2174.9855	K	-	634	655
PSM	LYGSAGPPPTGEEDTAEKDEL	49	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=12991	66.225	2	2174.9855	2174.9855	K	-	634	655
PSM	MQMLEDEDDLAYAETEK	50	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	1-UNIMOD:35,3-UNIMOD:35	ms_run[2]:scan=12903	65.805	2	2061.8395	2061.8395	K	K	4346	4363
PSM	QNLYDLDEDDDGIASVPTK	51	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=16566	84.721	2	2106.9593	2106.9593	K	Q	179	198
PSM	SQETGDLDVGGLQETDK	52	sp|P23142-2|FBLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=11457	58.607	2	1790.817	1790.8170	K	I	147	164
PSM	SRTSVQTEDDQLIAGQSAR	53	sp|P26232-3|CTNA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=9899	51.197	2	2220.9413	2220.9413	R	A	651	670
PSM	TTYDSAEEENKENLYAGK	54	sp|Q9HAW4-2|CLSPN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	5-UNIMOD:21	ms_run[2]:scan=8421	44.192	2	2140.8838	2140.8838	K	N	79	97
PSM	VDNALQSGNSQESVTEQDSK	55	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=5940	32.056	2	2134.9614	2134.9614	K	D	43	63
PSM	VIAINVDDPDAANYNDINDVK	56	sp|Q15181|IPYR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=17252	88.694	2	2287.0968	2287.0968	K	R	156	177
PSM	DPDAQPGGELMLGGTDSK	57	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=13812	70.37700333333333	2	1787.795420	1786.804344	R	Y	236	254
PSM	KGGSYSQAASSDSAQGSDVSLTACK	58	sp|P01892|1A02_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	41	17-UNIMOD:21,20-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=7435	39.22078833333334	3	2623.059297	2621.035373	R	V	340	365
PSM	DPDAQPGGELMLGGTDSK	59	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	11-UNIMOD:35	ms_run[2]:scan=12272	62.659	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	60	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	11-UNIMOD:35	ms_run[2]:scan=13493	68.775	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	61	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	11-UNIMOD:35	ms_run[2]:scan=13695	69.784	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	62	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	11-UNIMOD:35	ms_run[2]:scan=14110	71.811	2	1802.7993	1802.7993	R	Y	236	254
PSM	EAGEGGEAEAPAAEGGK	63	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=1702	11.068	2	1528.6641	1528.6641	K	D	177	194
PSM	ECSIYLIGGSIPEEDAGK	64	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	2-UNIMOD:4	ms_run[2]:scan=18281	94.616	2	1936.9088	1936.9088	K	L	75	93
PSM	FDYSGVGSSDGNSEESTLGK	65	sp|Q9NUJ1-3|ABHDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=11908	60.826	2	2034.8654	2034.8654	R	W	110	130
PSM	GAGDGSDEEVDGKADGAEAKPAE	66	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	6-UNIMOD:21	ms_run[2]:scan=4364	24.437	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GEAEQSEEEADEEDKAEDAR	67	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	6-UNIMOD:21	ms_run[2]:scan=5127	28.13	2	2315.8551	2315.8551	K	E	1011	1031
PSM	KDSEGYSESPDLEFEYADTDK	68	sp|Q5VSL9-4|STRP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:21	ms_run[2]:scan=15849	80.891	2	2503.9792	2503.9792	R	W	57	78
PSM	LASGEDDPFDSDFSCPVK	69	sp|Q99567|NUP88_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	15-UNIMOD:4	ms_run[2]:scan=17247	88.672	2	1984.836	1984.8360	K	L	377	395
PSM	PVTVEPMDQLDDEEGLPEK	70	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	7-UNIMOD:35	ms_run[2]:scan=13489	68.755	2	2155.9831	2155.9831	R	L	132	151
PSM	PVTVEPMDQLDDEEGLPEK	71	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=16817	86.164	2	2139.9882	2139.9882	R	L	132	151
PSM	QTNPSAMEVEEDDPVPEIR	72	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	7-UNIMOD:35	ms_run[2]:scan=14824	75.543	2	2170.9688	2170.9688	R	R	714	733
PSM	SVSKESVASMGADSGDDFASDGSSSR	73	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	3-UNIMOD:21	ms_run[2]:scan=12039	61.436	3	2615.033	2615.0330	R	E	28	54
PSM	TDASSASSFLDSDELER	74	sp|Q14498-3|RBM39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=16374	83.679	2	1828.7963	1828.7963	R	T	308	325
PSM	TELEDTLDSTAAQQELR	75	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=15910	81.199	2	1918.912	1918.9120	K	S	1146	1163
PSM	VAEEDEDDDGGIMMR	76	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	14-UNIMOD:35	ms_run[2]:scan=7484	39.483	2	1696.6556	1696.6556	K	S	751	766
PSM	VAEEDEDDDGGIMMR	77	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	13-UNIMOD:35	ms_run[2]:scan=7773	40.917	2	1696.6556	1696.6556	K	S	751	766
PSM	VWTSGQVEEYDLDADDINSR	78	sp|P29972-4|AQP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=17064	87.598	2	2311.024	2311.0240	K	V	129	149
PSM	YPDLYPQEDEDEEEER	79	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=13132	66.955	2	2054.8229	2054.8229	K	E	101	117
PSM	LEAEGEAMEDAAAPGDDR	80	sp|P56181-2|NDUV3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	40	8-UNIMOD:35	ms_run[1]:scan=6062	32.642828333333334	2	1860.781848	1861.763602	K	G	400	418
PSM	AACSAAAMEEDSEASSSR	81	sp|Q05086-2|UBE3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:4,8-UNIMOD:35	ms_run[2]:scan=2700	16.166	2	1844.7153	1844.7153	K	I	173	191
PSM	AGGAGFGTDGDDQEAINEAISVK	82	sp|Q96EB6-2|SIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=17148	88.102	2	2221.0135	2221.0135	R	Q	526	549
PSM	CECDDGFTGADCGELK	83	sp|P24821-5|TENA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=10351	53.268	2	1832.6651	1832.6652	R	C	392	408
PSM	DLSGGLGGQEEEEEQR	84	sp|Q9C086|IN80B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=8623	45.17	2	1731.7548	1731.7548	R	W	136	152
PSM	DPDAQPGGELMLGGTDSK	85	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	11-UNIMOD:35	ms_run[2]:scan=10381	53.407	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	86	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	11-UNIMOD:35	ms_run[2]:scan=12476	63.707	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	87	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=13135	66.969	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSHSSEEDEASSQTDLSQTISK	88	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:21	ms_run[2]:scan=9645	50.016	2	2459.9813	2459.9813	R	K	153	175
PSM	GAGDGSDEEVDGKADGAEAKPAE	89	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	6-UNIMOD:21	ms_run[2]:scan=4821	26.622	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAMSVDSITDLDDNQSR	90	sp|O43182-5|RHG06_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:35	ms_run[2]:scan=11900	60.785	2	1838.7952	1838.7952	R	L	157	174
PSM	GGNDSDELANGEVGGDR	91	sp|Q5JRA6-2|TGO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6013	32.423	2	1660.6925	1660.6925	K	N	1368	1385
PSM	GTEAPAVVTEEEDDDEETAPPVIAPR	92	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=15646	79.834	2	2736.2614	2736.2614	K	P	161	187
PSM	LEAEGEAMEDAAAPGDDR	93	sp|P56181-2|NDUV3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	8-UNIMOD:35	ms_run[2]:scan=6266	33.562	2	1861.7636	1861.7636	K	G	400	418
PSM	LFEESDDKEDEDADGK	94	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:21	ms_run[2]:scan=6380	34.119	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	95	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:21	ms_run[2]:scan=7015	37.176	2	1920.715	1920.7150	K	E	672	688
PSM	LGIYDADGDGDFDVDDAK	96	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=16704	85.543	2	1899.801	1899.8010	K	V	58	76
PSM	LPAPPPVTTPPLAGGSSTEDSR	97	sp|P39060-2|COIA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	17-UNIMOD:21	ms_run[2]:scan=15293	77.969	2	2226.0569	2226.0569	R	S	274	296
PSM	LPNLSSPSAEGPPGPPSGPAPR	98	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:21	ms_run[2]:scan=13740	70.023	2	2161.0205	2161.0205	R	K	412	434
PSM	MNSDTVDYDDACLIVR	99	sp|Q6KC79-2|NIPBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	1-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=15894	81.113	2	1901.8135	1901.8135	K	Y	1743	1759
PSM	PICGASSGDDDDSDEDK	100	sp|Q96S99|PKHF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	3-UNIMOD:4	ms_run[2]:scan=1753	11.339	2	1781.6534	1781.6534	R	E	237	254
PSM	RPPSPDVIVLSDNEQPSSPR	101	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=13542	69.008	2	2349.0403	2349.0403	R	V	97	117
PSM	SQEGENEEGSEGELVVK	102	sp|Q92835-3|SHIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=7962	41.865	2	1818.8119	1818.8119	K	F	550	567
PSM	VLAVNQENEQLMEDYEK	103	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	12-UNIMOD:35	ms_run[2]:scan=12828	65.448	2	2066.9467	2066.9467	K	L	265	282
PSM	YMADMDELFSQVDEK	104	sp|Q9UNE7|CHIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	2-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=15088	76.912	2	1851.7543	1851.7543	K	R	207	222
PSM	YPDLYPQEDEDEEEER	105	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=12931	65.94	2	2054.8229	2054.8229	K	E	101	117
PSM	YSSQDADEQDWEFQK	106	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=12743	65.045	2	1874.7595	1874.7595	R	R	918	933
PSM	VFDDESDEKEDEEYADEK	107	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39	6-UNIMOD:21	ms_run[1]:scan=9404	48.83307	2	2271.832003	2270.826395	K	G	637	655
PSM	PDAQPGGELMLGGTDSK	108	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	10-UNIMOD:35	ms_run[1]:scan=9710	50.326928333333335	2	1687.7737	1687.7718	D	Y	237	254
PSM	SQGDSNPAAIPHAAEDIQGDDR	109	sp|P68402|PA1B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=12519	63.933580000000006	2	2305.0235	2305.0202	M	W	2	24
PSM	CDYMDEVTYGELEK	110	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:4,4-UNIMOD:35	ms_run[2]:scan=13296	67.824	2	1766.7015	1766.7015	K	E	602	616
PSM	CELLYEGPPDDEAAMGIK	111	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=15775	80.507	2	2022.8914	2022.8914	R	S	369	387
PSM	DPDAQPGGELMLGGTDSK	112	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:35	ms_run[2]:scan=13091	66.745	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	113	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:35	ms_run[2]:scan=14313	72.842	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	114	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:35	ms_run[2]:scan=17439	89.726	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	115	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	11-UNIMOD:35	ms_run[2]:scan=18314	94.799	2	1802.7993	1802.7993	R	Y	236	254
PSM	DSHSSEEDEASSQTDLSQTISK	116	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:21	ms_run[2]:scan=9930	51.34	2	2459.9813	2459.9813	R	K	153	175
PSM	ECSIYLIGGSIPEEDAGK	117	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:4	ms_run[2]:scan=18306	94.759	2	1936.9088	1936.9088	K	L	75	93
PSM	GPPQEEEEEEDEEEEATK	118	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=7329	38.713	2	2102.8288	2102.8288	R	E	202	220
PSM	LAEDEGDSEPEAVGQSR	119	sp|Q9UIG0-2|BAZ1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5842	31.603	2	1787.781	1787.7810	R	G	1457	1474
PSM	LGIYDADGDGDFDVDDAK	120	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=16881	86.566	2	1899.801	1899.8010	K	V	58	76
PSM	LSEGSQPAEEEEDQETPSR	121	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=5364	29.299	2	2116.9033	2116.9033	K	N	239	258
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	122	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	6-UNIMOD:21	ms_run[2]:scan=8861	46.276	2	2796.2339	2796.2339	K	K	68	94
PSM	NGLAEGTEQEEEEEDEQVR	123	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=9229	48.005	2	2189.9196	2189.9196	R	L	130	149
PSM	NLEAVETLGSTSTICSDK	124	sp|P50993|AT1A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	15-UNIMOD:4	ms_run[2]:scan=15361	78.344	2	1923.9095	1923.9095	K	T	358	376
PSM	SAEIDSDDTGGSAAQK	125	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=1843	11.769	2	1550.6696	1550.6696	K	Q	814	830
PSM	SCSGVEFSTSGSSNTDTGK	126	sp|P45880-2|VDAC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	2-UNIMOD:4	ms_run[2]:scan=6364	34.041	2	1906.7851	1906.7851	K	V	35	54
PSM	SEDFGVNEDLADSDAR	127	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=13456	68.619	2	1738.7282	1738.7282	R	A	189	205
PSM	SVSESHTSCPAESASDAAPLQR	128	sp|Q8WUA7-3|TB22A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	5-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=8202	43.113	2	2365.9846	2365.9846	K	S	96	118
PSM	SYEDLTESEDGAASGDSHK	129	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:21	ms_run[2]:scan=7790	40.992	2	2076.7797	2076.7797	R	E	56	75
PSM	TASVLSKDDVAPESGDTTVK	130	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	6-UNIMOD:21	ms_run[2]:scan=10398	53.491	2	2098.9671	2098.9671	K	K	312	332
PSM	TTTTNTQVEGDDEAAFLER	131	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=14086	71.704	2	2096.9498	2096.9498	K	L	75	94
PSM	TVECEEGSEDDESLR	132	sp|Q9UKF6|CPSF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	4-UNIMOD:4	ms_run[2]:scan=5430	29.621	2	1753.6949	1753.6949	R	E	652	667
PSM	TYSMICLAIDDDDKTDK	133	sp|Q8IUC4-2|RHPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	1-UNIMOD:21,4-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=15933	81.307	2	2098.8476	2098.8476	K	T	463	480
PSM	VFDDESDEKEDEEYADEK	134	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38	6-UNIMOD:21	ms_run[1]:scan=10123	52.2181	2	2271.826491	2270.826395	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	135	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38	6-UNIMOD:21	ms_run[1]:scan=9606	49.84415166666667	2	2271.831095	2270.826395	K	G	637	655
PSM	SQETGDLDVGGLQETDK	136	sp|P23142|FBLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=11186	57.324535	2	1790.830578	1790.817017	K	I	147	164
PSM	ASLVSEEEEDEEEDKATPR	137	sp|Q96GN5-5|CDA7L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:21	ms_run[2]:scan=11464	58.64	2	2241.9162	2241.9162	K	R	67	86
PSM	DGSKSEDELDQASTPTDVR	138	sp|P30279|CCND2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:21	ms_run[2]:scan=8478	44.464	2	2128.8798	2128.8798	R	D	267	286
PSM	DPDAQPGGELMLGGTDSK	139	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35	ms_run[2]:scan=11217	57.472	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	140	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35	ms_run[2]:scan=12884	65.722	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	141	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35	ms_run[2]:scan=15565	79.411	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	142	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35	ms_run[2]:scan=15760	80.426	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	143	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:35	ms_run[2]:scan=18811	97.827	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	144	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=12739	65.026	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	145	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=13478	68.71	2	1786.8043	1786.8043	R	Y	236	254
PSM	DQPPFGDSDDSVEADK	146	sp|Q14676-4|MDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9551	49.552	2	1720.7064	1720.7064	K	S	488	504
PSM	DSDKESEDGEDEVSCETVK	147	sp|Q96TC7-2|RMD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	6-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=5846	31.623	2	2236.8203	2236.8203	R	M	59	78
PSM	EESSELEQPFAQDTSSVGPDR	148	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=14586	74.324	2	2307.0139	2307.0139	K	K	231	252
PSM	EFQDAGEQVVSSPADVAEK	149	sp|P31937|3HIDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=12727	64.972	2	2004.9276	2004.9276	K	A	77	96
PSM	ELSDQAGSEFENSDVR	150	sp|O43301|HS12A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=10798	55.415	2	1781.7704	1781.7704	K	W	183	199
PSM	ESEDKPEIEDVGSDEEEEK	151	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	13-UNIMOD:21	ms_run[2]:scan=8589	45.012	2	2271.8792	2271.8792	K	K	251	270
PSM	FNDSEGDDTEETEDYR	152	sp|Q9NYF8-2|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=7398	39.042	2	1920.7133	1920.7133	K	Q	392	408
PSM	FVDEEDGGDGQAGPDEGEVDSCLR	153	sp|O15511|ARPC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	22-UNIMOD:4	ms_run[2]:scan=12683	64.748	3	2552.0245	2552.0245	K	Q	24	48
PSM	GAGDGSDEEVDGKADGAEAKPAE	154	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	6-UNIMOD:21	ms_run[2]:scan=4771	26.345	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GDQPAASGDSDDDEPPPLPR	155	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	10-UNIMOD:21	ms_run[2]:scan=10163	52.4	2	2114.843	2114.8430	R	L	48	68
PSM	GDVGMAGVAIDTVEDTK	156	sp|P22033|MUTA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:35	ms_run[2]:scan=13286	67.775	2	1692.7876	1692.7876	R	I	155	172
PSM	GEVGEIGLDGLDGEDGDK	157	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=15846	80.875	2	1773.7905	1773.7905	K	G	1497	1515
PSM	GPPQEEEEEEDEEEEATK	158	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6721	35.675	2	2102.8288	2102.8288	R	E	202	220
PSM	IDNDGDGFVTTEELK	159	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=13728	69.963	2	1651.7577	1651.7577	R	T	91	106
PSM	IECVSAETTEDCIAK	160	sp|P02787|TRFE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=9925	51.317	2	1724.7597	1724.7597	K	I	385	400
PSM	IIEVEEEQEDPYLNDR	161	sp|P23142-2|FBLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=14737	75.106	2	1989.9167	1989.9167	K	C	164	180
PSM	LAEFSSQAAEEEEK	162	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9043	47.154	2	1566.7049	1566.7049	R	V	1025	1039
PSM	LFEESDDKEDEDADGK	163	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:21	ms_run[2]:scan=6165	33.112	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	164	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	5-UNIMOD:21	ms_run[2]:scan=6605	35.14	2	1920.715	1920.7150	K	E	672	688
PSM	LGIYDADGDGDFDVDDAK	165	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=17249	88.68	2	1899.801	1899.8010	K	V	58	76
PSM	LQDLDTDYGSGYPNDPK	166	sp|O75792|RNH2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=11869	60.624	2	1896.8378	1896.8378	K	T	199	216
PSM	MAEGGSGDVDDAGDCSGAR	167	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	15-UNIMOD:4	ms_run[2]:scan=3542	20.485	2	1825.6843	1825.6843	K	Y	38	57
PSM	MEELVQAEEAQEER	168	sp|Q0VD83-3|APOBR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:35	ms_run[2]:scan=9103	47.441	2	1705.7465	1705.7465	R	G	476	490
PSM	NAGDLAPAGGAASASTDEAADAESGTR	169	sp|Q9NXV6|CARF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9850	50.973	3	2432.0688	2432.0688	R	N	42	69
PSM	NYTDEAIETDDLTIK	170	sp|O14818-2|PSA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=15733	80.293	2	1739.8101	1739.8101	K	L	105	120
PSM	QVTSNSLSGTQEDGLDDPR	171	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=9569	49.642	2	2017.9189	2017.9189	R	L	132	151
PSM	SEDFGVNEDLADSDAR	172	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=12941	65.988	2	1738.7282	1738.7282	R	A	189	205
PSM	SIDGTADDEDEGVPTDQAIR	173	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=10964	56.26	2	2102.924	2102.9240	K	A	628	648
PSM	SIEGTADDEEEGVSPDTAIR	174	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=11954	61.023	2	2089.9288	2089.9288	K	S	638	658
PSM	SQSESSDEVTELDLSHGK	175	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:21	ms_run[2]:scan=11291	57.809	2	2026.8368	2026.8368	R	K	657	675
PSM	SVEDDEEGHLICQSGDVLSAR	176	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=16404	83.819	2	2394.9999	2394.9999	R	Y	140	161
PSM	SVGDGETVEFDVVEGEK	177	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=15801	80.644	2	1794.816	1794.8160	R	G	102	119
PSM	SVLDQDDVDTSMEESLK	178	sp|Q8WXH0-2|SYNE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	12-UNIMOD:35	ms_run[2]:scan=11946	60.99	2	1925.8412	1925.8412	K	H	755	772
PSM	TYSMICLAIDDDDKTDK	179	sp|Q8IUC4-2|RHPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	1-UNIMOD:21,4-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=16143	82.408	2	2098.8476	2098.8476	K	T	463	480
PSM	VAEEDEDDDGGIMMR	180	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4271	23.986	2	1712.6505	1712.6505	K	S	751	766
PSM	VLAVNQENEQLMEDYEK	181	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	12-UNIMOD:35	ms_run[2]:scan=13037	66.454	2	2066.9467	2066.9467	K	L	265	282
PSM	VNDDVGIDWTNENDR	182	sp|Q14432|PDE3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=13943	71.031	2	1760.7602	1760.7602	K	L	924	939
PSM	VNDSDDLIMTENEVGK	183	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=13794	70.283	2	1777.804	1777.8040	R	I	686	702
PSM	QEPESEEEEEEKQEK	184	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=4848	26.768698333333333	2	1938.7277	1938.7250	K	E	579	594
PSM	DPDAQPGGELMLGGTDSK	185	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37	11-UNIMOD:35	ms_run[1]:scan=11280	57.76949666666667	2	1803.787433	1802.799259	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	186	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37	11-UNIMOD:35	ms_run[1]:scan=11456	58.60418333333334	2	1803.787433	1802.799259	R	Y	236	254
PSM	AADEEAFEDNSEEYIR	187	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=13993	71.262	2	1886.7806	1886.7806	R	R	300	316
PSM	AATEALGEKSPDSATVSGYDIMK	188	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=12045	61.462	2	2436.0768	2436.0768	K	S	930	953
PSM	AGEAAELQDAEVESSAK	189	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9692	50.237	2	1703.785	1703.7850	K	S	637	654
PSM	AIEQADLLQEEDESPR	190	sp|P61966|AP1S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=13326	67.976	2	1841.8643	1841.8643	K	S	134	150
PSM	DATNVGDEGGFAPNILENK	191	sp|P06733-2|ENOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=17225	88.542	2	1959.9174	1959.9174	K	E	110	129
PSM	DCDLQEDEACYNCGR	192	sp|P62633-8|CNBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:4,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=8729	45.66	2	1903.6771	1903.6771	K	G	59	74
PSM	DENATLDGGDVLFTGR	193	sp|O94760-2|DDAH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=16665	85.291	2	1678.7798	1678.7798	K	E	18	34
PSM	DPDAQPGGELMLGGTDSK	194	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35	ms_run[2]:scan=11007	56.456	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	195	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35	ms_run[2]:scan=16902	86.688	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPTGMDPDDIWQLSSSLK	196	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:35	ms_run[2]:scan=20904	111.89	2	2019.9095	2019.9095	K	R	147	165
PSM	DSQSASGEERPPEADGK	197	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	4-UNIMOD:21	ms_run[2]:scan=1979	12.453	2	1838.732	1838.7320	R	K	360	377
PSM	DSSSSLTDPQVSYVKSPAAER	198	sp|O94887-3|FARP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	16-UNIMOD:21	ms_run[2]:scan=11632	59.479	2	2303.0319	2303.0319	K	R	424	445
PSM	DTSFLGSDDIGNIDVR	199	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=19116	99.765	2	1722.8061	1722.8061	K	E	397	413
PSM	DVQGTDASLDEELDR	200	sp|Q9UJZ1-2|STML2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=12773	65.189	2	1661.738	1661.7380	R	V	293	308
PSM	EGQGEGETQEAAAATAAAR	201	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=7274	38.455	2	1816.8187	1816.8187	R	R	3681	3700
PSM	EIEELQSQAQALSQEGK	202	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=14238	72.453	2	1886.9222	1886.9222	K	S	1435	1452
PSM	FVAYNEEEEEEDCSLAGQDK	203	sp|P55196-1|AFAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	13-UNIMOD:4	ms_run[2]:scan=12692	64.79	3	2360.9591	2360.9591	K	Y	1713	1733
PSM	GEIDASVPELEGDLR	204	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=17912	92.456	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GPTSSPCEEEGDEGEEDR	205	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:4	ms_run[2]:scan=3324	19.333	2	1978.7334	1978.7334	R	T	91	109
PSM	IAEFTTNLTEEEEK	206	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=13808	70.358	2	1652.7781	1652.7781	R	S	1001	1015
PSM	IDEDNLTCLEDLCK	207	sp|Q92851-7|CASPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=17564	90.464	2	1736.7597	1736.7597	K	T	162	176
PSM	IEFDNDADPTSESK	208	sp|P23229-4|ITA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8666	45.382	2	1566.6686	1566.6686	R	E	97	111
PSM	ITALEDISTEDGDR	209	sp|O43264|ZW10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=12904	65.809	2	1533.7158	1533.7158	K	L	668	682
PSM	LFEESDDKEDEDADGK	210	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:21	ms_run[2]:scan=5482	29.854	2	1920.715	1920.7150	K	E	672	688
PSM	LPDSDDDEDEETAIQR	211	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8470	44.423	2	1846.7705	1846.7705	R	V	176	192
PSM	LPDSDDDEDEETAIQR	212	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8679	45.441	2	1846.7705	1846.7705	R	V	176	192
PSM	LYGSAGPPPTGEEDTAEKDEL	213	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=13212	67.377	2	2174.9855	2174.9855	K	-	634	655
PSM	MLADDAEAGAEDEK	214	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:35	ms_run[2]:scan=5066	27.846	2	1479.6035	1479.6035	K	E	481	495
PSM	NSGQNLEEDMGQSEQK	215	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:35	ms_run[2]:scan=1928	12.184	2	1808.7483	1808.7483	K	A	35	51
PSM	NSYVAGQYDDAASYQR	216	sp|P11413|G6PD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10006	51.682	2	1806.7809	1806.7809	R	L	105	121
PSM	PELVNDDDEEADDTR	217	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=6811	36.122	2	1731.7071	1731.7071	R	Y	299	314
PSM	PVTVEPMDQLDDEEGLPEK	218	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:35	ms_run[2]:scan=13689	69.758	2	2155.9831	2155.9831	R	L	132	151
PSM	QTSGGPVDASSEYQQELER	219	sp|P18859|ATP5J_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=12273	62.662	2	2079.9345	2079.9345	R	E	55	74
PSM	SAEIDSDDTGGSAAQK	220	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=2042	12.781	2	1550.6696	1550.6696	K	Q	814	830
PSM	SDAEEDGGTVSQEEEDR	221	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3989	22.59	2	1851.7242	1851.7242	K	K	446	463
PSM	SEDLDNSIDKTEAGIK	222	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	7-UNIMOD:21	ms_run[2]:scan=10094	52.062	2	1813.7983	1813.7983	R	E	880	896
PSM	SIVEEEEDDDYVELK	223	sp|P50851-2|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=15135	77.165	2	1810.7996	1810.7996	K	V	1100	1115
PSM	SPMSTNSSVHTGSDVEQDAEK	224	sp|Q9ULU4-4|PKCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:21,3-UNIMOD:35	ms_run[2]:scan=4932	27.206	2	2300.9104	2300.9104	R	K	56	77
PSM	SSDSDESYGEGCIALR	225	sp|Q92835-3|SHIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:4	ms_run[2]:scan=11564	59.146	2	1744.721	1744.7210	K	L	595	611
PSM	STNCFGDNDPIDVCEIGSK	226	sp|Q9H2U2|IPYR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=16306	83.318	2	2126.8885	2126.8885	K	I	158	177
PSM	TGSTSSKEDDYESDAATIVQK	227	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:21	ms_run[2]:scan=12449	63.567	2	2310.9741	2310.9741	R	C	360	381
PSM	TYADYESVNECMEGVCK	228	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=14183	72.179	2	2053.8067	2053.8067	R	M	18	35
PSM	VAEEDEDDDGGIMMR	229	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	14-UNIMOD:35	ms_run[2]:scan=6796	36.052	2	1696.6556	1696.6556	K	S	751	766
PSM	VDDSPSTSGGSSDGDQR	230	sp|Q96LR5|UB2E2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=877	7.0904	2	1665.6714	1665.6714	R	E	8	25
PSM	VDINTEDLEDGTCR	231	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	13-UNIMOD:4	ms_run[2]:scan=11816	60.37	2	1635.7046	1635.7046	K	V	2082	2096
PSM	VIENADGSEEETDTR	232	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=3316	19.291	2	1663.7173	1663.7173	R	D	1947	1962
PSM	VQGSDSDEEVVVATTR	233	sp|P26640-2|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=8922	46.588	2	1690.801	1690.8010	K	I	227	243
PSM	VVSEDFLQDVSASTK	234	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=17882	92.301	2	1623.7992	1623.7992	R	S	453	468
PSM	YLTESYGTGQDIDDR	235	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10784	55.343	2	1731.7588	1731.7588	R	I	167	182
PSM	YLTESYGTGQDIDDR	236	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=10990	56.373	2	1731.7588	1731.7588	R	I	167	182
PSM	YSEEANNLIEECEQAER	237	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	12-UNIMOD:4	ms_run[2]:scan=14345	73.033	2	2082.88	2082.8800	K	L	120	137
PSM	ESEDKPEIEDVGSDEEEEK	238	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:27,13-UNIMOD:21	ms_run[1]:scan=10150	52.340068333333335	2	2253.8732	2253.8681	K	K	251	270
PSM	VFDDESDEKEDEEYADEK	239	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	36	6-UNIMOD:21	ms_run[1]:scan=8973	46.81360333333333	2	2271.824616	2270.826395	K	G	637	655
PSM	QEPESEEEEEEKQEK	240	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=5053	27.792925	2	1938.7289	1938.7250	K	E	579	594
PSM	VVVAENFDEIVNNENK	241	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=17033	87.43041666666666	2	1833.902163	1831.895208	K	D	380	396
PSM	CECDDGFTGADCGELK	242	sp|P24821|TENA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=14175	72.14116666666666	2	1815.6402	1815.6381	R	C	392	408
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	243	sp|P54725|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	36	4-UNIMOD:21	ms_run[1]:scan=9471	49.16650333333333	3	3000.267689	3001.267344	R	E	120	150
PSM	AEEEEASTEEEDKEGAVVSAPSVK	244	sp|Q14160-2|SCRIB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:21	ms_run[2]:scan=9327	48.444	3	2599.1062	2599.1062	R	G	601	625
PSM	ALYESDENCEVDPSK	245	sp|Q5VWQ8-3|DAB2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:4	ms_run[2]:scan=8181	43.012	2	1754.7305	1754.7305	K	C	251	266
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	246	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13195	67.297	3	2789.2772	2789.2772	R	T	112	140
PSM	DHSSQSEEEVVEGEK	247	sp|O60238-2|BNI3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:21	ms_run[2]:scan=5454	29.721	2	1767.6836	1767.6836	R	E	75	90
PSM	DPDAQPGGELMLGGTDSK	248	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:35	ms_run[2]:scan=16727	85.675	2	1802.7993	1802.7993	R	Y	236	254
PSM	DTDDVPMILVGNK	249	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=17496	90.07	2	1415.6966	1415.6966	K	C	86	99
PSM	EITENLMATGDLDQDGR	250	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:35	ms_run[2]:scan=11560	59.127	2	1892.8422	1892.8422	R	I	52	69
PSM	ESEDDLNKESEEEVGPTK	251	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	10-UNIMOD:21	ms_run[2]:scan=5989	32.311	2	2113.8576	2113.8576	K	E	520	538
PSM	ESEDKPEIEDVGSDEEEEK	252	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:21	ms_run[2]:scan=6157	33.075	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	253	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:21	ms_run[2]:scan=7166	37.904	2	2271.8792	2271.8792	K	K	251	270
PSM	EVEGDDVPESIMLEMK	254	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	12-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=13471	68.68	2	1851.8118	1851.8118	K	A	578	594
PSM	EVEGDDVPESIMLEMK	255	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	12-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=13676	69.696	2	1851.8118	1851.8118	K	A	578	594
PSM	GGNDSDELANGEVGGDR	256	sp|Q5JRA6-2|TGO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5799	31.417	2	1660.6925	1660.6925	K	N	1368	1385
PSM	GIVDQSQQAYQEAFEISK	257	sp|P63104|1433Z_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=19288	100.86	2	2039.98	2039.9800	K	K	140	158
PSM	GSDALSETSSVSHIEDLEK	258	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	10-UNIMOD:21	ms_run[2]:scan=14616	74.472	2	2082.8994	2082.8994	R	V	622	641
PSM	IDENSDKEMEVEESPEK	259	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	5-UNIMOD:21	ms_run[2]:scan=7393	39.019	2	2086.829	2086.8290	K	I	495	512
PSM	IDQYQGADAVGLEEK	260	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10913	55.997	2	1634.7788	1634.7788	R	I	88	103
PSM	IEDGNDFGVAIQEK	261	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=13305	67.871	2	1533.7311	1533.7311	K	V	132	146
PSM	INEELESQYQQSMDSK	262	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:35	ms_run[2]:scan=8606	45.088	2	1943.8419	1943.8419	K	L	76	92
PSM	INEELESQYQQSMDSK	263	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=11706	59.841	2	1927.8469	1927.8469	K	L	76	92
PSM	ISDLTTNLAEEEEK	264	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=12394	63.314	2	1590.7625	1590.7625	R	A	1008	1022
PSM	KSCVEEPEPEPEAAEGDGDK	265	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	2-UNIMOD:21,3-UNIMOD:4	ms_run[2]:scan=6003	32.378	2	2251.8828	2251.8828	K	K	99	119
PSM	LAGEELAGEEAPQEK	266	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8603	45.077	2	1569.7522	1569.7522	K	A	575	590
PSM	LASGVEGSDIPDDGK	267	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=7864	41.313	2	1458.6838	1458.6838	K	L	503	518
PSM	LDEEEEDNEGGEWER	268	sp|Q99613-2|EIF3C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=8900	46.473	2	1834.7129	1834.7129	R	V	279	294
PSM	LEEDDGDVAMSDAQDGPR	269	sp|Q9UBU9-2|NXF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	10-UNIMOD:35	ms_run[2]:scan=6261	33.539	2	1934.78	1934.7800	R	V	52	70
PSM	LESIDNHSSTGGQSDQGYGSK	270	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21	ms_run[2]:scan=5438	29.658	2	2245.9125	2245.9125	R	D	951	972
PSM	LFEESDDKEDEDADGK	271	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	5-UNIMOD:21	ms_run[2]:scan=5214	28.565	2	1920.715	1920.7150	K	E	672	688
PSM	LGDEDEEIDGDTNK	272	sp|P09884|DPOLA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5792	31.387	2	1548.6427	1548.6427	K	Y	816	830
PSM	LLDEEEATDNDLR	273	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10860	55.711	2	1531.7002	1531.7002	R	A	457	470
PSM	LLVDVDESTLSPEEQK	274	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=15966	81.469	2	1800.8993	1800.8993	K	E	478	494
PSM	LQQETAELEESVESGK	275	sp|P42566-2|EPS15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=13137	66.975	2	1775.8425	1775.8425	R	A	143	159
PSM	LTPLPEDNSMNVDQDGDPSDR	276	sp|P78527-2|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	10-UNIMOD:35	ms_run[2]:scan=10225	52.689	2	2329.9968	2329.9968	K	M	3197	3218
PSM	LYQPEYQEVSTEEQR	277	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=11162	57.21	2	1897.8694	1897.8694	K	E	754	769
PSM	MDVNVGDIDIEGPEGK	278	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:35	ms_run[2]:scan=15362	78.348	2	1702.772	1702.7720	K	L	1620	1636
PSM	MEDSVGCLETAEEVK	279	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=11569	59.173	2	1711.7281	1711.7281	K	R	1373	1388
PSM	NPDDITQEEYGEFYK	280	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=15468	78.883	2	1846.7897	1846.7897	R	S	292	307
PSM	NPDDITQEEYGEFYK	281	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=15659	79.902	2	1846.7897	1846.7897	R	S	292	307
PSM	SLDGALYDDEDDDDIER	282	sp|Q6P3S1|DEN1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=13432	68.504	2	1954.7916	1954.7916	K	A	514	531
PSM	SLDSDESEDEEDDYQQK	283	sp|Q13442|HAP28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=6057	32.62	2	2030.7712	2030.7712	K	R	57	74
PSM	SLSKSDSDLLTCSPTEDATMGSR	284	sp|Q92625|ANS1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:21,12-UNIMOD:4,20-UNIMOD:35	ms_run[2]:scan=13486	68.744	3	2553.0612	2553.0612	R	S	622	645
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	285	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9112	47.482	3	3138.2319	3138.2319	R	R	103	132
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	286	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	1-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9765	50.592	3	3138.2319	3138.2319	R	R	103	132
PSM	SVSKESVASMGADSGDDFASDGSSSR	287	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8412	44.144	3	2631.028	2631.0280	R	E	28	54
PSM	SVTSNQSDGTQESCESPDVLDR	288	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:4	ms_run[2]:scan=9290	48.272	2	2410.019	2410.0190	R	H	257	279
PSM	TPAVEGLTEAEEEELR	289	sp|O43399-6|TPD54_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=16472	84.187	2	1771.8476	1771.8476	R	A	12	28
PSM	TYADYESVNECMEGVCK	290	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:4,12-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9922	51.303	2	2069.8016	2069.8016	R	M	18	35
PSM	TYGNTDGPETGFSAIDTDER	291	sp|Q9NYV4-2|CDK12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=14099	71.756	2	2144.9134	2144.9134	R	N	1328	1348
PSM	TYVGVVDGENELASPK	292	sp|P09327-2|VILI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=13506	68.831	2	1676.8257	1676.8257	R	L	206	222
PSM	VAEEDEDDDGGIMMR	293	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10140	52.296	2	1680.6607	1680.6607	K	S	751	766
PSM	VQVQDNEGCPVEALVK	294	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:4	ms_run[2]:scan=14351	73.062	2	1783.8774	1783.8774	R	D	709	725
PSM	YDYEEVEAEGANK	295	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=9515	49.38	2	1515.6365	1515.6365	R	M	428	441
PSM	YGDINFDDLNSEQSYNK	296	sp|Q9HBH5|RDH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=16508	84.392	2	2020.865	2020.8650	K	S	197	214
PSM	YPDLYPQEDEDEEEER	297	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=12717	64.924	2	2054.8229	2054.8229	K	E	101	117
PSM	YYSDSDDELTVEQR	298	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=10037	51.816	2	1718.7271	1718.7271	K	R	480	494
PSM	ESEDKPEIEDVGSDEEEEK	299	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	13-UNIMOD:21	ms_run[1]:scan=9064	47.26030166666666	2	2271.896912	2271.879159	K	K	251	270
PSM	LFEESDDKEDEDADGK	300	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	5-UNIMOD:21	ms_run[1]:scan=4976	27.416753333333332	2	1921.720128	1920.714994	K	E	672	688
PSM	DPDAQPGGELMLGGTDSK	301	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=13656	69.60321333333333	2	1787.795420	1786.804344	R	Y	236	254
PSM	SQLDDHPESDDEENFIDANDDEDMEK	302	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	9-UNIMOD:21	ms_run[1]:scan=15203	77.49874333333334	3	3132.142813	3131.134674	R	F	621	647
PSM	SETAPAAPAAPAPAEKTPVK	303	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8224	43.22872	2	2024.9845	2024.9815	M	K	2	22
PSM	SVSKESVASMGADSGDDFASDGSSSR	304	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=8660	45.3472	3	2630.028610	2631.027965	R	E	28	54
PSM	GNEFFCEVDEDYIQDK	305	sp|P67870|CSK2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	6-UNIMOD:4	ms_run[1]:scan=19686	103.570475	2	2006.803927	2006.820388	R	F	18	34
PSM	ECSIYLIGGSIPEEDAGK	306	sp|Q9NQR4|NIT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	2-UNIMOD:4	ms_run[1]:scan=18258	94.47485166666667	2	1936.911004	1936.908809	K	L	75	93
PSM	SPDHCEEPMSCDSDLGTANAEDSDR	307	sp|Q9Y4G2|PKHM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	1-UNIMOD:21,5-UNIMOD:4,9-UNIMOD:35,11-UNIMOD:4	ms_run[1]:scan=7220	38.175261666666664	3	2892.007247	2890.000113	K	S	280	305
PSM	AANDAGYFNDEMAPIEVK	308	sp|P42765|THIM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	12-UNIMOD:35	ms_run[2]:scan=15162	77.305	2	1969.8728	1969.8728	K	T	192	210
PSM	AEDGSVIDYELIDQDAR	309	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=17841	92.082	2	1907.8749	1907.8749	R	D	180	197
PSM	AEGSEAAELAEIYAK	310	sp|Q9NUQ8-2|ABCF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=16625	85.06	2	1550.7464	1550.7464	R	L	274	289
PSM	AFLDEDDMSLEEIK	311	sp|Q86XL3|ANKL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=19516	102.41	2	1653.7444	1653.7444	R	N	639	653
PSM	ALSQAAVEEEEEEEEEEEPAQGK	312	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=12139	61.926	2	2559.0984	2559.0984	R	G	947	970
PSM	AQAVSEDAGGNEGR	313	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1131	8.233	2	1359.6015	1359.6015	R	A	121	135
PSM	AYEDDGDDYSSIMVK	314	sp|Q99707-2|METH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:35	ms_run[2]:scan=10704	54.944	2	1722.6931	1722.6931	K	A	1062	1077
PSM	CVDVDECAPPAEPCGK	315	sp|P23142-2|FBLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:4,7-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=7823	41.122	2	1802.7274	1802.7274	R	G	354	370
PSM	DCDLQEDACYNCGR	316	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7837	41.191	2	1774.6345	1774.6345	K	G	49	63
PSM	DFQDYMEPEEGCQGSPQR	317	sp|O43237-2|DC1L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=9439	49.016	2	2187.8473	2187.8473	K	R	103	121
PSM	DLFNQEDEEEEDDVR	318	sp|Q96M32|KAD7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=13453	68.604	2	1880.7548	1880.7548	K	G	492	507
PSM	DPAEGDGAQPEETPR	319	sp|Q14697-2|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2985	17.683	2	1567.675	1567.6750	K	D	214	229
PSM	DPDAQPGGELMLGGTDSK	320	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=12676	64.714	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	321	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=14764	75.24	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	322	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=17971	92.778	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	323	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:35	ms_run[2]:scan=18142	93.796	2	1802.7993	1802.7993	R	Y	236	254
PSM	DSPSKSSAEAQTPEDTPNK	324	sp|O43493-4|TGON2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:21	ms_run[2]:scan=1997	12.544	2	2067.8634	2067.8634	K	S	65	84
PSM	DTTVISHSPNTSYDTALEAR	325	sp|Q4VCS5-2|AMOT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:21	ms_run[2]:scan=12889	65.742	2	2256.99	2256.9900	R	I	298	318
PSM	DVSGVVMECGLDVK	326	sp|Q8WWV3-3|RT4I1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=13516	68.873	2	1522.7007	1522.7007	R	Y	122	136
PSM	EAAGEGPALYEDPPDQK	327	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9414	48.886	2	1785.8057	1785.8057	K	T	36	53
PSM	EDEEGDDSTMGPDFR	328	sp|P25940|CO5A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:35	ms_run[2]:scan=6254	33.506	2	1714.6264	1714.6264	R	A	342	357
PSM	EEGDYTCFAENQVGK	329	sp|Q9NR99|MXRA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4	ms_run[2]:scan=11936	60.945	2	1745.7203	1745.7203	R	D	2318	2333
PSM	EEGETADTVGCCSLR	330	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7293	38.546	2	1682.6876	1682.6876	K	V	494	509
PSM	EEIQSSISGVTAAYNR	331	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=14250	72.51	2	1723.8377	1723.8377	R	E	723	739
PSM	ELEASEELDTICPK	332	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	12-UNIMOD:4	ms_run[2]:scan=15052	76.739	2	1632.7553	1632.7553	K	A	218	232
PSM	ELYSESDETFDQISK	333	sp|Q9H8L6|MMRN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=14659	74.694	2	1789.7894	1789.7894	K	V	414	429
PSM	EMEENFAVEAANYQDTIGR	334	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:35	ms_run[2]:scan=17216	88.494	2	2201.9535	2201.9535	R	L	346	365
PSM	EQQESLALEELELQK	335	sp|Q13439-3|GOGA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=17947	92.654	2	1785.8996	1785.8996	K	K	530	545
PSM	ESEDKPEIEDVGSDEEEEK	336	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:21	ms_run[2]:scan=7572	39.963	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	337	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:21	ms_run[2]:scan=7786	40.973	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	338	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:21	ms_run[2]:scan=7980	41.976	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	339	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:21	ms_run[2]:scan=8177	42.999	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	340	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:21	ms_run[2]:scan=8381	44.003	2	2271.8792	2271.8792	K	K	251	270
PSM	EYCGVPGDGDEELLR	341	sp|P02760|AMBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:4	ms_run[2]:scan=14559	74.193	2	1707.741	1707.7410	R	F	335	350
PSM	FLEDDPSDPTYTSSLGGK	342	sp|P54753|EPHB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=13966	71.132	2	1927.8687	1927.8687	R	I	782	800
PSM	FLETDSEEEQEEVNEK	343	sp|Q76FK4-2|NOL8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9454	49.091	2	1953.8327	1953.8327	R	K	817	833
PSM	GAGDGSDEEVDGKADGAEAKPAE	344	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:21	ms_run[2]:scan=4355	24.399	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GDDTDTRDDISILATGCK	345	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=15757	80.412	2	2031.8456	2031.8456	K	G	588	606
PSM	GDEDDDESCAVELR	346	sp|O75676-2|KS6A4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:4	ms_run[2]:scan=8142	42.838	2	1608.621	1608.6210	M	I	2	16
PSM	GPVAVTGASTPEGTAPPPPAAPAPPK	347	sp|Q9H0W8-2|SMG9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:21	ms_run[2]:scan=11434	58.507	2	2414.1883	2414.1883	K	G	109	135
PSM	GYAYVEFENPDEAEK	348	sp|Q15287-3|RNPS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=14979	76.365	2	1759.7577	1759.7577	K	A	167	182
PSM	GYNDDYYEESYFTTR	349	sp|P50402|EMD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=16392	83.763	2	1921.7643	1921.7643	K	T	89	104
PSM	IAECSSQLAEEEEK	350	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:4	ms_run[2]:scan=6714	35.644	2	1621.7141	1621.7141	R	A	1008	1022
PSM	IDENSDKEMEVEESPEK	351	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4549	25.302	2	2102.8239	2102.8239	K	I	495	512
PSM	IDENSDKEMEVEESPEK	352	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4761	26.301	2	2102.8239	2102.8239	K	I	495	512
PSM	IDNDGDGFVTTEELK	353	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=13292	67.805	2	1651.7577	1651.7577	R	T	91	106
PSM	IDNDGDGFVTTEELK	354	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=14149	72.006	2	1651.7577	1651.7577	R	T	91	106
PSM	IEADSESQEDIIR	355	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9252	48.106	2	1503.7053	1503.7053	R	N	72	85
PSM	IEADSESQEDIIR	356	sp|P55957|BID_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9283	48.243	2	1503.7053	1503.7053	R	N	72	85
PSM	IEDLSQQAQLAAAEK	357	sp|Q13765|NACA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=12005	61.262	2	1613.8261	1613.8261	K	F	128	143
PSM	IESLEQEKVDEEEEGK	358	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21	ms_run[2]:scan=9070	47.285	2	1969.8405	1969.8405	R	K	247	263
PSM	IEYNDQNDGSCDVK	359	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	11-UNIMOD:4	ms_run[2]:scan=4233	23.815	2	1655.6733	1655.6733	K	Y	594	608
PSM	ILTENLCEGTEDLDK	360	sp|Q709C8-3|VP13C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4	ms_run[2]:scan=14410	73.396	2	1748.8138	1748.8138	R	V	1323	1338
PSM	IMGVEEEDDDDDDDDNLPQLK	361	sp|Q6AI12|ANR40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:35	ms_run[2]:scan=14114	71.834	3	2434.9806	2434.9806	K	K	92	113
PSM	INEELESQYQQSMDSK	362	sp|O00193|SMAP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:35	ms_run[2]:scan=8951	46.714	2	1943.8419	1943.8419	K	L	76	92
PSM	INEVQTDVGVDTK	363	sp|Q12792-4|TWF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7607	40.122	2	1416.7096	1416.7096	K	H	61	74
PSM	INEVQTDVGVDTK	364	sp|Q12792-4|TWF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=7944	41.734	2	1416.7096	1416.7096	K	H	61	74
PSM	IVEEEAQEDLEGLR	365	sp|Q0VD83-3|APOBR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=15180	77.389	2	1628.7893	1628.7893	K	G	58	72
PSM	LDDDDEGVPSSALR	366	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9854	50.992	2	1487.674	1487.6740	R	E	37	51
PSM	LDETDDPDDYGDR	367	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=4969	27.388	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	368	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6226	33.385	2	1524.5852	1524.5852	R	E	401	414
PSM	LEEEQIILEDQNCK	369	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:4	ms_run[2]:scan=13376	68.222	2	1759.8298	1759.8298	K	L	976	990
PSM	LESIDNHSSTGGQSDQGYGSK	370	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21	ms_run[2]:scan=5402	29.487	3	2245.9125	2245.9125	R	D	951	972
PSM	LGAVDESLSEETQK	371	sp|Q96HE7|ERO1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9577	49.683	2	1504.7257	1504.7257	R	A	137	151
PSM	LLKPGEEPSEYTDEEDTK	372	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=9894	51.174	2	2238.8858	2238.8858	R	D	200	218
PSM	LPVGSQCSVDLESASGEK	373	sp|P24821-5|TENA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=11977	61.13	2	1941.8391	1941.8391	K	D	58	76
PSM	LSDAGQYLCQAGDDSNSNK	374	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:4	ms_run[2]:scan=10514	54.033	3	2041.8647	2041.8647	R	K	212	231
PSM	MDVNVGDIDIEGPEGK	375	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:35	ms_run[2]:scan=15552	79.35	2	1702.772	1702.7720	K	L	1620	1636
PSM	MEELVQAEEAQEER	376	sp|Q0VD83-3|APOBR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11403	58.353	2	1689.7516	1689.7516	R	G	476	490
PSM	MGDEDDDESCAVELR	377	sp|O75676-2|KS6A4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:35,10-UNIMOD:4	ms_run[2]:scan=8245	43.335	2	1755.6564	1755.6564	-	I	1	16
PSM	MQQQLDEYQELLDIK	378	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:35	ms_run[2]:scan=20384	108.27	2	1908.9139	1908.9139	R	L	352	367
PSM	NPDDITNEEYGEFYK	379	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=15243	77.699	2	1832.7741	1832.7741	R	S	300	315
PSM	NQDATVYVGGLDEK	380	sp|Q15427|SF3B4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=11228	57.517	2	1507.7155	1507.7155	R	V	10	24
PSM	NSAAEIPVTSNGEVDDSR	381	sp|P53367-3|ARFP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9251	48.102	2	1859.8497	1859.8497	K	E	8	26
PSM	NVLDSEDEIEELSK	382	sp|Q9BWS9-3|CHID1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=17333	89.119	2	1618.7574	1618.7574	R	T	162	176
PSM	QFYDQALQQAVVDDDANNAK	383	sp|P60033|CD81_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=17110	87.875	2	2252.0346	2252.0346	K	A	125	145
PSM	QLSSSSGNTDTQADEDER	384	sp|P30622-2|CLIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=2291	14.085	2	1938.8039	1938.8039	R	A	1254	1272
PSM	SANAEDAQEFSDVER	385	sp|Q9HCY8|S10AE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=9502	49.319	2	1666.7071	1666.7071	R	A	6	21
PSM	SDGLPWCSTTANYDTDDR	386	sp|P14780|MMP9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:4	ms_run[2]:scan=15904	81.163	2	2072.8382	2072.8382	R	F	250	268
PSM	SETAPAETATPAPVEK	387	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5447	29.693	2	1597.7835	1597.7835	M	S	2	18
PSM	SEVERPASIPLSSGYSTASSDSTPR	388	sp|Q9C0F1|CEP44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:21	ms_run[2]:scan=13378	68.23	3	2660.1967	2660.1967	K	A	324	349
PSM	SGDEEFKGEDELCDSGR	389	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=9788	50.695	2	2008.7357	2008.7357	R	Q	339	356
PSM	SLCSLNYEDDDEDDTPVK	390	sp|Q6NSI3|FA53A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:4	ms_run[2]:scan=13141	66.994	2	2113.8634	2113.8634	K	T	301	319
PSM	SNLDEDIIAEENIVSR	391	sp|P01024|CO3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=19571	102.76	2	1815.885	1815.8850	R	S	749	765
PSM	SSVLIAQQTDTSDPEK	392	sp|P46060|RAGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=8462	44.387	2	1717.837	1717.8370	K	V	453	469
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	393	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=11749	60.047	3	3122.237	3122.2370	R	R	103	132
PSM	SVLDQDDVDTSMEESLK	394	sp|Q8WXH0-2|SYNE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=16517	84.446	2	1909.8463	1909.8463	K	H	755	772
PSM	SVTSNQSDGTQESCESPDVLDR	395	sp|Q9UGV2-3|NDRG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	14-UNIMOD:4	ms_run[2]:scan=9296	48.297	3	2410.019	2410.0190	R	H	257	279
PSM	SYEDLTESEDGAASGDSHK	396	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:21	ms_run[2]:scan=6657	35.378	2	2076.7797	2076.7797	R	E	56	75
PSM	TCVADESAENCDK	397	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2300	14.122	2	1497.5712	1497.5712	K	S	76	89
PSM	TFMDMDQDSEDEK	398	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2692	16.133	2	1621.576	1621.5760	K	Q	51	64
PSM	TITQIEEFSDVNEGEK	399	sp|Q15022|SUZ12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=15613	79.641	2	1837.8582	1837.8582	K	E	596	612
PSM	TNDDQTMCLDINECER	400	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:35,8-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=9237	48.039	2	2028.7823	2028.7823	K	D	1882	1898
PSM	TSIPNAASEEGDEDDWASNK	401	sp|P30291-2|WEE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=12105	61.771	3	2134.8927	2134.8927	R	V	223	243
PSM	VAEEDEDDDGGIMMR	402	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4060	22.974	2	1712.6505	1712.6505	K	S	751	766
PSM	VDQDDDQDSSSLK	403	sp|Q8ND24|RN214_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=1567	10.412	2	1450.606	1450.6060	R	L	186	199
PSM	VDVEGPDVNIEGPEGK	404	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=12805	65.343	2	1652.7893	1652.7893	K	L	2930	2946
PSM	VEQLGAEGNVEESQK	405	sp|Q9Y383-3|LC7L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=5961	32.16	2	1615.7689	1615.7689	K	V	137	152
PSM	YLTESYGTGQDIDDR	406	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10277	52.939	2	1731.7588	1731.7588	R	I	167	182
PSM	YLTESYGTGQDIDDR	407	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=10573	54.323	2	1731.7588	1731.7588	R	I	167	182
PSM	NPDDITQEEYGEFYK	408	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=15925	81.27193333333334	2	1846.792329	1846.789740	R	S	292	307
PSM	VFDDESDEKEDEEYADEK	409	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	6-UNIMOD:21	ms_run[1]:scan=10684	54.85447333333333	2	2271.830449	2270.826395	K	G	637	655
PSM	QEPESEEEEEEKQEK	410	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=4650	25.766663333333334	2	1938.7277	1938.7250	K	E	579	594
PSM	DPDAQPGGELMLGGTDSK	411	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	11-UNIMOD:35	ms_run[1]:scan=16553	84.657085	2	1803.804813	1802.799259	R	Y	236	254
PSM	DDDDIDLFGSDDEEESEEAKR	412	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	10-UNIMOD:21	ms_run[1]:scan=16735	85.71219	2	2508.938420	2507.933713	K	L	97	118
PSM	YLTESYGTGQDIDDR	413	sp|Q9UM54|MYO6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=11292	57.81256166666667	2	1732.747128	1731.758774	R	I	167	182
PSM	QGAEGAPSPNYDDDDDER	414	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:28	ms_run[1]:scan=7437	39.22777833333333	2	1932.7255	1932.7240	R	A	445	463
PSM	DSDDVPMVLVGNK	415	sp|P01112|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	7-UNIMOD:35	ms_run[1]:scan=12902	65.80230333333333	2	1404.649569	1403.660246	K	C	105	118
PSM	AEGHSDDESDSEGSDSESTSR	416	sp|Q9P289|STK26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	5-UNIMOD:21	ms_run[1]:scan=644	5.896145	3	2263.770053	2262.766982	K	E	296	317
PSM	CSQEDHCLTSDLEDDR	417	sp|Q9NZU5|LMCD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:385,1-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=13795	70.28641333333333	2	1961.7383	1961.7362	K	K	52	68
PSM	GQVIIISDSDDDDDER	418	sp|Q7Z333|SETX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=11236	57.555355000000006	2	1790.773309	1790.780631	R	I	1011	1027
PSM	LDETDDPDDYGDR	419	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=6900	36.562115000000006	2	1523.582881	1524.585226	R	E	401	414
PSM	AAEDDEDDDVDTK	420	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1499	10.046	2	1436.5427	1436.5427	R	K	90	103
PSM	ACIDSNEDGDLSK	421	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:4	ms_run[2]:scan=4885	26.94	2	1422.5933	1422.5933	R	S	208	221
PSM	ADNFEYSDPVDGSISR	422	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=13854	70.6	2	1770.7697	1770.7697	K	N	471	487
PSM	ADVLTTGAGNPVGDK	423	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=8923	46.592	2	1413.71	1413.7100	K	L	24	39
PSM	AFLDEDDMSLEEIK	424	sp|Q86XL3|ANKL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:35	ms_run[2]:scan=17085	87.714	2	1669.7393	1669.7393	R	N	639	653
PSM	AGVQADEDEDGDEK	425	sp|P26358|DNMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1333	9.2186	2	1476.5852	1476.5852	R	D	268	282
PSM	ALQEGQPEEDETDDR	426	sp|Q96BZ8|LENG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4265	23.961	2	1730.7231	1730.7231	R	R	225	240
PSM	ALVLIAFAQYLQQCPFEDHVK	427	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	14-UNIMOD:4	ms_run[2]:scan=26038	151.5	3	2489.2777	2489.2777	K	L	45	66
PSM	AQLSSPEDQDDQDDIK	428	sp|Q86US8-3|EST1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6868	36.409	2	1802.7806	1802.7806	K	V	88	104
PSM	DNDSDDVESNLLLPAGIALR	429	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=22501	123.5	3	2126.0491	2126.0491	R	W	295	315
PSM	DPDAQPGGELMLGGTDSK	430	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:35	ms_run[2]:scan=18486	95.84	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	431	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:35	ms_run[2]:scan=18652	96.86	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	432	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=13266	67.675	2	1786.8043	1786.8043	R	Y	236	254
PSM	DSALETLQGQLEEK	433	sp|Q14980-4|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=18099	93.552	2	1559.7679	1559.7679	R	A	1161	1175
PSM	DSDDYAQLCNIPVTGR	434	sp|Q14766-3|LTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:4	ms_run[2]:scan=15407	78.567	3	1822.8156	1822.8156	K	R	1190	1206
PSM	DSEPLGIEEAQIGK	435	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=14121	71.867	2	1484.7359	1484.7359	K	R	239	253
PSM	EALNVFGNDYDTEDGTGVR	436	sp|Q14376-2|GALE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=17049	87.519	2	2070.913	2070.9130	R	D	147	166
PSM	EAQAALAEAQEDLESER	437	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=16235	82.907	2	1858.8545	1858.8545	R	V	1132	1149
PSM	EAQAALAEAQEDLESER	438	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=16246	82.973	3	1858.8545	1858.8545	R	V	1132	1149
PSM	EDTESLEIFQNEVAR	439	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=18248	94.418	2	1778.8323	1778.8323	K	Q	271	286
PSM	EEASSPGAGEGPAEEGTR	440	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=2871	17.079	2	1729.7391	1729.7391	K	D	1143	1161
PSM	EEVMGLCIGELNDDTR	441	sp|P46736-5|BRCC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=16414	83.872	2	1865.8135	1865.8135	K	S	32	48
PSM	EISEASENIYSDVR	442	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=12485	63.761	2	1610.7424	1610.7424	K	G	1781	1795
PSM	ELEDVTESAESMNR	443	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11222	57.492	2	1608.6937	1608.6937	R	E	1923	1937
PSM	ELESSEEGGSAEER	444	sp|Q9HAS0|NJMU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1982	12.47	2	1507.6274	1507.6274	K	R	15	29
PSM	ELNEDVSADVEER	445	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10055	51.895	2	1503.6689	1503.6689	R	F	878	891
PSM	ESESEEAEAGAAELR	446	sp|Q8NAF0|ZN579_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9918	51.284	2	1576.6853	1576.6853	R	A	193	208
PSM	FDYDDEPEAVEESK	447	sp|O95104-2|SFR15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11656	59.6	2	1671.6788	1671.6788	R	K	265	279
PSM	GEDLTEEEDGGIIR	448	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=12062	61.535	2	1531.7002	1531.7002	K	R	139	153
PSM	GGQGAEEVGESAGGGEER	449	sp|Q8TE04|PANK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3245	18.945	2	1674.7081	1674.7081	R	R	72	90
PSM	GIDSDDVQDNSQLK	450	sp|Q96QE3-2|ATAD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7085	37.521	2	1532.6954	1532.6954	R	A	611	625
PSM	GLDSGAETEEEKDTWEEK	451	sp|P78559|MAP1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:21	ms_run[2]:scan=11223	57.495	2	2131.8471	2131.8471	R	K	609	627
PSM	GNAEGSSDEEGKLVIDEPAK	452	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:21	ms_run[2]:scan=10561	54.255	2	2123.926	2123.9260	K	E	120	140
PSM	GSYGSDAEEEEYR	453	sp|Q9UDY2-4|ZO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5986	32.296	2	1490.5797	1490.5797	R	Q	985	998
PSM	GTQCEDIDECEVFPGVCK	454	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:4,10-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=15528	79.231	2	2141.8704	2141.8704	K	N	905	923
PSM	GVVDSDDLPLNVSR	455	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=15172	77.354	2	1484.7471	1484.7471	K	E	435	449
PSM	GYDFESETDTETIAK	456	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=13053	66.535	2	1704.7366	1704.7366	K	L	140	155
PSM	IDNDGDGFVTTEELK	457	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=14108	71.8	2	1651.7577	1651.7577	R	T	91	106
PSM	IEDVGSDEEDDSGK	458	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3041	17.947	2	1493.6005	1493.6005	K	D	250	264
PSM	IVSDGEDEDDSFK	459	sp|Q2NKX8|ERC6L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6659	35.389	2	1454.6049	1454.6049	R	D	1026	1039
PSM	KGGSYSQAASSDSAQGSDVSLTACK	460	sp|Q09160|1A80_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:21,20-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=7818	41.104	3	2621.0354	2621.0354	R	V	340	365
PSM	LDQEDALLGSYPVDDGCR	461	sp|Q99426-2|TBCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:4	ms_run[2]:scan=16820	86.179	2	2021.9	2021.9000	K	I	16	34
PSM	LEDEILVMDDQNNK	462	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:35	ms_run[2]:scan=11642	59.53	2	1690.772	1690.7720	K	L	983	997
PSM	LETLDGGQEDGSEADR	463	sp|Q9Y5S1|TRPV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6371	34.077	2	1690.7282	1690.7282	R	G	12	28
PSM	LFEESDDKEDEDADGK	464	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:21	ms_run[2]:scan=5692	30.889	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	465	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:21	ms_run[2]:scan=5701	30.947	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	466	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:21	ms_run[2]:scan=5946	32.084	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	467	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:21	ms_run[2]:scan=6816	36.153	2	1920.715	1920.7150	K	E	672	688
PSM	LLDAEDVDVPSPDEK	468	sp|Q9UPN3-4|MACF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=14267	72.603	2	1640.7781	1640.7781	R	S	270	285
PSM	LQGEHSQNGEEEPETEPVGEESISDAEK	469	sp|Q5EBL4-3|RIPL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=10989	56.369	3	3133.2885	3133.2885	R	V	103	131
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	470	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=8742	45.721	3	2796.2339	2796.2339	K	K	68	94
PSM	MSDSESEELPKPQVSDSESEEPPR	471	sp|Q96ST2|IWS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:35,2-UNIMOD:21	ms_run[2]:scan=11057	56.703	3	2784.1321	2784.1321	R	H	208	232
PSM	NGSEADIDEGLYSR	472	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10538	54.147	2	1524.6692	1524.6692	K	Q	4	18
PSM	NPDDITQEEYGEFYK	473	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=15856	80.921	2	1846.7897	1846.7897	R	S	292	307
PSM	NSLQDQLDEEMEAK	474	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:35	ms_run[2]:scan=10501	53.974	2	1664.7199	1664.7199	R	Q	1346	1360
PSM	PVTVEPMDQLDDEEGLPEK	475	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=16826	86.216	3	2139.9882	2139.9882	R	L	132	151
PSM	SEESLTSLHAVDGDSK	476	sp|A7KAX9-2|RHG32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:21	ms_run[2]:scan=11093	56.891	2	1753.7408	1753.7408	K	L	357	373
PSM	SENGLEFTSSGSANTETTK	477	sp|P21796|VDAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=9200	47.887	2	1958.8705	1958.8705	K	V	35	54
PSM	SETAPAETATPAPVEKSPAK	478	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:21	ms_run[2]:scan=5591	30.374	2	2060.9667	2060.9667	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	479	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:21	ms_run[2]:scan=5794	31.394	2	2060.9667	2060.9667	M	K	2	22
PSM	SGDETPGSEVPGDK	480	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3496	20.239	2	1373.5947	1373.5947	R	A	161	175
PSM	SIDGTADDEDEGVPTDQAIR	481	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10999	56.415	2	2102.924	2102.9240	K	A	628	648
PSM	SLDGALYDDEDDDDIER	482	sp|Q6P3S1|DEN1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=14249	72.507	2	1954.7916	1954.7916	K	A	514	531
PSM	SNASTLESHETEEPAAK	483	sp|Q9UJA5-4|TRM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:21	ms_run[2]:scan=5112	28.065	2	1879.7837	1879.7837	K	K	302	319
PSM	SPSEAADEVCALEEK	484	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:4	ms_run[2]:scan=13374	68.21	2	1633.7141	1633.7141	R	E	151	166
PSM	SQEPIPDDQKVSDDDK	485	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	12-UNIMOD:21	ms_run[2]:scan=5437	29.654	2	1894.7833	1894.7833	K	E	415	431
PSM	SSLVDEHPEDAEFEQK	486	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:21	ms_run[2]:scan=10967	56.274	2	1938.7884	1938.7884	R	I	644	660
PSM	SVSKESVASMGADSGDDFASDGSSSR	487	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8076	42.505	3	2631.028	2631.0280	R	E	28	54
PSM	SVSNGTAKPATSENFDEDLK	488	sp|Q96K49-2|TM87B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:21	ms_run[2]:scan=10670	54.791	2	2188.9525	2188.9525	K	W	493	513
PSM	SVSTPSEAGSQDSGDGAVGSR	489	sp|Q13409-6|DC1I2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=4500	25.091	2	1949.8563	1949.8563	K	R	86	107
PSM	SVTEQGAELSNEER	490	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=6095	32.796	2	1547.7063	1547.7063	K	N	28	42
PSM	SYEDDDDMDLQPNK	491	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	8-UNIMOD:35	ms_run[2]:scan=5819	31.505	2	1699.6519	1699.6519	R	Q	167	181
PSM	TCTTVAFTQVNSEDK	492	sp|P62424|RL7A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:4	ms_run[2]:scan=10201	52.571	2	1699.7723	1699.7723	K	G	198	213
PSM	TEESPASDEAGEK	493	sp|P05114|HMGN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1063	7.9503	2	1348.563	1348.5630	K	E	83	96
PSM	VAEEDEDDDGGIMMR	494	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=3429	19.889	2	1712.6505	1712.6505	K	S	751	766
PSM	VCVETVESGAMTK	495	sp|P48735-2|IDHP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:4,11-UNIMOD:35	ms_run[2]:scan=6790	36.021	2	1425.648	1425.6480	K	D	349	362
PSM	VDATEESDLAQQYGVR	496	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=13872	70.686	2	1779.8275	1779.8275	K	G	82	98
PSM	VEGDMQVPDLDIK	497	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:35	ms_run[2]:scan=13362	68.152	2	1473.7021	1473.7021	K	G	3898	3911
PSM	VGDDVEFEVSSDR	498	sp|O75534-2|CSDE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=11435	58.511	2	1452.6369	1452.6369	K	R	65	78
PSM	VIENADGSEEETDTR	499	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3597	20.744	2	1663.7173	1663.7173	R	D	1947	1962
PSM	VTLLDGTEYSCDLEK	500	sp|O43491-4|E41L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:4	ms_run[2]:scan=16834	86.269	2	1741.808	1741.8080	K	H	222	237
PSM	YDAFGEDSSSAMGVENR	501	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=12824	65.43	2	1833.7476	1833.7476	R	A	372	389
PSM	TCVADESAENCDK	502	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=2061	12.893053333333334	2	1498.558435	1497.571173	K	S	76	89
PSM	SAEIDSDDTGGSAAQK	503	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=2314	14.18912	2	1551.654978	1550.669624	K	Q	814	830
PSM	EGEEPTVYSDEEEPKDESAR	504	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:27,9-UNIMOD:21	ms_run[1]:scan=8980	46.84155333333333	2	2356.9244	2356.9215	K	K	173	193
PSM	ADKEAAFDDAVEER	505	sp|Q09028|RBBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=12446	63.551840000000006	2	1606.7128	1606.7106	M	V	2	16
PSM	QDVDDEYGVSQALAR	506	sp|P51532|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28	ms_run[1]:scan=16036	81.83217666666667	2	1647.7394	1647.7371	K	G	712	727
PSM	QNLYDLDEDDDGIASVPTK	507	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28	ms_run[1]:scan=19411	101.69638666666667	2	2089.9353	2089.9323	K	Q	179	198
PSM	IDNDGDGFVTTEELK	508	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33		ms_run[1]:scan=13808	70.35819666666667	2	1651.7595	1651.7572	R	T	91	106
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	509	sp|P54725|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:27,4-UNIMOD:21	ms_run[1]:scan=8569	44.912290000000006	3	2983.2595	2983.2563	R	E	120	150
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	510	sp|P54725|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:27,4-UNIMOD:21	ms_run[1]:scan=9477	49.19689666666667	3	2983.2596	2983.2563	R	E	120	150
PSM	AADEEAFEDNSEEYIR	511	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=14013	71.352	3	1886.7806	1886.7806	R	R	300	316
PSM	ADDYIEITGAGGK	512	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11516	58.894	2	1308.6198	1308.6198	K	K	323	336
PSM	AEVGAPLSPDHSEEEEEEEEGLEEDEPR	513	sp|P23327|SRCH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:21	ms_run[2]:scan=14948	76.212	3	3216.278	3216.2780	R	F	556	584
PSM	ALSQAAVEEEEEEEEEEEPAQGK	514	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12112	61.805	3	2559.0984	2559.0984	R	G	947	970
PSM	ASEVEEILDGNDEK	515	sp|Q12824-2|SNF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=15827	80.783	2	1546.6999	1546.6999	K	Y	84	98
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	516	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13396	68.32	3	2789.2772	2789.2772	R	T	112	140
PSM	ASPLPPPPPPPGAEPACPGSSAAAPEYK	517	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=13608	69.334	3	2789.2772	2789.2772	R	T	112	140
PSM	AVTELNEPLSNEDR	518	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10432	53.659	2	1585.7584	1585.7584	K	N	29	43
PSM	AVTEQGAELSNEER	519	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5547	30.183	2	1531.7114	1531.7114	K	N	28	42
PSM	CDGFLDCSDESDEK	520	sp|Q92673|SORL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=9573	49.661	2	1675.5978	1675.5978	R	A	1534	1548
PSM	DAEEEGGDQAGQNIR	521	sp|Q92620|PRP16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3137	18.399	2	1587.6761	1587.6761	K	K	91	106
PSM	DAGEGLLAVQITDPEGK	522	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=18410	95.379	2	1711.8628	1711.8628	K	P	1574	1591
PSM	DFVDDDDDDDLER	523	sp|Q9H9C1-2|SPE39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11500	58.83	2	1582.5907	1582.5907	R	V	44	57
PSM	DLDDIEDENEQLK	524	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12721	64.947	2	1574.6948	1574.6948	R	Q	313	326
PSM	DLDDIEDENEQLK	525	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12938	65.972	2	1574.6948	1574.6948	R	Q	313	326
PSM	DNAEAISGHSVEADPK	526	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:21	ms_run[2]:scan=5574	30.298	2	1718.7149	1718.7149	K	E	2744	2760
PSM	DNDSDDVESNLLLPAGIALR	527	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=22482	123.36	2	2126.0491	2126.0491	R	W	295	315
PSM	DNSNIILLGDSQGDLR	528	sp|Q9H0P0-3|5NT3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=17573	90.516	2	1728.8642	1728.8642	K	M	217	233
PSM	DPDAQPGGELMLGGTDSK	529	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:35	ms_run[2]:scan=17256	88.721	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	530	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:35	ms_run[2]:scan=17608	90.745	2	1802.7993	1802.7993	R	Y	236	254
PSM	DSDDVPMVLVGNK	531	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=15332	78.194	2	1387.6653	1387.6653	K	C	105	118
PSM	DSDDVPMVLVGNK	532	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=15523	79.202	2	1387.6653	1387.6653	K	C	105	118
PSM	DSDDYAQLCNIPVTGR	533	sp|Q14766-3|LTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:4	ms_run[2]:scan=15582	79.493	2	1822.8156	1822.8156	K	R	1190	1206
PSM	DSGIIATITSSSENDDR	534	sp|Q9C0D5|TANC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=16464	84.14	2	1779.8123	1779.8123	K	S	223	240
PSM	DTDDVPMILVGNK	535	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:35	ms_run[2]:scan=16254	83.019	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	536	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=17666	91.078	2	1415.6966	1415.6966	K	C	86	99
PSM	DYDEEEQGYDSEKEK	537	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:21	ms_run[2]:scan=4208	23.699	2	1942.6993	1942.6993	R	K	423	438
PSM	EAPALVAAGGAPEDDEEDDGR	538	sp|Q8IWF6|DEN6A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10325	53.155	2	2082.8978	2082.8978	R	G	28	49
PSM	EDAGDNDDTEGAIGVR	539	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6445	34.412	2	1632.6863	1632.6863	R	N	377	393
PSM	EETNEIQVVNEEPQR	540	sp|Q8NBJ4-2|GOLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9504	49.33	2	1812.849	1812.8490	K	D	243	258
PSM	EGQGEGETQEAAAAAR	541	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3394	19.695	2	1573.6968	1573.6968	R	R	3150	3166
PSM	ELDEATESNEAMGR	542	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6650	35.348	2	1550.6519	1550.6519	R	E	1906	1920
PSM	ELENEENQEEQGLEEK	543	sp|Q8IWE2-2|NXP20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8190	43.057	2	1945.8389	1945.8389	K	G	139	155
PSM	EMEENFAVEAANYQDTIGR	544	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:35	ms_run[2]:scan=17218	88.505	3	2201.9535	2201.9535	R	L	346	365
PSM	EQDDLLVLLADQDQK	545	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=21598	116.9	2	1741.8734	1741.8734	K	I	905	920
PSM	ETVSEESNVLCLSK	546	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:4	ms_run[2]:scan=13449	68.581	2	1593.7556	1593.7556	R	S	581	595
PSM	FDYDDEPEAVEESK	547	sp|O95104-2|SFR15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11865	60.605	2	1671.6788	1671.6788	R	K	265	279
PSM	FSSSDSDFDDEEPR	548	sp|O14526-3|FCHO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9272	48.189	2	1631.6223	1631.6223	R	K	292	306
PSM	GAGDGSDEEVDGKADGAEAKPAE	549	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:21	ms_run[2]:scan=3712	21.294	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GEPAAAAAPEAGASPVEK	550	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6306	33.744	2	1621.7948	1621.7948	K	E	88	106
PSM	GGDDYSEDEGDSSVSR	551	sp|Q99871-3|HAUS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3745	21.445	2	1673.6289	1673.6289	R	A	21	37
PSM	GPPQEEEEEEDEEEEATK	552	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6965	36.911	3	2102.8288	2102.8288	R	E	202	220
PSM	GPPQEEEEEEDEEEEATK	553	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7171	37.929	3	2102.8288	2102.8288	R	E	202	220
PSM	GSGDTSNFDDYEEEDIR	554	sp|P22694-10|KAPCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12581	64.214	2	1947.7606	1947.7606	R	V	291	308
PSM	GVGDDQLGEESEER	555	sp|P20645|MPRD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6070	32.68	2	1518.6434	1518.6434	R	D	257	271
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	556	sp|Q9UQ35-2|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21,25-UNIMOD:21	ms_run[2]:scan=14956	76.25	3	3011.3427	3011.3427	R	D	374	402
PSM	IDLDAEEENIQEGPK	557	sp|P13866-2|SC5A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=13574	69.16	2	1698.7948	1698.7948	R	E	444	459
PSM	IDNDGDGFVTTEELK	558	sp|Q15293|RCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=13530	68.947	2	1651.7577	1651.7577	R	T	91	106
PSM	IDVDTEDVGDER	559	sp|Q9Y2W6-3|TDRKH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8406	44.115	2	1361.5947	1361.5947	R	V	86	98
PSM	IEDSEPHIPLIDDTDAEDDAPTK	560	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21	ms_run[2]:scan=18049	93.252	3	2615.1164	2615.1164	R	R	1116	1139
PSM	IEDSEPHIPLIDDTDAEDDAPTK	561	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21	ms_run[2]:scan=18224	94.271	3	2615.1164	2615.1164	R	R	1116	1139
PSM	IEDVTPIPSDSTR	562	sp|P62263|RS14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9559	49.598	2	1428.7096	1428.7096	R	R	129	142
PSM	IESSLQEDEPENDAK	563	sp|Q9NPL8|TIDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6669	35.428	2	1702.7534	1702.7534	K	K	250	265
PSM	IPMTPTSSFVSPPPPTASPHSNR	564	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35,4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=12621	64.434	3	2580.1121	2580.1121	K	T	373	396
PSM	IVQAEGEAEAAK	565	sp|Q99623|PHB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3199	18.721	2	1214.6143	1214.6143	K	M	225	237
PSM	KPSVGVPPPASPSYPR	566	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=10114	52.172	2	1794.8107	1794.8107	R	A	969	985
PSM	KPSVGVPPPASPSYPR	567	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=10353	53.28	2	1794.8107	1794.8107	R	A	969	985
PSM	LANQDEGPEDEEDEVPK	568	sp|Q6P1N0-2|C2D1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8183	43.024	2	1912.8174	1912.8174	K	K	435	452
PSM	LAPDYDALDVANK	569	sp|P62750|RL23A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=13877	70.713	2	1403.6933	1403.6933	R	I	140	153
PSM	LDDDDEGVPSSALR	570	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10081	52.009	2	1487.674	1487.6740	R	E	37	51
PSM	LDYDEDASAMLK	571	sp|Q8NFI4|F10A5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:35	ms_run[2]:scan=9851	50.976	2	1385.6021	1385.6021	K	E	211	223
PSM	LEGALGADTTEDGDEK	572	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6430	34.347	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LESSEGEIIQTVDR	573	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=14022	71.394	2	1574.7788	1574.7788	K	Q	296	310
PSM	LFEDDDSNEKLFDEEEDSSEK	574	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:21	ms_run[2]:scan=16101	82.16	2	2599.0011	2599.0011	K	L	696	717
PSM	LLDPEDVDVPQPDEK	575	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=15095	76.947	2	1707.8203	1707.8203	R	S	203	218
PSM	LLLEYTDSSYEEK	576	sp|Q03013-3|GSTM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=15043	76.698	2	1588.7508	1588.7508	R	K	19	32
PSM	LQAETEELEEEK	577	sp|P15408-3|FOSL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8086	42.554	2	1446.6726	1446.6726	K	S	113	125
PSM	LSQVNESDADDEDNYGAR	578	sp|Q6V0I7-2|FAT4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7099	37.59	3	1996.8246	1996.8246	K	L	3111	3129
PSM	LYGSAGPPPTGEEDTAEKDEL	579	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12579	64.207	2	2174.9855	2174.9855	K	-	634	655
PSM	MDTIDQDDELIR	580	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:35	ms_run[2]:scan=11830	60.435	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	NEEALDTESSER	581	sp|Q92859-3|NEO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=3425	19.866	2	1378.5848	1378.5848	K	L	285	297
PSM	NESSNASEEEACEK	582	sp|Q9H6Z4-3|RANB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:4	ms_run[2]:scan=950	7.4094	2	1582.6053	1582.6053	K	K	170	184
PSM	NSQEDSEDSEDKDVK	583	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=867	7.0473	2	1803.6684	1803.6684	K	T	53	68
PSM	NTDQASMPDNTAAQK	584	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:35	ms_run[2]:scan=683	6.103	2	1606.6893	1606.6893	R	V	359	374
PSM	NVLDSEDEIEELSK	585	sp|Q9BWS9-3|CHID1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=15424	78.651	2	1618.7574	1618.7574	R	T	162	176
PSM	NVTELNEPLSNEER	586	sp|P61981|1433G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=10846	55.644	2	1642.7798	1642.7798	K	N	29	43
PSM	PSESSEEFLEEEPEQR	587	sp|Q9Y6X4|F169A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=12171	62.112	2	1920.8225	1920.8225	R	G	375	391
PSM	QDVDDEYGVSQALAR	588	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=13312	67.909	2	1664.7642	1664.7642	K	G	712	727
PSM	RPPSPDVIVLSDNEQPSSPR	589	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=14513	73.945	2	2349.0403	2349.0403	R	V	97	117
PSM	SEDDESGAGELTR	590	sp|P33993-2|MCM7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4014	22.724	2	1364.5692	1364.5692	K	E	309	322
PSM	SEDGVEGDLGETQSR	591	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7189	38.025	2	1577.6805	1577.6805	K	T	135	150
PSM	SLGECCDVEDSTTCFNAK	592	sp|P02774-2|VTDB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:4,6-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=11870	60.628	2	2091.8184	2091.8184	K	G	249	267
PSM	SNSQENVEASHPSQDGK	593	sp|Q02410-2|APBA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=1087	8.05	2	1892.7538	1892.7538	R	R	555	572
PSM	SQEPIPDDQKVSDDDK	594	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:21	ms_run[2]:scan=2225	13.706	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	595	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:21	ms_run[2]:scan=5000	27.551	2	1894.7833	1894.7833	K	E	415	431
PSM	SSLVDEHPEDAEFEQK	596	sp|Q15154-4|PCM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21	ms_run[2]:scan=11690	59.754	2	1938.7884	1938.7884	R	I	644	660
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	597	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9554	49.57	3	3138.2319	3138.2319	R	R	103	132
PSM	SVPVTVDDDDDDNDPENR	598	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7738	40.738	2	2015.8192	2015.8192	K	I	1185	1203
PSM	TFMDMDQDSEEEK	599	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2760	16.493	2	1635.5916	1635.5916	K	E	41	54
PSM	TGIEQGSDAGYLCESQK	600	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:4	ms_run[2]:scan=9919	51.287	2	1841.8102	1841.8102	K	F	310	327
PSM	TLSSPSLQTDGIAATPVPPPPPPK	601	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21	ms_run[2]:scan=16455	84.098	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TLTDEVNSPDSDR	602	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6276	33.61	2	1447.6427	1447.6427	K	R	276	289
PSM	TQLEELEDELQATEDAK	603	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=20973	112.37	2	1960.9113	1960.9113	K	L	1539	1556
PSM	TVEDEDQDSEEEKDNDSYIK	604	sp|Q9Y5T5-4|UBP16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=7373	38.917	2	2466.9435	2466.9435	K	E	97	117
PSM	VAEEDEDDDGGIMMR	605	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4425	24.695	2	1712.6505	1712.6505	K	S	751	766
PSM	VANFSNMDEDDIELEPER	606	sp|O14646-2|CHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:35	ms_run[2]:scan=14748	75.159	2	2137.911	2137.9110	K	N	1021	1039
PSM	VDSNDSLYGGDSK	607	sp|Q7Z3J2-2|CP062_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=4259	23.931	2	1355.5841	1355.5841	K	F	693	706
PSM	VDVDVPDVNIEGPDAK	608	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=16054	81.924	2	1680.8206	1680.8206	K	L	3186	3202
PSM	VDVECPDVNIEGPEGK	609	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:4	ms_run[2]:scan=13183	67.241	2	1755.7985	1755.7985	K	W	2802	2818
PSM	VEGDMQVPDLDIK	610	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:35	ms_run[2]:scan=13162	67.136	2	1473.7021	1473.7021	K	G	3898	3911
PSM	VEYTLGEESEAPGQR	611	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9871	51.071	2	1663.7689	1663.7689	K	A	1226	1241
PSM	VFCESGASPEEVADK	612	sp|Q8IYQ7|THNS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:4	ms_run[2]:scan=8961	46.758	2	1623.7087	1623.7087	R	V	201	216
PSM	VLCDDVICDETK	613	sp|P02452|CO1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=10975	56.306	2	1465.6429	1465.6429	K	N	68	80
PSM	VNDSDDLIMTENEVGK	614	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:35	ms_run[2]:scan=11650	59.569	2	1793.7989	1793.7989	R	I	686	702
PSM	VVTDTDETELAR	615	sp|P05198|IF2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7000	37.106	2	1347.6518	1347.6518	K	Q	277	289
PSM	YDNTSPEDMPQDFK	616	sp|O94956-3|SO2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:35	ms_run[2]:scan=7925	41.596	2	1701.6828	1701.6828	R	A	122	136
PSM	YDNTSPEDMPQDFK	617	sp|O94956-3|SO2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11925	60.899	2	1685.6879	1685.6879	R	A	122	136
PSM	YDYNSGEELESYK	618	sp|Q9Y3F4|STRAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11716	59.886	2	1595.6627	1595.6627	K	G	250	263
PSM	YNDWSDDDDDSNESK	619	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5467	29.779	2	1803.6344	1803.6344	R	S	57	72
PSM	VFDDESDEKEDEEYADEK	620	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	6-UNIMOD:21	ms_run[1]:scan=9834	50.90029666666667	2	2271.824995	2270.826395	K	G	637	655
PSM	VFDDESDEKEDEEYADEK	621	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	6-UNIMOD:21	ms_run[1]:scan=9186	47.82738333333333	2	2271.832003	2270.826395	K	G	637	655
PSM	SDAAVDTSSEITTKDLK	622	sp|P06454|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=13111	66.84758666666667	2	1821.8832	1821.8838	M	E	2	19
PSM	EVEDKESEGEEEDEDEDLSK	623	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	7-UNIMOD:21	ms_run[1]:scan=5325	29.130881666666664	2	2419.902065	2418.895931	K	Y	147	167
PSM	DPDAQPGGELMLGGTDSK	624	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=12696	64.80911166666667	2	1786.806366	1786.804344	R	Y	236	254
PSM	DDDDIDLFGSDDEEESEEAKR	625	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	10-UNIMOD:21	ms_run[1]:scan=16127	82.31563166666666	3	2508.939595	2507.933713	K	L	97	118
PSM	QDVDDEYGVSQALAR	626	sp|P51532|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=13415	68.41767	2	1664.766923	1664.764193	K	G	712	727
PSM	ELESSEEGGSAEER	627	sp|Q9HAS0|NJMU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=2169	13.422656666666668	2	1507.627992	1507.627425	K	R	15	29
PSM	SNTACDGDKESEVEDVETDSGNSPEDLR	628	sp|Q7Z3K6|MIER3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	5-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=12254	62.562169999999995	3	3135.221348	3134.214322	R	K	146	174
PSM	AGVEEVAASGSHLNGDLDPDDR	629	sp|P50579|MAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=17368	89.31365500000001	3	2265.0172	2265.0140	M	E	2	24
PSM	QSGEAFVELGSEDDVK	630	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=17723	91.40720166666667	2	1691.7527	1691.7521	R	M	53	69
PSM	DPDAQPGGELMLGGTDSK	631	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	11-UNIMOD:35	ms_run[1]:scan=10203	52.577605000000005	2	1801.819493	1802.799259	R	Y	236	254
PSM	AAEDDEDDDVDTK	632	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1291	9.0176	2	1436.5427	1436.5427	R	K	90	103
PSM	AALEDTLAETEAR	633	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12520	63.937	2	1388.6783	1388.6783	K	F	318	331
PSM	AANDAGYFNDEMAPIEVK	634	sp|P42765|THIM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:35	ms_run[2]:scan=15091	76.928	2	1969.8728	1969.8728	K	T	192	210
PSM	AETASQSQRSPISDNSGCDAPGNSNPSLSVPSSAESEK	635	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=10903	55.949	3	3927.6702	3927.6702	R	Q	14	52
PSM	AGGEEEDDDDEAAGGR	636	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1286	8.9948	2	1591.587	1591.5870	R	C	357	373
PSM	AGLESGAEPGDGDSDTTK	637	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4164	23.488	2	1705.7279	1705.7279	K	K	481	499
PSM	ALDSSPEANTEDDK	638	sp|B4DJY2|TM233_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3249	18.965	2	1490.6373	1490.6373	R	T	13	27
PSM	AQAVSEDAGGNEGR	639	sp|P55884|EIF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1164	8.4078	2	1359.6015	1359.6015	R	A	121	135
PSM	ASLGSLEGEAEAEASSPK	640	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=15948	81.378	2	1731.8163	1731.8163	K	G	5748	5766
PSM	AVSPPHLDGPPSPR	641	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11036	56.594	2	1585.6691	1585.6691	K	S	516	530
PSM	CDYMDEVTYGELEK	642	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:4	ms_run[2]:scan=17208	88.455	2	1750.7066	1750.7066	K	E	602	616
PSM	CELLYEGPPDDEAAMGIK	643	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:4,15-UNIMOD:35	ms_run[2]:scan=15656	79.887	2	2022.8914	2022.8914	R	S	369	387
PSM	DADDAVYELNGK	644	sp|Q13247-2|SRSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11141	57.11	2	1308.5834	1308.5834	R	E	47	59
PSM	DASDDLDDLNFFNQK	645	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=21136	113.55	2	1755.7588	1755.7588	K	K	65	80
PSM	DDDDGPVSSQGYMPYLNK	646	sp|Q9H4E7|DEFI6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:35	ms_run[2]:scan=12538	64.022	2	2015.8419	2015.8419	R	Y	57	75
PSM	DGDDVIIIGVFK	647	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=21494	116.13	2	1289.6867	1289.6867	K	G	302	314
PSM	DIDSEKEAAMEAEIK	648	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=13044	66.492	2	1757.7431	1757.7431	K	A	614	629
PSM	DIEISTEEEKDTGDLK	649	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21	ms_run[2]:scan=12474	63.696	2	1900.8191	1900.8191	R	D	333	349
PSM	DINVSVGSQQPDTK	650	sp|P50851-2|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7775	40.925	2	1486.7264	1486.7264	R	D	964	978
PSM	DLDEDELLGNLSETELK	651	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=21345	115.03	2	1931.9211	1931.9211	K	Q	14	31
PSM	DLQEQDADAGSER	652	sp|Q6P158-3|DHX57_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2934	17.418	2	1432.6066	1432.6066	R	G	15	28
PSM	DNPGVVTCLDEAR	653	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:4	ms_run[2]:scan=11760	60.097	2	1444.6616	1444.6616	K	H	187	200
PSM	DPDAQPGGELMLGGTDSK	654	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=14972	76.33	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	655	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=15169	77.339	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	656	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=18952	98.722	2	1802.7993	1802.7993	R	Y	236	254
PSM	DSDDVPMVLVGNK	657	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=12329	62.966	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	658	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=12529	63.982	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	659	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=12734	65.005	2	1403.6602	1403.6602	K	C	105	118
PSM	DSHSSEEDEASSQTDLSQTISK	660	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:21	ms_run[2]:scan=9604	49.833	3	2459.9813	2459.9813	R	K	153	175
PSM	DSHSSEEDEASSQTDLSQTISK	661	sp|Q5JTV8-2|TOIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:21	ms_run[2]:scan=9902	51.213	3	2459.9813	2459.9813	R	K	153	175
PSM	DSLLQDGEFSMDLR	662	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=17435	89.708	2	1640.7352	1640.7352	R	T	76	90
PSM	DSTSQHDDDNISTTSGFSSR	663	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:21	ms_run[2]:scan=8291	43.556	2	2235.8553	2235.8553	K	A	171	191
PSM	DTDDVPMILVGNK	664	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=14724	75.051	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	665	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=14921	76.073	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	666	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=15118	77.088	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	667	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=15314	78.096	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	668	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=18517	96.046	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	669	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=18681	97.058	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	670	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=15639	79.796	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	671	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:35	ms_run[2]:scan=16641	85.147	2	1431.6915	1431.6915	K	C	86	99
PSM	DVDASPSPLSVQDLK	672	sp|Q8IWZ8|SUGP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=15134	77.163	2	1569.7886	1569.7886	R	G	405	420
PSM	EDQSILCTGESGAGK	673	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:4	ms_run[2]:scan=8119	42.715	2	1550.6883	1550.6883	R	T	166	181
PSM	EEPVSSGPEEAVGK	674	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5764	31.269	2	1413.6624	1413.6624	K	S	565	579
PSM	EEVNECGESIDR	675	sp|Q9HB21-2|PKHA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=4559	25.348	2	1435.5885	1435.5885	K	N	158	170
PSM	ELEDATETADAMNR	676	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:35	ms_run[2]:scan=5022	27.665	2	1580.6624	1580.6624	R	E	1899	1913
PSM	ELEDATETADAMNR	677	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9094	47.402	2	1564.6675	1564.6675	R	E	1899	1913
PSM	ELEDVTESAESMNR	678	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:35	ms_run[2]:scan=7622	40.182	2	1624.6886	1624.6886	R	E	1923	1937
PSM	ELESSEEGGSAEER	679	sp|Q9HAS0|NJMU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2324	14.235	2	1507.6274	1507.6274	K	R	15	29
PSM	ENNISEEVEAPEVEPR	680	sp|Q9H4Z3|PCIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12525	63.964	2	1839.8487	1839.8487	K	L	385	401
PSM	ESEDKPEIEDVGSDEEEEK	681	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21	ms_run[2]:scan=5037	27.725	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	682	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21	ms_run[2]:scan=7376	38.933	2	2271.8792	2271.8792	K	K	251	270
PSM	ESQDTSFTTLVER	683	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=14581	74.302	2	1511.7104	1511.7104	R	V	164	177
PSM	ESQSYLVEDLER	684	sp|Q9ULZ3-3|ASC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=15655	79.884	2	1466.6889	1466.6889	R	S	123	135
PSM	ETGGAEGTGDAVLGEK	685	sp|Q92667-2|AKAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6889	36.512	2	1489.6896	1489.6896	R	V	198	214
PSM	ETYVEQEQGENANDR	686	sp|Q9Y2L1|RRP44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4305	24.149	2	1780.75	1780.7500	R	N	130	145
PSM	EVNSQEEEEEELLR	687	sp|Q96RL1-3|UIMC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12963	66.093	2	1731.7799	1731.7799	R	K	20	34
PSM	EVTDMNLNVINEGGIDK	688	sp|Q96TA1-2|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:35	ms_run[2]:scan=14068	71.628	2	1875.8884	1875.8884	K	L	355	372
PSM	GEDLTEEEDGGIIR	689	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11118	57.002	2	1531.7002	1531.7002	K	R	139	153
PSM	GEIDASVPELEGDLR	690	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=17031	87.419	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	691	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:21,16-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=13829	70.464	3	2842.2398	2842.2398	K	Q	609	638
PSM	GNAEGSSDEEGKLVIDEPAK	692	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21	ms_run[2]:scan=10345	53.244	2	2123.926	2123.9260	K	E	120	140
PSM	GVEEEEEDGEMRE	693	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=1789	11.503	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	694	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=3308	19.256	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	695	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5044	27.757	2	1536.5886	1536.5886	R	-	74	87
PSM	IDENSDKEMEVEESPEK	696	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4624	25.645	3	2102.8239	2102.8239	K	I	495	512
PSM	IDVDTEDVGDER	697	sp|Q9Y2W6-3|TDRKH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8612	45.12	2	1361.5947	1361.5947	R	V	86	98
PSM	IEDVGSDEEDDSGKDK	698	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21	ms_run[2]:scan=2355	14.409	2	1816.6888	1816.6888	K	K	250	266
PSM	IESDEEEDFENVGK	699	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11267	57.709	2	1638.6897	1638.6897	R	V	1091	1105
PSM	IEYNDQNDGSCDVK	700	sp|O75369-5|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:4	ms_run[2]:scan=4507	25.125	2	1655.6733	1655.6733	K	Y	594	608
PSM	IIEVEEEQEDPYLNDR	701	sp|P23142-2|FBLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=14751	75.175	3	1989.9167	1989.9167	K	C	164	180
PSM	IPMTPTSSFVSPPPPTASPHSNR	702	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35,4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=12826	65.442	3	2580.1121	2580.1121	K	T	373	396
PSM	IYEFPETDDEEENK	703	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12374	63.208	2	1756.7316	1756.7316	K	L	221	235
PSM	LDETDDPDDYGDR	704	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5411	29.53	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	705	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6004	32.381	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	706	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6691	35.521	2	1524.5852	1524.5852	R	E	401	414
PSM	LDETDDPDDYGDR	707	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6443	34.405	2	1524.5852	1524.5852	R	E	401	414
PSM	LEELDDFEEGSQK	708	sp|Q7Z3J2-2|CP062_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13368	68.183	2	1537.6784	1537.6784	R	E	40	53
PSM	LEGALGADTTEDGDEK	709	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6772	35.933	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LEGALGADTTEDGDEK	710	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6987	37.028	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LFEDDDSNEKLFDEEEDSSEK	711	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:21	ms_run[2]:scan=16073	82.015	3	2599.0011	2599.0011	K	L	696	717
PSM	LFEESDDKEDEDADGK	712	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21	ms_run[2]:scan=5685	30.843	2	1920.715	1920.7150	K	E	672	688
PSM	LQQELDDATMDLEQQR	713	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:35	ms_run[2]:scan=14757	75.205	3	1947.8844	1947.8844	R	Q	1442	1458
PSM	LSEIDVSSEGVK	714	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10244	52.777	2	1261.6402	1261.6402	R	G	177	189
PSM	MATEVAADALGEEWK	715	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35	ms_run[2]:scan=16135	82.361	2	1635.745	1635.7450	R	G	32	47
PSM	MDTIDQDDELIR	716	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35	ms_run[2]:scan=12043	61.456	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MDTIDQDDELIR	717	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35	ms_run[2]:scan=12236	62.467	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MDTIDQDDELIR	718	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35	ms_run[2]:scan=12428	63.475	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MEVDYSATVDQR	719	sp|O00232-2|PSD12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35	ms_run[2]:scan=7203	38.094	2	1428.6191	1428.6191	K	L	16	28
PSM	NDDDNDIMETLCK	720	sp|Q96HF1|SFRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:4	ms_run[2]:scan=15413	78.598	2	1581.6287	1581.6287	K	N	179	192
PSM	NGLAEGTEQEEEEEDEQVR	721	sp|Q147X3-2|NAA30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9232	48.021	3	2189.9196	2189.9196	R	L	130	149
PSM	NQDEESQEAPELLK	722	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=10376	53.384	2	1628.753	1628.7530	K	R	552	566
PSM	NSLQDQLDEEMEAK	723	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=16214	82.795	2	1648.725	1648.7250	R	Q	1346	1360
PSM	QDADEEALYYTGVR	724	sp|Q9NR99|MXRA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=14608	74.433	2	1628.7318	1628.7318	R	A	409	423
PSM	QDENDDDDDWNPCK	725	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:4	ms_run[2]:scan=8401	44.096	2	1764.6169	1764.6169	K	A	188	202
PSM	QLSSSSGNTDTQADEDER	726	sp|P30622-2|CLIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2312	14.182	3	1938.8039	1938.8039	R	A	1254	1272
PSM	QQMAEEMVEAAGEDER	727	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=6284	33.644	2	1853.7408	1853.7408	K	E	817	833
PSM	QSGEAFVELGSEDDVK	728	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13938	71.009	2	1708.7792	1708.7792	R	M	53	69
PSM	QTIDNSQGAYQEAFDISK	729	sp|P27348|1433T_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=15576	79.463	2	2013.928	2013.9280	K	K	140	158
PSM	SAEIDSDDTGGSAAQK	730	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1000	7.6606	2	1550.6696	1550.6696	K	Q	814	830
PSM	SDEEDFVKVEDLPLK	731	sp|Q15154-4|PCM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21	ms_run[2]:scan=19009	99.095	2	1841.8336	1841.8336	K	L	1794	1809
PSM	SEAPETPMEEEAELVLTEK	732	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:35	ms_run[2]:scan=17322	89.068	2	2146.9828	2146.9828	K	S	72	91
PSM	SEDFGVNEDLADSDAR	733	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13228	67.456	2	1738.7282	1738.7282	R	A	189	205
PSM	SEDPDQQYLILNTAR	734	sp|Q96QK1|VPS35_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=15829	80.795	2	1761.8533	1761.8533	R	K	500	515
PSM	SEIDALEMSSNDSR	735	sp|P08183-2|MDR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:35	ms_run[2]:scan=9996	51.642	2	1568.6624	1568.6624	K	S	582	596
PSM	SELEEQLTPVAEETR	736	sp|P02649|APOE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13809	70.362	2	1729.837	1729.8370	K	A	94	109
PSM	SETAPAETATPAPVEKSPAK	737	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:21	ms_run[2]:scan=5171	28.347	2	2060.9667	2060.9667	M	K	2	22
PSM	SGAEVEAGDAAER	738	sp|Q8IY67-3|RAVR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=2570	15.501	2	1260.5582	1260.5582	K	R	17	30
PSM	SGDEEFKGEDELCDSGR	739	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10466	53.821	2	2008.7357	2008.7357	R	Q	339	356
PSM	SNASTLESHETEEPAAK	740	sp|Q9UJA5-4|TRM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21	ms_run[2]:scan=5462	29.752	2	1879.7837	1879.7837	K	K	302	319
PSM	SQEPIPDDQKVSDDDK	741	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=3920	22.257	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	742	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=4378	24.497	2	1894.7833	1894.7833	K	E	415	431
PSM	SSKSAEDLTDGSYDDVLNAEQLQK	743	sp|Q8N2F6-6|ARM10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21	ms_run[2]:scan=17406	89.551	3	2692.1753	2692.1753	R	L	42	66
PSM	SSSLSNTPHASEESSMDEEQSK	744	sp|Q76I76|SSH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=3723	21.344	3	2461.9428	2461.9428	R	A	706	728
PSM	TCVADESAENCDK	745	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1631	10.736	2	1497.5712	1497.5712	K	S	76	89
PSM	TCVADESAENCDK	746	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1837	11.743	2	1497.5712	1497.5712	K	S	76	89
PSM	TCVADESAENCDK	747	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2879	17.131	2	1497.5712	1497.5712	K	S	76	89
PSM	TDDVSEKTSLADQEEVR	748	sp|Q9Y2Q0-3|AT8A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:21	ms_run[2]:scan=7788	40.985	3	2000.8576	2000.8576	K	T	21	38
PSM	TEFDQEIDMGSLNPGK	749	sp|P52789|HXK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:35	ms_run[2]:scan=13725	69.948	2	1795.7934	1795.7934	R	Q	275	291
PSM	TFMDMDQDSEDEK	750	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2499	15.124	2	1621.576	1621.5760	K	Q	51	64
PSM	TGEEDEEEFFCNR	751	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:4	ms_run[2]:scan=13450	68.585	2	1660.6311	1660.6311	K	A	1186	1199
PSM	TIASDSEEEAGKELSDK	752	sp|Q96ST2|IWS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=12684	64.752	2	1887.7987	1887.7987	K	K	435	452
PSM	TIAVDFASEDIYDK	753	sp|Q53GQ0|DHB12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=17753	91.574	2	1585.7512	1585.7512	R	I	104	118
PSM	TLSSPSLQTDGIAATPVPPPPPPK	754	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21	ms_run[2]:scan=16810	86.127	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TTDEELSELEDR	755	sp|Q9BV36-5|MELPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12383	63.253	2	1435.6314	1435.6314	R	V	314	326
PSM	TVQIEASTVEIEER	756	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=13494	68.778	2	1602.8101	1602.8101	R	G	78	92
PSM	TVSASESEDRLVAEQETEPSK	757	sp|Q9ULG6-3|CCPG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21	ms_run[2]:scan=10072	51.967	2	2371.0428	2371.0428	K	E	184	205
PSM	TVTLPENEDELESTNR	758	sp|P30876|RPB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12522	63.949	2	1845.8592	1845.8592	K	R	870	886
PSM	VATLNSEEESDPPTYK	759	sp|Q00341-2|VIGLN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=8668	45.389	2	1778.821	1778.8210	K	D	62	78
PSM	VDIDTPDINIEGSEGK	760	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=15456	78.817	2	1700.8105	1700.8105	K	F	3712	3728
PSM	VDINTEDLEDGTCR	761	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:4	ms_run[2]:scan=10629	54.61	2	1635.7046	1635.7046	K	V	2082	2096
PSM	VDSTTCLFPVEEK	762	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:4	ms_run[2]:scan=15053	76.743	2	1523.7178	1523.7178	R	A	241	254
PSM	VDSTTCLFPVEEK	763	sp|Q06210-2|GFPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=16523	84.481	2	1603.6841	1603.6841	R	A	241	254
PSM	VDVEVPDVSLEGPEGK	764	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=17013	87.311	2	1667.8254	1667.8254	K	L	1290	1306
PSM	VEESSWLIEDGK	765	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=14509	73.921	2	1390.6616	1390.6616	K	V	228	240
PSM	VEMYSGSDDDDDFNK	766	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:35	ms_run[2]:scan=6536	34.826	2	1751.6468	1751.6468	K	L	131	146
PSM	VGAEDADGIDMAYR	767	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:35	ms_run[2]:scan=9227	47.998	2	1497.6406	1497.6406	K	V	283	297
PSM	VIENADGSEEETDTR	768	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3065	18.049	2	1663.7173	1663.7173	R	D	1947	1962
PSM	VLAVNQENEQLMEDYEK	769	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=16146	82.424	2	2050.9517	2050.9517	K	L	265	282
PSM	VLDVSNSFAVPFDEDDK	770	sp|P51665|PSMD7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=19984	105.57	2	1895.8789	1895.8789	K	D	47	64
PSM	VSESEGKLEGQATAVTPNK	771	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=9179	47.791	2	2023.9463	2023.9463	K	N	12	31
PSM	VVEDDEDDFPTTR	772	sp|Q9Y5P4-2|C43BP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9080	47.34	2	1536.658	1536.6580	K	S	199	212
PSM	VWTSGQVEEYDLDADDINSR	773	sp|P29972-4|AQP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=17058	87.569	3	2311.024	2311.0240	K	V	129	149
PSM	YNDWSDDDDDSNESK	774	sp|Q9UH62|ARMX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=5253	28.771	2	1803.6344	1803.6344	R	S	57	72
PSM	YQEDSDPERSDYEEQQLQK	775	sp|Q6P6C2-3|ALKB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:21	ms_run[2]:scan=8148	42.869	3	2465.986	2465.9860	K	E	49	68
PSM	YSDASDDSFSEPR	776	sp|Q9NRF8|PYRG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=7080	37.5	2	1474.5848	1474.5848	R	I	567	580
PSM	TCVADESAENCDK	777	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=2340	14.325154999999999	2	1498.556435	1497.571173	K	S	76	89
PSM	TCVADESAENCDK	778	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=2091	13.060556666666667	2	1498.558435	1497.571173	K	S	76	89
PSM	SQETGDLDVGGLQETDK	779	sp|P23142|FBLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=11236	57.555355000000006	2	1790.830578	1790.817017	K	I	147	164
PSM	CTSHSETPTVDDEEK	780	sp|O95425|SVIL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=7454	39.312756666666665	2	1796.6501	1796.6443	R	V	671	686
PSM	EVEDKESEGEEEDEDEDLSK	781	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:21	ms_run[1]:scan=5741	31.15573333333333	2	2419.901915	2418.895931	K	Y	147	167
PSM	DPDAQPGGELMLGGTDSK	782	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:35	ms_run[1]:scan=19948	105.33151000000001	2	1803.804336	1802.799259	R	Y	236	254
PSM	PDAQPGGELMLGGTDSK	783	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31		ms_run[1]:scan=11949	61.00091333333333	2	1671.7792	1671.7769	D	Y	237	254
PSM	SETAPAETATPAPVEKSPAK	784	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=5908	31.914171666666668	2	2102.9807	2102.9768	M	K	2	22
PSM	SETAPAETATPAPVEKSPAK	785	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=5956	32.132306666666665	2	2102.9807	2102.9768	M	K	2	22
PSM	IEDGNDFGVAIQEK	786	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=13263	67.656935	2	1534.710247	1533.731102	K	V	132	146
PSM	MDTIDQDDELIR	787	sp|Q93008|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:35	ms_run[1]:scan=12659	64.62195666666666	2	1479.642761	1478.655889	R	Y	1956	1968
PSM	IDQYQGADAVGLEEK	788	sp|O43396|TXNL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=10985	56.35118333333334	2	1634.779552	1634.778781	R	I	88	103
PSM	LPAPPIGAAASSGGGGGGGSGGGGGGASAAPAPPGLSGTTSPR	789	sp|P50750-2|CDK9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	40-UNIMOD:21	ms_run[1]:scan=15591	79.530795	3	3477.651385	3477.627404	R	G	16	59
PSM	QPCPSESDIITEEDK	790	sp|O75475|PSIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=13454	68.60766	2	1729.7402	1729.7347	K	S	202	217
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	791	sp|Q9NPQ8|RIC8A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	3-UNIMOD:35,13-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=8937	46.65195833333333	3	2839.033362	2838.025262	R	E	424	448
PSM	QHSSDSVSSINSATSHSSVGSNIESDSK	792	sp|Q8IVL1|NAV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=10843	55.62829666666667	3	2896.2031	2896.1991	R	K	1797	1825
PSM	LDETDDPDDYGDR	793	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6829	36.23021666666667	2	1523.582881	1524.585226	R	E	401	414
PSM	LDEAQEAECQALR	794	sp|Q9H2K8|TAOK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	9-UNIMOD:4	ms_run[1]:scan=10020	51.73847	2	1530.688375	1531.693671	R	L	787	800
PSM	DPDAQPGGELMLGGTDSK	795	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	11-UNIMOD:35	ms_run[1]:scan=9950	51.42648333333333	2	1801.799445	1802.799259	R	Y	236	254
PSM	SDGLPWCSTTANYDTDDR	796	sp|P14780|MMP9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	7-UNIMOD:4	ms_run[1]:scan=15947	81.37419333333334	2	2073.826281	2072.838163	R	F	250	268
PSM	TLPLVDSKDSMILLGSVER	797	sp|P35523|CLCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	1-UNIMOD:21,7-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=16096	82.13301166666668	2	2327.022380	2328.012650	K	S	636	655
PSM	AAEDDEDDDVDTK	798	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1719	11.153	2	1436.5427	1436.5427	R	K	90	103
PSM	AAEDDEDDDVDTKK	799	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=935	7.345	2	1564.6377	1564.6377	R	Q	90	104
PSM	AALLEAGMPECTEDK	800	sp|Q9C0C9|UBE2O_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:35,11-UNIMOD:4	ms_run[2]:scan=9174	47.764	2	1649.7277	1649.7277	R	-	1278	1293
PSM	ADEASELACPTPK	801	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:4	ms_run[2]:scan=6840	36.278	2	1387.6289	1387.6289	K	E	2194	2207
PSM	ADPDGPEAQAEACSGER	802	sp|Q9NX24|NHP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=5733	31.124	2	1758.7115	1758.7115	K	T	6	23
PSM	AFTFDDEDDELSQLK	803	sp|Q9H9C1-2|SPE39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=19251	100.66	2	1771.7788	1771.7788	K	E	19	34
PSM	ALDVSASDDEIAR	804	sp|P13798|ACPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10200	52.567	2	1360.647	1360.6470	K	L	181	194
PSM	ANDDLADAGLEK	805	sp|Q9NQL2-2|RRAGD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8331	43.765	2	1230.5728	1230.5728	R	I	49	61
PSM	CTSHSETPTVDDEEK	806	sp|O95425-2|SVIL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:4,2-UNIMOD:21	ms_run[2]:scan=3077	18.103	2	1813.6714	1813.6714	R	V	277	292
PSM	DADSITLFDVQQK	807	sp|P53621|COPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17614	90.775	2	1478.7253	1478.7253	R	R	468	481
PSM	DASTLQSQKAEGTGDAK	808	sp|O00479|HMGN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21	ms_run[2]:scan=1725	11.189	3	1785.7782	1785.7782	R	-	74	91
PSM	DDGSTLMEIDGDK	809	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=9522	49.41	2	1410.5821	1410.5821	R	G	6	19
PSM	DEQFEQCVQNFNK	810	sp|O00499-9|BIN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4	ms_run[2]:scan=13816	70.396	2	1684.7151	1684.7151	K	Q	41	54
PSM	DFDGLTDSSAGELSSR	811	sp|Q9H1H9-3|KI13A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=14537	74.071	2	1655.7275	1655.7275	K	R	1698	1714
PSM	DFQDYMEPEEGCQGSPQR	812	sp|O43237-2|DC1L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=9423	48.936	3	2187.8473	2187.8473	K	R	103	121
PSM	DIYDKDNYELDEDTD	813	sp|Q9UBW7|ZMYM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12709	64.882	2	1861.7378	1861.7378	K	-	1363	1378
PSM	DLLIAYYDVDYEK	814	sp|P30101|PDIA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=20715	110.56	2	1618.7767	1618.7767	K	N	259	272
PSM	DLQGAMDDLDADMK	815	sp|P46939|UTRO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:35	ms_run[2]:scan=15534	79.26	2	1552.6385	1552.6385	R	E	2695	2709
PSM	DPDAQPGGELMLGGTDSK	816	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=10611	54.528	3	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	817	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=11027	56.555	3	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	818	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=14021	71.39	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPVQEAWAEDVDLR	819	sp|P14618-3|KPYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=18807	97.804	2	1641.7635	1641.7635	K	V	461	475
PSM	DSDDVPMVLVGNK	820	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=13055	66.546	2	1403.6602	1403.6602	K	C	105	118
PSM	DSSESQLASTESDKPTTGR	821	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=5128	28.134	2	2074.8692	2074.8692	R	V	65	84
PSM	DTDDVPMILVGNK	822	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=15832	80.81	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	823	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=16072	82.011	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	824	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=16440	84.027	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	825	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=20006	105.71	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	826	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=20360	108.1	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	827	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=21657	117.33	2	1431.6915	1431.6915	K	C	86	99
PSM	DVDASPSPLSVQDLK	828	sp|Q8IWZ8|SUGP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=15128	77.135	2	1569.7886	1569.7886	R	G	405	420
PSM	DVFSGSDTDPDMAFCK	829	sp|O60568|PLOD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=14658	74.691	2	1806.7077	1806.7077	R	S	480	496
PSM	DVPNPNQDDDDDEGFSFNPLK	830	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=19161	100.05	2	2376.9982	2376.9982	K	I	523	544
PSM	DYDEEEQGYDSEKEK	831	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=3792	21.667	2	1942.6993	1942.6993	R	K	423	438
PSM	DYEPPSPSPAPGAPPPPPQR	832	sp|P55196-1|AFAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=9456	49.099	2	2132.9568	2132.9568	R	N	1674	1694
PSM	DYSTLTSVSSHDSR	833	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:21	ms_run[2]:scan=8407	44.118	2	1633.6621	1633.6621	R	L	1439	1453
PSM	EALPAPSDDATALMTDPK	834	sp|P07203|GPX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:35	ms_run[2]:scan=12393	63.31	2	1857.8666	1857.8666	R	L	131	149
PSM	EDAGDNDDTEGAIGVR	835	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6678	35.465	2	1632.6863	1632.6863	R	N	377	393
PSM	EDEIATMECINNGK	836	sp|P49189-2|AL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6293	33.681	2	1638.6865	1638.6865	R	S	18	32
PSM	EDLNSPNPSPGGCYDTK	837	sp|Q6P4A8|PLBL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=7372	38.914	2	1849.7789	1849.7789	R	V	477	494
PSM	EDYDSVEQDGDEPGPQR	838	sp|Q9Y5S9-2|RBM8A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7364	38.876	2	1934.7766	1934.7766	R	S	51	68
PSM	EEAEAPVEDGSQPPPPEPK	839	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6890	36.516	2	2001.9167	2001.9167	K	G	624	643
PSM	EEEAIQLDGLNASQIR	840	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17006	87.277	3	1784.8905	1784.8905	R	E	52	68
PSM	EENLPDENEEQKQSNQK	841	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:21	ms_run[2]:scan=3481	20.153	2	2137.8801	2137.8801	R	Q	570	587
PSM	EEPLSEEEPCTSTAIASPEKK	842	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=10569	54.303	2	2411.0451	2411.0451	K	K	498	519
PSM	EEPVSSGPEEAVGK	843	sp|O00567|NOP56_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5563	30.255	2	1413.6624	1413.6624	K	S	565	579
PSM	EGEEPTVYSDEEEPKDESAR	844	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=8132	42.786	2	2374.9326	2374.9326	K	K	121	141
PSM	EISDDEAEEEKGEK	845	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=1958	12.34	2	1686.6509	1686.6509	K	E	224	238
PSM	EISDDEAEEEKGEK	846	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=2545	15.376	2	1686.6509	1686.6509	K	E	224	238
PSM	EISDDEAEEEKGEK	847	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=2736	16.383	2	1686.6509	1686.6509	K	E	224	238
PSM	ELAEDGYSGVEVR	848	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10000	51.66	2	1422.6627	1422.6627	R	V	28	41
PSM	ELAEDGYSGVEVR	849	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10550	54.201	2	1422.6627	1422.6627	R	V	28	41
PSM	ELEAAQEQLAELK	850	sp|Q96CN9|GCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=14754	75.186	2	1470.7566	1470.7566	K	E	516	529
PSM	ELGSECGIEFDEEK	851	sp|P39656-2|OST48_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:4	ms_run[2]:scan=13078	66.686	2	1640.6876	1640.6876	R	T	103	117
PSM	EQSHAEISPPAESGQAVEECK	852	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=8619	45.15	2	2361.9784	2361.9784	R	E	141	162
PSM	ESPGHVPSTLDAGPEDTCPSAEEPR	853	sp|Q96RG2-4|PASK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:21,18-UNIMOD:4	ms_run[2]:scan=11868	60.62	3	2714.1167	2714.1167	R	L	842	867
PSM	ESSTESSQSAKPVSGQDTSGNTEGSPAAEK	854	sp|Q96S66-4|CLCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	25-UNIMOD:21	ms_run[2]:scan=2379	14.521	3	3032.2732	3032.2732	K	A	300	330
PSM	ETNISYSQEADDR	855	sp|O00116|ADAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5624	30.523	2	1526.6485	1526.6485	K	V	170	183
PSM	ETTCSKESNEELTESCETK	856	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=4205	23.683	2	2340.8975	2340.8975	R	K	289	308
PSM	GAGDGSDEEVDGKADGAEAKPAE	857	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=1137	8.263	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	858	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=4616	25.61	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GGIDNPAITSDQELDDK	859	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11645	59.546	2	1786.8221	1786.8221	K	K	1209	1226
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	860	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21,21-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=13349	68.079	3	2842.2398	2842.2398	K	Q	609	638
PSM	GGSDDSSKDPIDVNYEK	861	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=9343	48.52	2	1904.7677	1904.7677	R	L	780	797
PSM	IDEDNLTCLEDLCK	862	sp|Q92851-7|CASPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=18117	93.655	2	1736.7597	1736.7597	K	T	162	176
PSM	IDENSDKEMEVEESPEK	863	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21	ms_run[2]:scan=7415	39.135	3	2086.829	2086.8290	K	I	495	512
PSM	IDVTAPDVSIEEPEGK	864	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=14947	76.208	2	1697.836	1697.8360	K	L	785	801
PSM	IEDVGSDEEDDSGKDK	865	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=2976	17.634	2	1816.6888	1816.6888	K	K	250	266
PSM	ITENDIQIALDDAK	866	sp|P04114|APOB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=18315	94.803	2	1557.7886	1557.7886	R	I	2151	2165
PSM	KDSEGYSESPDLEFEYADTDK	867	sp|Q5VSL9-4|STRP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=15838	80.837	3	2503.9792	2503.9792	R	W	57	78
PSM	KEESEESDDDMGFGLFD	868	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:35	ms_run[2]:scan=17794	91.8	2	1964.7469	1964.7469	K	-	99	116
PSM	LCYYIGATDDAATK	869	sp|P55145|MANF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=12730	64.987	2	1560.713	1560.7130	R	I	74	88
PSM	LDEDDSCSLLTK	870	sp|Q9HAW4-2|CLSPN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4	ms_run[2]:scan=10558	54.241	2	1394.6235	1394.6235	K	E	693	705
PSM	LDETDDPDDYGDR	871	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7103	37.609	2	1524.5852	1524.5852	R	E	401	414
PSM	LECSEELGDLVK	872	sp|Q00610-2|CLH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:4	ms_run[2]:scan=15087	76.909	2	1390.665	1390.6650	K	S	457	469
PSM	LPGPPPASPIPTEGPR	873	sp|Q9H6A9-3|PCX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21	ms_run[2]:scan=12413	63.404	2	1661.8178	1661.8178	R	T	789	805
PSM	LPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	874	sp|O60341|KDM1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	16-UNIMOD:21	ms_run[2]:scan=15347	78.271	3	3477.525	3477.5250	K	L	151	183
PSM	LQAALEAEEPDDER	875	sp|Q9BUJ2-2|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9122	47.537	2	1584.7267	1584.7267	R	E	33	47
PSM	LQDFSDQLSDYYEK	876	sp|P04114|APOB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17407	89.555	2	1749.7734	1749.7734	K	F	4499	4513
PSM	LVQDVANNTNEEAGDGTTTATVLAR	877	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12792	65.285	3	2559.2413	2559.2413	K	S	97	122
PSM	LYGSAGPPPTGEEDTAEKDEL	878	sp|P11021|BIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12798	65.312	3	2174.9855	2174.9855	K	-	634	655
PSM	MDTIDQDDELIR	879	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:35	ms_run[2]:scan=10870	55.76	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MEIDESNAGSSKEEAGETSPADESGAPK	880	sp|Q9UKY1|ZHX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=6100	32.818	3	2918.1649	2918.1649	K	S	630	658
PSM	NEDLEEIASTDLK	881	sp|P78318|IGBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=16983	87.14	2	1475.6991	1475.6991	R	Y	65	78
PSM	NEGSESAPEGQAQQR	882	sp|P67809|YBOX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=927	7.3119	2	1586.6921	1586.6921	K	R	171	186
PSM	NEGVVGGEDYEEVDR	883	sp|Q86UK7-2|ZN598_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9781	50.664	2	1665.7118	1665.7118	R	Y	297	312
PSM	NPDDITNEEYGEFYK	884	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=15045	76.706	2	1832.7741	1832.7741	R	S	300	315
PSM	NPDDITNEEYGEFYK	885	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=15440	78.728	2	1832.7741	1832.7741	R	S	300	315
PSM	PAAMISQPPTPPTGQPVR	886	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=10302	53.049	2	1939.9227	1939.9227	R	E	985	1003
PSM	PVTVEPMDQLDDEEGLPEK	887	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:35	ms_run[2]:scan=13492	68.771	3	2155.9831	2155.9831	R	L	132	151
PSM	QDENDDDDDWNPCK	888	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=7636	40.243	2	1764.6169	1764.6169	K	A	188	202
PSM	QDENDDDDDWNPCK	889	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=8197	43.091	2	1764.6169	1764.6169	K	A	188	202
PSM	QGAEGAPSPNYDDDDDER	890	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4990	27.498	2	1949.7511	1949.7511	R	A	445	463
PSM	QLLDSDEEQEEDEGR	891	sp|Q9UNS1-2|TIM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7839	41.198	2	1790.7442	1790.7442	R	N	1168	1183
PSM	QNLYDLDEDDDGIASVPTK	892	sp|Q9BY77|PDIP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=16804	86.097	2	2106.9593	2106.9593	K	Q	179	198
PSM	QQMAEEMVEAAGEDER	893	sp|Q15393|SF3B3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,7-UNIMOD:35	ms_run[2]:scan=6527	34.781	2	1853.7408	1853.7408	K	E	817	833
PSM	QSGEAFVELGSEDDVK	894	sp|P52597|HNRPF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=14544	74.108	2	1708.7792	1708.7792	R	M	53	69
PSM	SCNLDEQQELVER	895	sp|P08575-4|PTPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4	ms_run[2]:scan=9617	49.89	2	1618.7257	1618.7257	R	D	448	461
PSM	SDDEVDDPAVELK	896	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10857	55.696	2	1430.6413	1430.6413	K	Q	741	754
PSM	SDGLPWCSTTANYDTDDR	897	sp|P14780|MMP9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:4	ms_run[2]:scan=15786	80.562	3	2072.8382	2072.8382	R	F	250	268
PSM	SEAEDEDDEDYVPYVPLR	898	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17886	92.32	2	2139.912	2139.9120	R	Q	23	41
PSM	SEAPETPMEEEAELVLTEK	899	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:35	ms_run[2]:scan=17359	89.26	3	2146.9828	2146.9828	K	S	72	91
PSM	SEILDESDMYTDNR	900	sp|Q6P4Q7|CNNM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:35	ms_run[2]:scan=10716	54.995	2	1702.6992	1702.6992	K	S	506	520
PSM	SELPDSIESALQGDER	901	sp|Q9ULT8|HECD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=18764	97.563	2	1744.8115	1744.8115	R	C	300	316
PSM	SETAPAETATPAPVEKSPAK	902	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:21	ms_run[2]:scan=5375	29.349	2	2060.9667	2060.9667	M	K	2	22
PSM	SQDVELWEGEVVK	903	sp|Q9UHB6-5|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=16806	86.109	2	1516.7409	1516.7409	K	E	567	580
PSM	SQEPIPDDQKVSDDDK	904	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=1999	12.551	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	905	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=4597	25.524	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	906	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=4808	26.548	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	907	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=5219	28.594	2	1894.7833	1894.7833	K	E	415	431
PSM	SQEPIPDDQKVSDDDK	908	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=5651	30.662	2	1894.7833	1894.7833	K	E	415	431
PSM	SQQQDDIEELETK	909	sp|Q9H4A3-2|WNK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=10690	54.878	2	1561.7108	1561.7108	R	A	198	211
PSM	SRDATPPVSPINMEDQER	910	sp|P17275|JUNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21,9-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=7596	40.077	3	2216.881	2216.8810	R	I	251	269
PSM	SSPPAPPLPPGSGSPGTPQALPR	911	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:21	ms_run[2]:scan=14848	75.676	2	2244.094	2244.0940	R	R	585	608
PSM	SSSPAELDLKDDLQQTQGK	912	sp|Q2PPJ7-3|RGPA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:21	ms_run[2]:scan=14232	72.423	2	2138.9733	2138.9733	R	C	819	838
PSM	STVTGERQSGDGQESTEPVENK	913	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:21	ms_run[2]:scan=3281	19.134	2	2414.0235	2414.0235	K	V	140	162
PSM	SVSKESVASMGADSGDDFASDGSSSR	914	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8627	45.19	3	2631.028	2631.0280	R	E	28	54
PSM	TCVADESAENCDK	915	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1865	11.878	2	1497.5712	1497.5712	K	S	76	89
PSM	TCVADESAENCDK	916	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=2577	15.53	2	1497.5712	1497.5712	K	S	76	89
PSM	TEGDGVYTLNDK	917	sp|P00738|HPT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7785	40.97	2	1310.599	1310.5990	R	K	60	72
PSM	TELEDTLDSTAAQQELR	918	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=15915	81.222	3	1918.912	1918.9120	K	S	1146	1163
PSM	TFMDMDQDSEDEK	919	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2299	14.118	2	1621.576	1621.5760	K	Q	51	64
PSM	TIDDLEDEVYAQK	920	sp|P07951|TPM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=15192	77.448	2	1537.7148	1537.7148	K	M	252	265
PSM	TKDQPDGSSLSPAQSPSQSQPPAASSLR	921	sp|Q6WCQ1-3|MPRIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=9658	50.083	3	2983.2962	2983.2962	R	E	210	238
PSM	TSDIFEADIANDVK	922	sp|O94763-2|RMP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17729	91.437	2	1536.7308	1536.7308	K	S	111	125
PSM	TSDIFEADIANDVK	923	sp|O94763-2|RMP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=17737	91.488	2	1536.7308	1536.7308	K	S	111	125
PSM	TVECEEGSEDDESLR	924	sp|Q9UKF6|CPSF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:4	ms_run[2]:scan=5481	29.85	2	1753.6949	1753.6949	R	E	652	667
PSM	VDIEAPDVSLEGPEGK	925	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=15897	81.128	2	1653.8097	1653.8097	K	L	1162	1178
PSM	VDPSLMEDSDDGPSLPTK	926	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:35	ms_run[2]:scan=11508	58.862	2	1917.8514	1917.8514	K	Q	87	105
PSM	VDSAATSGYEIGNPPDYR	927	sp|P24666-4|PPAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12410	63.389	2	1910.8646	1910.8646	R	G	42	60
PSM	VLQSDEYEEVEDK	928	sp|O15397-2|IPO8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9260	48.137	2	1581.7046	1581.7046	K	T	387	400
PSM	VVVTVEQTEEELER	929	sp|O15269|SPTC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=16013	81.72	2	1658.8363	1658.8363	R	A	446	460
PSM	VYDEEVEEPVLK	930	sp|Q9Y4E1-3|WAC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12317	62.909	2	1447.7082	1447.7082	R	A	44	56
PSM	YDAFGEDSSSAMGVENR	931	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:35	ms_run[2]:scan=9827	50.871	3	1849.7425	1849.7425	R	A	372	389
PSM	YFQINQDEEEEEDED	932	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=13204	67.339	2	1930.7228	1930.7228	R	-	114	129
PSM	TCVADESAENCDK	933	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=1544	10.27873	2	1498.554901	1497.571173	K	S	76	89
PSM	VFDDESDEKEDEEYADEK	934	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	6-UNIMOD:21	ms_run[1]:scan=9191	47.85062666666666	3	2271.832951	2270.826395	K	G	637	655
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	935	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	28-UNIMOD:21	ms_run[1]:scan=7834	41.175095	3	3062.339618	3061.351348	K	G	56	88
PSM	VIEEQLEPAVEK	936	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=10481	53.88976166666667	2	1382.732100	1382.729311	K	I	1225	1237
PSM	EVEDKESEGEEEDEDEDLSK	937	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:21	ms_run[1]:scan=5539	30.144603333333333	2	2419.900926	2418.895931	K	Y	147	167
PSM	DTDDVPMILVGNK	938	sp|P61224|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:35	ms_run[1]:scan=17167	88.2107	2	1431.701082	1431.691546	K	C	105	118
PSM	DTDDVPMILVGNK	939	sp|P61224|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:35	ms_run[1]:scan=15483	78.96865833333334	2	1432.679679	1431.691546	K	C	105	118
PSM	SQLDDHPESDDEENFIDANDDEDMEK	940	sp|Q03701|CEBPZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	9-UNIMOD:21,24-UNIMOD:35	ms_run[1]:scan=13463	68.64782833333334	3	3149.134501	3147.129589	R	F	621	647
PSM	SCNLDEQQELVER	941	sp|P08575|PTPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	2-UNIMOD:4	ms_run[1]:scan=9699	50.26564833333333	2	1618.724789	1618.725700	R	D	609	622
PSM	TSEVQELQNDLDR	942	sp|Q9UBC2|EP15R_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=15980	81.54732166666666	2	1546.740595	1545.727080	K	E	418	431
PSM	MDTIDQDDELIR	943	sp|Q93008|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:35	ms_run[1]:scan=12549	64.06943333333334	2	1479.642761	1478.655889	R	Y	1956	1968
PSM	CDSSPDSAEDVR	944	sp|P02765|FETUA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:4	ms_run[1]:scan=2261	13.918465	2	1336.520180	1336.520124	K	K	132	144
PSM	GEDNAIEMSEDFDGK	945	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=13370	68.19091666666667	2	1656.664458	1655.662096	K	M	4722	4737
PSM	SQEPIPDDQKVSDDDK	946	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	12-UNIMOD:21	ms_run[1]:scan=3132	18.373503333333332	2	1895.788140	1894.783348	K	E	415	431
PSM	DSDDVPMVLVGNK	947	sp|P01112|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:35	ms_run[1]:scan=14053	71.551725	2	1403.654876	1403.660246	K	C	105	118
PSM	SQSDLDDQHDYDSVASDEDTDQEPLR	948	sp|Q9Y2X7|GIT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	16-UNIMOD:21	ms_run[1]:scan=12406	63.37096999999999	3	3060.186885	3059.178923	R	S	373	399
PSM	APAPVVLGSPVVLGPPVGQAR	949	sp|Q6ZN55|ZN574_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	9-UNIMOD:21	ms_run[1]:scan=19458	101.98980999999999	2	2061.122874	2060.118362	K	V	156	177
PSM	SEESLTSLHAVDGDSK	950	sp|A7KAX9|RHG32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:21	ms_run[1]:scan=11148	57.15271333333333	2	1753.742277	1753.740755	K	L	706	722
PSM	MDDDSYSHHSGLEYADPEK	951	sp|P51636-2|CAV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,1-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=10281	52.958055	2	2333.8532	2332.8462	-	F	1	20
PSM	EDAGDNDDTEGAIGVR	952	sp|Q9H0S4|DDX47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=6864	36.390265	2	1633.692676	1632.686337	R	N	426	442
PSM	DASDDLDDLNFFNQK	953	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=21511	116.256155	2	1756.745210	1755.758774	K	K	65	80
PSM	AAEDDEDDDVDTK	954	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1931	12.195	2	1436.5427	1436.5427	R	K	90	103
PSM	AALSASEGEEVPQDK	955	sp|O95831-6|AIFM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6665	35.413	2	1529.7209	1529.7209	K	A	26	41
PSM	AASDSDPDEQASLLQR	956	sp|Q2M3G4|SHRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9650	50.039	2	1701.7806	1701.7806	R	L	733	749
PSM	ACIDSNEDGDLSK	957	sp|P29144|TPP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4	ms_run[2]:scan=3967	22.491	2	1422.5933	1422.5933	R	S	208	221
PSM	AEAGPEGVAPAPEGEK	958	sp|Q9Y4L1|HYOU1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5427	29.606	2	1507.7155	1507.7155	K	K	670	686
PSM	AEDNADTLALVFEAPNQEK	959	sp|P12004|PCNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=20175	106.84	2	2073.9855	2073.9855	R	V	92	111
PSM	AESSFSEEEEEK	960	sp|Q9Y6G5|COMDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4087	23.117	2	1399.5627	1399.5627	K	L	45	57
PSM	AGGAGFGTDGDDQEAINEAISVK	961	sp|Q96EB6-2|SIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17166	88.207	3	2221.0135	2221.0135	R	Q	526	549
PSM	AGGEEEDDDDEAAGGR	962	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=980	7.5704	2	1591.587	1591.5870	R	C	357	373
PSM	ALDSEVDPDPEGDLGVR	963	sp|Q6IA17|SIGIR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=15080	76.879	2	1782.8272	1782.8272	R	G	343	360
PSM	ALEEGLTPQEICDK	964	sp|P56192|SYMC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:4	ms_run[2]:scan=12744	65.049	2	1601.7607	1601.7607	K	Y	322	336
PSM	ASLEDAPVDDLTR	965	sp|Q7Z2W4-3|ZCCHV_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13626	69.438	2	1400.6783	1400.6783	R	K	283	296
PSM	CESCYGAEAEDIK	966	sp|Q9Y282-2|ERGI3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:4,4-UNIMOD:4	ms_run[2]:scan=7891	41.428	2	1530.5967	1530.5967	R	C	142	155
PSM	CGEDDETIPSEYR	967	sp|P20810-4|ICAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:4	ms_run[2]:scan=9018	47.034	2	1569.6253	1569.6253	K	L	287	300
PSM	CTEDMTEDELR	968	sp|Q13148|TADBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:4,5-UNIMOD:35	ms_run[2]:scan=4711	26.056	2	1413.5388	1413.5388	R	E	198	209
PSM	DADDAVYELDGK	969	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10112	52.16	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	970	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10328	53.169	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	971	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10941	56.154	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	972	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11781	60.191	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	973	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11990	61.195	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	974	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12188	62.207	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELDGK	975	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12471	63.681	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELNGK	976	sp|Q13247-2|SRSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10424	53.622	2	1308.5834	1308.5834	R	E	47	59
PSM	DADDAVYELNGK	977	sp|Q13247-2|SRSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10728	55.05	2	1308.5834	1308.5834	R	E	47	59
PSM	DDGSWEVIEGYR	978	sp|P00367|DHE3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17372	89.337	2	1424.6208	1424.6208	R	A	125	137
PSM	DDMIFEDCGDVPSEPK	979	sp|P05026-2|AT1B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=13737	70.007	2	1868.7444	1868.7444	R	E	119	135
PSM	DEDEDIQSILR	980	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16767	85.882	2	1331.6205	1331.6205	K	T	80	91
PSM	DENATLDGGDVLFTGR	981	sp|O94760-2|DDAH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17334	89.123	2	1678.7798	1678.7798	K	E	18	34
PSM	DGPGETDAFGNSEGK	982	sp|O94925-2|GLSK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6046	32.57	2	1479.6114	1479.6114	K	E	107	122
PSM	DHSPTPSVFNSDEER	983	sp|Q6UN15-3|FIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=9874	51.086	2	1795.705	1795.7050	R	Y	416	431
PSM	DLEDETLWVEER	984	sp|P11277-3|SPTB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=18875	98.246	2	1532.6995	1532.6995	R	L	1486	1498
PSM	DLQGAMDDLDADMK	985	sp|P46939|UTRO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=9262	48.144	2	1568.6334	1568.6334	R	E	2695	2709
PSM	DPAAPEPEEQEER	986	sp|Q969T4|UB2E3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3785	21.636	2	1495.6427	1495.6427	R	K	26	39
PSM	DPDAQPGGELMLGGTDSK	987	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=10823	55.54	3	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	988	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=17788	91.766	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	989	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=20865	111.63	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	990	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=21068	113.03	2	1802.7993	1802.7993	R	Y	236	254
PSM	DSLLQDGEFSMDLR	991	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=20080	106.19	2	1624.7403	1624.7403	R	T	76	90
PSM	DSQDASAEQSDHDDEVASLASASGGFGTK	992	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=15900	81.144	3	2961.1785	2961.1785	R	V	489	518
PSM	DSQSASGEERPPEADGK	993	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=1776	11.445	2	1838.732	1838.7320	R	K	360	377
PSM	DTDDVPMILVGNK	994	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=14347	73.04	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	995	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=18009	93.002	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	996	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=19588	102.87	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	997	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=19741	103.93	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	998	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:35	ms_run[2]:scan=20159	106.74	2	1431.6915	1431.6915	K	C	86	99
PSM	DVETLQQTIEEK	999	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13825	70.445	2	1431.7093	1431.7093	R	D	813	825
PSM	DVIELTDDSFDK	1000	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16606	84.962	2	1395.6406	1395.6406	K	N	158	170
PSM	DYDEEEQGYDSEKEK	1001	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:21	ms_run[2]:scan=4508	25.129	2	1942.6993	1942.6993	R	K	423	438
PSM	EALNVFGNDYDTEDGTGVR	1002	sp|Q14376-2|GALE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17071	87.636	3	2070.913	2070.9130	R	D	147	166
PSM	EALPAPSDDATALMTDPK	1003	sp|P07203|GPX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16083	82.06	2	1841.8717	1841.8717	R	L	131	149
PSM	EDDVGTGAGLLEIK	1004	sp|P49368-2|TCPG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16332	83.458	2	1415.7144	1415.7144	R	K	302	316
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	1005	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=8653	45.317	3	3001.2673	3001.2673	R	E	120	150
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	1006	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:21	ms_run[2]:scan=9166	47.731	3	3001.2673	3001.2673	R	E	120	150
PSM	EEASDYLELDTIK	1007	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17230	88.572	2	1524.7195	1524.7195	K	N	253	266
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	1008	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	22-UNIMOD:21	ms_run[2]:scan=7593	40.06	3	3061.3513	3061.3513	K	G	56	88
PSM	EGEEPTVYSDEEEPKDESAR	1009	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:21	ms_run[2]:scan=5474	29.815	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1010	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:21	ms_run[2]:scan=6379	34.116	2	2374.9326	2374.9326	K	K	121	141
PSM	EGGAGAVDEDDFIK	1011	sp|O75122-2|CLAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12548	64.066	2	1421.6311	1421.6311	K	A	65	79
PSM	EGIESGDPGTDDGR	1012	sp|Q12797-10|ASPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3455	20.022	2	1403.5801	1403.5801	K	F	484	498
PSM	EIEELQSQAQALSQEGK	1013	sp|Q01082|SPTB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=14252	72.522	3	1886.9222	1886.9222	K	S	1435	1452
PSM	ELAEDGYSGVEVR	1014	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10298	53.034	2	1422.6627	1422.6627	R	V	28	41
PSM	ELAQQVQQVADDYGK	1015	sp|Q92841-1|DDX17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16112	82.226	2	1690.8162	1690.8162	R	C	176	191
PSM	ELDEATESNEAMGR	1016	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=3819	21.776	2	1566.6468	1566.6468	R	E	1906	1920
PSM	ELGGLEGDPSPEEDEGIQK	1017	sp|Q9BT09|CNPY3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12084	61.656	2	1997.9066	1997.9066	K	A	248	267
PSM	ESSETPDQFMTADETR	1018	sp|P16070-18|CD44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:35	ms_run[2]:scan=7791	40.996	2	1858.7527	1858.7527	K	N	314	330
PSM	ETTCSKESNEELTESCETK	1019	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=3783	21.629	2	2340.8975	2340.8975	R	K	289	308
PSM	ETTCSKESNEELTESCETK	1020	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=3995	22.628	2	2340.8975	2340.8975	R	K	289	308
PSM	EVAEAATGEDASSPPPK	1021	sp|Q99536-3|VAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3599	20.751	2	1654.7686	1654.7686	R	T	6	23
PSM	GAGDGSDEEVDGKADGAEAKPAE	1022	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=3503	20.278	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	1023	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=3701	21.243	2	2253.8911	2253.8911	K	-	1938	1961
PSM	GAGDGSDEEVDGKADGAEAKPAE	1024	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=4138	23.357	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GDSESEEDEDLEVPVPSR	1025	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12954	66.047	2	1987.8494	1987.8494	K	F	76	94
PSM	GDSFPDDGVQDDDDR	1026	sp|Q92932-2|PTPR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8259	43.398	2	1651.6234	1651.6234	R	L	373	388
PSM	GDVGSADIQDLEK	1027	sp|Q9Y5M8|SRPRB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11425	58.464	2	1345.6361	1345.6361	R	W	253	266
PSM	GEDNAIEMSEDFDGK	1028	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:35	ms_run[2]:scan=10303	53.052	2	1671.657	1671.6570	K	M	4722	4737
PSM	GEIDASVPELEGDLR	1029	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17223	88.531	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GEIDASVPELEGDLR	1030	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=18084	93.469	2	1598.7788	1598.7788	K	G	1797	1812
PSM	GPENEYSVDDECLVK	1031	sp|Q5SRH9-2|TT39A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:4	ms_run[2]:scan=12700	64.832	2	1752.7512	1752.7512	K	L	102	117
PSM	GVDEDDPVNSAYNMK	1032	sp|Q96JI7-2|SPTCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:35	ms_run[2]:scan=8279	43.5	2	1668.6937	1668.6937	K	L	312	327
PSM	GVEEEEEDGEMRE	1033	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=2393	14.582	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1034	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5973	32.222	2	1536.5886	1536.5886	R	-	74	87
PSM	GVGDDQLGEESEER	1035	sp|P20645|MPRD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5831	31.552	2	1518.6434	1518.6434	R	D	257	271
PSM	IDENSDKEMEVEESPEK	1036	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4828	26.658	3	2102.8239	2102.8239	K	I	495	512
PSM	IDEPLEGSEDR	1037	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6850	36.328	2	1258.5677	1258.5677	K	I	399	410
PSM	IDEPLEGSEDR	1038	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7047	37.345	2	1258.5677	1258.5677	K	I	399	410
PSM	IEELQEQLEQK	1039	sp|Q9UJC3-2|HOOK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11130	57.058	2	1385.7038	1385.7038	R	H	447	458
PSM	ITEIYEGTSEIQR	1040	sp|P16219|ACADS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11459	58.617	2	1537.7624	1537.7624	R	L	387	400
PSM	IVEEEAQEDLEGLR	1041	sp|Q0VD83-3|APOBR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=15197	77.469	3	1628.7893	1628.7893	K	G	58	72
PSM	LASEEPPDDEEALATIR	1042	sp|Q9UBB4-2|ATX10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=14786	75.344	2	1854.8847	1854.8847	K	L	225	242
PSM	LDQMDEDELER	1043	sp|O14530-2|TXND9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9528	49.437	2	1391.5875	1391.5875	K	L	36	47
PSM	LDSSEMDHSENEDYTMSSPLPGK	1044	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=12461	63.623	3	2664.0245	2664.0245	R	K	1174	1197
PSM	LGMSADPDNEDATDK	1045	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35	ms_run[2]:scan=2606	15.663	2	1593.6464	1593.6464	R	V	335	350
PSM	LLDEEEATDNDLR	1046	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9793	50.713	2	1531.7002	1531.7002	R	A	457	470
PSM	LNESDEQHQENEGTNQLVMGIQK	1047	sp|Q15545|TAF7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=11967	61.088	3	2736.1698	2736.1698	K	Q	261	284
PSM	LQDTYNLDTDTISK	1048	sp|P13674-3|P4HA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12591	64.274	2	1625.7784	1625.7784	R	G	137	151
PSM	LVDEDFPEDSSSQK	1049	sp|A6NDU8|CE051_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9632	49.962	2	1594.6999	1594.6999	K	V	82	96
PSM	MDTIDQDDELIR	1050	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:35	ms_run[2]:scan=12892	65.753	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	NDQEPPPEALDFSDDEKEK	1051	sp|Q96HR8-2|NAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:21	ms_run[2]:scan=12814	65.385	2	2281.9264	2281.9264	K	E	303	322
PSM	NEIDNYEEDYQK	1052	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9858	51.005	2	1558.6423	1558.6423	K	M	1109	1121
PSM	NSVVEASEAAYK	1053	sp|Q04917|1433F_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8133	42.79	2	1266.6092	1266.6092	K	E	144	156
PSM	PAAMISQPPTPPTGQPVR	1054	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=10523	54.072	2	1939.9227	1939.9227	R	E	985	1003
PSM	PGGPPNPPGPSPK	1055	sp|O95785-2|WIZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:21	ms_run[2]:scan=3865	22.004	2	1277.5806	1277.5806	R	A	239	252
PSM	QDENDDDDDWNPCK	1056	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:4	ms_run[2]:scan=8613	45.123	2	1764.6169	1764.6169	K	A	188	202
PSM	QICPYGSGIIVGPDDSAVDMDECK	1057	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:4,20-UNIMOD:35,23-UNIMOD:4	ms_run[2]:scan=16731	85.694	3	2641.1346	2641.1346	R	E	2109	2133
PSM	QLSESESSLEMDDER	1058	sp|Q16204|CCDC6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9974	51.541	2	1753.7312	1753.7312	R	Y	321	336
PSM	SAVEAQNEVTENPK	1059	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4255	23.911	2	1514.7213	1514.7213	K	Q	562	576
PSM	SCSEEKIPEDGSLNTTK	1060	sp|P37173|TGFR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21,2-UNIMOD:4	ms_run[2]:scan=8249	43.353	2	1973.8289	1973.8289	R	-	551	568
PSM	SCSEEKIPEDGSLNTTK	1061	sp|P37173|TGFR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21,2-UNIMOD:4	ms_run[2]:scan=8391	44.044	2	1973.8289	1973.8289	R	-	551	568
PSM	SEAEDEDDEDYVPYVPLR	1062	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=18068	93.368	2	2139.912	2139.9120	R	Q	23	41
PSM	SEGDNYSATLLEPAASSLSPDHK	1063	sp|Q9Y2D5-5|AKAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	19-UNIMOD:21	ms_run[2]:scan=16656	85.236	2	2468.0744	2468.0744	K	N	66	89
PSM	SENENQEQIEESK	1064	sp|Q96JJ7|TMX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2038	12.762	2	1562.6696	1562.6696	K	E	415	428
PSM	SEQEDEVLLVSSSR	1065	sp|Q9NZJ9|NUDT4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13237	67.509	2	1576.758	1576.7580	R	Y	28	42
PSM	SEQLGGDVESYDK	1066	sp|Q9HC84|MUC5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=8674	45.415	2	1425.626	1425.6260	K	I	1520	1533
PSM	SGDEEFKGEDELCDSGR	1067	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10681	54.839	2	2008.7357	2008.7357	R	Q	339	356
PSM	SLDEADSENKEEVSPLGSK	1068	sp|Q6ZV73-2|FGD6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=9639	49.991	2	2112.91	2112.9100	R	A	1197	1216
PSM	SQEPIPDDQKVSDDDK	1069	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:21	ms_run[2]:scan=3412	19.788	2	1894.7833	1894.7833	K	E	415	431
PSM	SQETGDLDVGGLQETDK	1070	sp|P23142-2|FBLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11461	58.625	3	1790.817	1790.8170	K	I	147	164
PSM	SQKEEDEQEDLTK	1071	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=3089	18.158	2	1657.672	1657.6720	R	D	357	370
PSM	SSDEENGPPSSPDLDR	1072	sp|Q96B36-2|AKTS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6221	33.353	2	1700.7126	1700.7126	R	I	72	88
PSM	STESDVKADGDSK	1073	sp|Q9Y4W2-4|LAS1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=1056	7.9184	2	1417.561	1417.5610	K	G	235	248
PSM	STSDLDKDDASYLR	1074	sp|Q8TEP8|CE192_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=10350	53.265	2	1664.6931	1664.6931	R	L	565	579
PSM	SVSKESVASMGADSGDDFASDGSSSR	1075	sp|Q92805|GOGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=8548	44.81	2	2631.028	2631.0280	R	E	28	54
PSM	SVSNGTAKPATSENFDEDLK	1076	sp|Q96K49-2|TM87B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=10653	54.718	3	2188.9525	2188.9525	K	W	493	513
PSM	SYEDDDDMDLQPNK	1077	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9394	48.776	2	1683.657	1683.6570	R	Q	167	181
PSM	TCVADESAENCDK	1078	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1391	9.5137	2	1497.5712	1497.5712	K	S	76	89
PSM	TDEAFFDSENDPEK	1079	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11882	60.691	2	1642.6635	1642.6635	K	C	1974	1988
PSM	TDLDDDITALK	1080	sp|Q6P1J9|CDC73_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=14826	75.554	2	1218.598	1218.5980	K	Q	199	210
PSM	TFMDMDQDSEDEK	1081	sp|Q29RF7|PDS5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2102	13.109	2	1621.576	1621.5760	K	Q	51	64
PSM	TGSTSSKEDDYESDAATIVQK	1082	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=12425	63.46	3	2310.9741	2310.9741	R	C	360	381
PSM	TLTTVQGIADDYDK	1083	sp|P41567|EIF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=14615	74.468	2	1538.7464	1538.7464	K	K	43	57
PSM	TSIPNAASEEGDEDDWASNK	1084	sp|P30291-2|WEE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12087	61.671	2	2134.8927	2134.8927	R	V	223	243
PSM	TTTTNTQVEGDDEAAFLER	1085	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=14089	71.718	3	2096.9498	2096.9498	K	L	75	94
PSM	TYADYESVNECMEGVCK	1086	sp|P84090|ERH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:4,12-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=9942	51.393	3	2069.8016	2069.8016	R	M	18	35
PSM	VAEVEGEQVDNK	1087	sp|O95202|LETM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3431	19.902	2	1315.6256	1315.6256	K	A	452	464
PSM	VAVGELTDEDVK	1088	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10618	54.562	2	1273.6402	1273.6402	K	M	451	463
PSM	VDFTEEEINNMK	1089	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=10188	52.516	2	1483.6501	1483.6501	K	T	175	187
PSM	VDIDAPDVSIEGPDAK	1090	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=14878	75.826	2	1639.7941	1639.7941	K	L	4352	4368
PSM	VDIQTEDLEDGTCK	1091	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:4	ms_run[2]:scan=10263	52.869	2	1621.7141	1621.7141	K	V	2045	2059
PSM	VDNSSLTGESEPQTR	1092	sp|P50993|AT1A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=4858	26.812	2	1618.7435	1618.7435	K	S	211	226
PSM	VDSLVSLSEEDLESDQR	1093	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=18227	94.286	2	1919.896	1919.8960	R	E	1622	1639
PSM	VDTNAPDLSLEGPEGK	1094	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=12774	65.193	2	1640.7893	1640.7893	K	L	1034	1050
PSM	VEDPEINSIQDIK	1095	sp|Q14690|RRP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13723	69.936	2	1498.7515	1498.7515	K	E	1310	1323
PSM	VEELEMTEDIR	1096	sp|Q92896|GSLG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13763	70.133	2	1362.6337	1362.6337	R	L	807	818
PSM	VEELIESEAPPK	1097	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=10173	52.449	2	1339.6871	1339.6871	K	A	10	22
PSM	VSEEAESQQQWDTSK	1098	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6338	33.906	2	1750.7646	1750.7646	K	G	2109	2124
PSM	VVSPTKEQVSDTEDK	1099	sp|O60303|K0556_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=3868	22.016	2	1740.7819	1740.7819	R	Q	451	466
PSM	YDGESDKEQFDDDQK	1100	sp|Q08AD1-2|CAMP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=5314	29.088	2	1897.6891	1897.6891	K	V	1117	1132
PSM	YDLDACDIQEK	1101	sp|O14976-2|GAK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:4	ms_run[2]:scan=10668	54.785	2	1368.5867	1368.5867	K	Y	607	618
PSM	YEGSYALTSEEAER	1102	sp|O95810|CAVN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9791	50.705	2	1603.7002	1603.7002	R	S	395	409
PSM	YLMEEDEDAYK	1103	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35	ms_run[2]:scan=7388	38.993	2	1420.5704	1420.5704	R	K	210	221
PSM	YPDLYPQEDEDEEEER	1104	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13327	67.98	2	2054.8229	2054.8229	K	E	101	117
PSM	MDVNVGDIDIEGPEGK	1105	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	1-UNIMOD:35	ms_run[1]:scan=15456	78.81717833333333	2	1702.772825	1702.771981	K	L	1620	1636
PSM	IAEFTTNLTEEEEK	1106	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=14017	71.37089499999999	2	1651.759995	1652.778112	R	S	1001	1015
PSM	TCVADESAENCDK	1107	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	2-UNIMOD:4,11-UNIMOD:4	ms_run[1]:scan=2536	15.331998333333333	2	1498.555661	1497.571173	K	S	76	89
PSM	NPDDITQEEYGEFYK	1108	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=16009	81.69668833333333	2	1847.779049	1846.789740	R	S	292	307
PSM	ESEDKPEIEDVGSDEEEEK	1109	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:21	ms_run[1]:scan=8832	46.13659833333333	2	2271.892541	2271.879159	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEKK	1110	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:27,13-UNIMOD:21	ms_run[1]:scan=8772	45.86992333333333	3	2381.9655	2381.9630	K	D	251	271
PSM	NPDDITNEEYGEFYK	1111	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=15751	80.38100666666666	2	1833.766677	1832.774089	R	S	300	315
PSM	EEKEESDDEAAVEEEEEEK	1112	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:21	ms_run[1]:scan=7520	39.698251666666664	3	2332.875147	2331.863902	K	K	301	320
PSM	VFDDESDEKEDEEYADEK	1113	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:21	ms_run[1]:scan=9410	48.86524166666667	3	2271.832951	2270.826395	K	G	637	655
PSM	AAEDDEDDDVDTK	1114	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=2367	14.461051666666666	2	1437.553534	1436.542692	R	K	91	104
PSM	QEPESEEEEEEKQEK	1115	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=4434	24.735725	2	1938.7284	1938.7250	K	E	579	594
PSM	GNAEGSSDEEGKLVIDEPAK	1116	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	7-UNIMOD:21	ms_run[1]:scan=10794	55.39571	2	2124.916308	2123.925989	K	E	127	147
PSM	EITENLMATGDLDQDGR	1117	sp|P13796|PLSL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=15058	76.764635	2	1877.859076	1876.847271	R	I	52	69
PSM	YNLDASEEEDSNK	1118	sp|O95218|ZRAB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6120	32.91550833333333	2	1513.610249	1512.621611	K	K	183	196
PSM	DPDAQPGGELMLGGTDSK	1119	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	11-UNIMOD:35	ms_run[1]:scan=14585	74.32038666666666	2	1803.799977	1802.799259	R	Y	236	254
PSM	SSDSDESYGEGCIALR	1120	sp|Q92835|SHIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	12-UNIMOD:4	ms_run[1]:scan=11612	59.38143	2	1744.723439	1744.721008	K	L	808	824
PSM	GVEEEEEDGEMRE	1121	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	11-UNIMOD:35	ms_run[1]:scan=2899	17.247989999999998	2	1552.585061	1552.583512	R	-	74	87
PSM	CELLYEGPPDDEAAMGIK	1122	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=19652	103.32661166666666	2	2005.8725	2005.8644	R	S	369	387
PSM	EEDTSNTTFGPADLK	1123	sp|Q12830|BPTF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=12143	61.94401333333333	2	1625.732730	1623.726411	R	D	297	312
PSM	GLSGEEEDDEPDCCNDER	1124	sp|Q6P158|DHX57_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=5309	29.064136666666663	2	2125.753782	2124.748422	R	Y	130	148
PSM	QAVEMKNDKSEEEQSSSSVK	1125	sp|P07910|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	10-UNIMOD:21	ms_run[1]:scan=3117	18.30847	3	2318.949792	2318.993752	K	K	224	244
PSM	EDDLNSFNATDLK	1126	sp|P09960|LKHA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=14508	73.91748166666666	2	1480.670844	1480.668168	K	D	481	494
PSM	QDENDDDDDWNPCK	1127	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,13-UNIMOD:4	ms_run[1]:scan=10815	55.492733333333334	2	1748.5952	1747.5902	K	A	333	347
PSM	MEADKDDTQQILK	1128	sp|Q13287|NMI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,1-UNIMOD:35	ms_run[1]:scan=8263	43.41728666666666	2	1591.7406	1591.7394	-	E	1	14
PSM	DADDAVYELDGK	1129	sp|Q13243|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=10424	53.62242833333333	2	1308.585170	1309.567391	R	E	49	61
PSM	LEEDQEDMNELMK	1130	sp|Q92614|MY18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	8-UNIMOD:35,12-UNIMOD:35	ms_run[1]:scan=5182	28.405928333333332	2	1656.664820	1654.670219	R	K	1748	1761
PSM	DPDAQPGGELMLGGTDSK	1131	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	11-UNIMOD:35	ms_run[1]:scan=10184	52.49701833333334	2	1801.819493	1802.799259	R	Y	236	254
PSM	GAGDGSDEEVDGKADGAEAK	1132	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:21	ms_run[1]:scan=2762	16.500735	2	1955.742492	1956.758590	K	P	1938	1958
PSM	AADEEAFEDNSEEYIR	1133	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14206	72.292	2	1886.7806	1886.7806	R	R	300	316
PSM	AALEDTLAETEAR	1134	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12723	64.954	2	1388.6783	1388.6783	K	F	318	331
PSM	ADAEGESDLENSR	1135	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3670	21.097	2	1391.5801	1391.5801	K	K	842	855
PSM	AEDSLLAAEEAAAK	1136	sp|P09493-8|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13702	69.818	2	1387.6831	1387.6831	K	A	67	81
PSM	AELDNELMEGK	1137	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:35	ms_run[2]:scan=7674	40.429	2	1263.5653	1263.5653	K	V	118	129
PSM	AELVLIDEDDEK	1138	sp|Q8IXS6|PALM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14216	72.341	2	1387.6719	1387.6719	K	S	306	318
PSM	AGELTEDEVER	1139	sp|P62269|RS18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6078	32.713	2	1246.5677	1246.5677	R	V	56	67
PSM	AGTQIENIDEDFR	1140	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12578	64.203	2	1506.6951	1506.6951	K	D	67	80
PSM	AGTQIENIDEDFR	1141	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14958	76.262	2	1506.6951	1506.6951	K	D	67	80
PSM	ANAMLDEDEDER	1142	sp|Q9BSL1|UBAC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35	ms_run[2]:scan=3293	19.19	2	1422.5569	1422.5569	K	V	180	192
PSM	ATDGDLAQEPGPGLTFEDSGNPKSPDK	1143	sp|O15417|TNC18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	24-UNIMOD:21	ms_run[2]:scan=14733	75.087	3	2822.2284	2822.2284	K	A	2520	2547
PSM	AVAGDASESALLK	1144	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9580	49.698	2	1230.6456	1230.6456	R	C	415	428
PSM	AVANYDSVEEGEK	1145	sp|P51659-3|DHB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6210	33.305	2	1409.6311	1409.6311	K	V	51	64
PSM	DADECLLFGQEICK	1146	sp|Q14766-3|LTBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=18446	95.616	2	1696.7437	1696.7437	K	N	1045	1059
PSM	DAINQGMDEELER	1147	sp|P11177-3|ODPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12148	61.969	2	1518.662	1518.6620	R	D	37	50
PSM	DCEECIQLEPTFIK	1148	sp|P31948-3|STIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4,5-UNIMOD:4	ms_run[2]:scan=18704	97.194	2	1780.8012	1780.8012	K	G	392	406
PSM	DDDDSDIPTAQR	1149	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4512	25.15	2	1346.5586	1346.5586	K	K	475	487
PSM	DDDEGPVSNQGYMPYLNR	1150	sp|Q9UH65|SWP70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:35	ms_run[2]:scan=12757	65.109	2	2084.8745	2084.8745	R	F	58	76
PSM	DEDAGEGIQCSQR	1151	sp|Q9BSA9|TM175_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=2796	16.658	2	1463.5947	1463.5947	R	M	23	36
PSM	DELADEIANSSGK	1152	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11028	56.558	2	1347.6154	1347.6154	R	G	1704	1717
PSM	DFDDLCSLPDLNEK	1153	sp|B2RTY4-3|MYO9A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4	ms_run[2]:scan=19259	100.7	2	1679.7349	1679.7349	K	T	147	161
PSM	DFTSLENTVEER	1154	sp|Q07065|CKAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16355	83.565	2	1438.6576	1438.6576	R	L	229	241
PSM	DGDGEVSEQEFLR	1155	sp|P41208|CETN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13221	67.423	2	1479.6478	1479.6478	R	I	152	165
PSM	DGEEAGAYDGPR	1156	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4488	25.026	2	1235.5055	1235.5055	R	T	108	120
PSM	DGEEAGAYDGPR	1157	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4909	27.092	2	1235.5055	1235.5055	R	T	108	120
PSM	DGFYEAELCPDR	1158	sp|Q04206-2|TF65_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:4	ms_run[2]:scan=14575	74.277	2	1470.6085	1470.6085	R	C	84	96
PSM	DGQDAIAQSPEKESK	1159	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:21	ms_run[2]:scan=2582	15.553	2	1681.7196	1681.7196	K	D	281	296
PSM	DIISIAEDEDLR	1160	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=18694	97.137	2	1387.6831	1387.6831	R	V	178	190
PSM	DLECVTNLQEVAR	1161	sp|P10619-2|PPGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:4	ms_run[2]:scan=15690	80.057	2	1545.7457	1545.7457	K	I	236	249
PSM	DLLEEDELLEQK	1162	sp|Q9H3S7|PTN23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17948	92.658	2	1472.7246	1472.7246	R	F	461	473
PSM	DLQGAMDDLDADMK	1163	sp|P46939|UTRO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=8886	46.404	2	1568.6334	1568.6334	R	E	2695	2709
PSM	DMNQVLDAYENK	1164	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35	ms_run[2]:scan=10754	55.191	2	1454.6348	1454.6348	R	K	142	154
PSM	DPDAQPGGELMLGGTDSK	1165	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=19430	101.81	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1166	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=19594	102.91	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1167	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15414	78.601	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1168	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15728	80.266	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPDMVQNTVSELIK	1169	sp|Q16698-2|DECR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35	ms_run[2]:scan=18643	96.802	2	1603.7763	1603.7763	R	V	111	125
PSM	DPIDVDLPEEAER	1170	sp|P29590-4|PML_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15252	77.753	2	1496.6995	1496.6995	R	V	412	425
PSM	DQDELNPYAAWR	1171	sp|O43615|TIM44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16878	86.555	2	1476.6634	1476.6634	R	L	428	440
PSM	DSDDVPMVLVGNK	1172	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=14592	74.35	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	1173	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=16474	84.199	2	1403.6602	1403.6602	K	C	105	118
PSM	DSLLQDGEFSMDLR	1174	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=17605	90.729	2	1640.7352	1640.7352	R	T	76	90
PSM	DSSESQLASTESDKPTTGR	1175	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21	ms_run[2]:scan=6000	32.362	2	2074.8692	2074.8692	R	V	65	84
PSM	DTDDVPMILVGNK	1176	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=16816	86.16	2	1431.6915	1431.6915	K	C	86	99
PSM	DVDFEGTDEPIFGK	1177	sp|P42285|MTREX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17936	92.599	2	1567.7042	1567.7042	R	K	65	79
PSM	DVVICPDASLEDAK	1178	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:4	ms_run[2]:scan=13908	70.869	2	1530.7236	1530.7236	R	K	49	63
PSM	DYDEEEQGYDSEKEK	1179	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=2761	16.497	2	1942.6993	1942.6993	R	K	423	438
PSM	DYDEEEQGYDSEKEK	1180	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=3374	19.594	2	1942.6993	1942.6993	R	K	423	438
PSM	DYDEEEQGYDSEKEK	1181	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=4008	22.691	2	1942.6993	1942.6993	R	K	423	438
PSM	EDCSPDEFIDVIVGNR	1182	sp|P55039|DRG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4	ms_run[2]:scan=22783	125.62	2	1863.8309	1863.8309	R	V	221	237
PSM	EDDLNSFNATDLK	1183	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13139	66.987	2	1480.6682	1480.6682	K	D	457	470
PSM	EDDLNSFNATDLK	1184	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14305	72.801	2	1480.6682	1480.6682	K	D	457	470
PSM	EDDLNSFNATDLK	1185	sp|P09960-3|LKHA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14487	73.811	2	1480.6682	1480.6682	K	D	457	470
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	1186	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=7335	38.738	3	3001.2673	3001.2673	R	E	120	150
PSM	EDKSPSEESAPTTSPESVSGSVPSSGSSGR	1187	sp|P54725-2|RD23A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=8877	46.363	3	3001.2673	3001.2673	R	E	120	150
PSM	EEACDCLFEVVNK	1188	sp|O43592|XPOT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:4,6-UNIMOD:4	ms_run[2]:scan=17075	87.655	2	1611.6909	1611.6909	R	G	241	254
PSM	EEADENYNSVNTR	1189	sp|Q12846-2|STX4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3739	21.418	2	1539.6437	1539.6437	K	M	107	120
PSM	EEALEEADELDR	1190	sp|Q9UGY1|NOL12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11764	60.115	2	1417.6209	1417.6209	R	L	76	88
PSM	EEASGSSVTAEEAK	1191	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1861	11.855	2	1393.6209	1393.6209	K	K	689	703
PSM	EEDGVDTIEEDLTR	1192	sp|Q86X53|ERIC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=18234	94.333	2	1619.7162	1619.7162	R	A	271	285
PSM	EEEEENVQSEWR	1193	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9156	47.687	2	1562.6485	1562.6485	R	L	1445	1457
PSM	EELEEEQRTEE	1194	sp|P84157-2|MXRA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3580	20.668	2	1419.6001	1419.6001	K	-	160	171
PSM	EELQSGVDAANSAAQQYQR	1195	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12342	63.037	3	2063.9508	2063.9508	K	R	369	388
PSM	EFAGEDTSDLFLEER	1196	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=18572	96.377	2	1756.7792	1756.7792	K	E	1024	1039
PSM	EGEEAGPGDPLLEAVPK	1197	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17220	88.513	2	1706.8363	1706.8363	K	T	353	370
PSM	EGEEPTVYSDEEEPKDESAR	1198	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:21	ms_run[2]:scan=6815	36.15	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1199	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:21	ms_run[2]:scan=7633	40.233	2	2374.9326	2374.9326	K	K	121	141
PSM	EIAEAYDVLSDPR	1200	sp|P25685|DNJB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15701	80.118	2	1476.7096	1476.7096	K	K	47	60
PSM	EIENLTQQYEEK	1201	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10679	54.833	2	1522.7151	1522.7151	K	A	1400	1412
PSM	EISDDEAEEEKGEK	1202	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=918	7.2757	2	1686.6509	1686.6509	K	E	224	238
PSM	EISDDEAEEEKGEK	1203	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=2153	13.359	2	1686.6509	1686.6509	K	E	224	238
PSM	EISDDEAEEEKGEK	1204	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=2347	14.365	2	1686.6509	1686.6509	K	E	224	238
PSM	ELDEATESNEAMGR	1205	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:35	ms_run[2]:scan=4059	22.97	2	1566.6468	1566.6468	R	E	1906	1920
PSM	ELMDEEDVLQECK	1206	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=11726	59.93	2	1652.691	1652.6910	K	A	26	39
PSM	ELMDEEDVLQECK	1207	sp|Q5H9R7-3|PP6R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:4	ms_run[2]:scan=14771	75.269	2	1636.696	1636.6960	K	A	26	39
PSM	EQNQDSQTEAEELR	1208	sp|Q8N573-3|OXR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4964	27.367	2	1675.7285	1675.7285	K	K	423	437
PSM	EQSHAEISPPAESGQAVEECK	1209	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=8436	44.264	3	2361.9784	2361.9784	R	E	141	162
PSM	ESEDKPEIEDVGSDEEEEK	1210	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:21	ms_run[2]:scan=6431	34.351	2	2271.8792	2271.8792	K	K	251	270
PSM	EVAEAYEVLSDPK	1211	sp|Q9UDY4|DNJB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14007	71.326	2	1448.7035	1448.7035	K	K	47	60
PSM	EVDDLGPEVGDIK	1212	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13550	69.047	2	1384.6722	1384.6722	R	I	372	385
PSM	EVDEISPEDDQR	1213	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5639	30.599	2	1430.6161	1430.6161	R	A	316	328
PSM	FEEDVEEETER	1214	sp|P48751-2|B3A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7568	39.941	2	1410.5787	1410.5787	K	W	51	62
PSM	FLNRSPEESFDIK	1215	sp|Q96S38-2|KS6C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=15702	80.121	2	1740.7161	1740.7161	K	E	407	420
PSM	FSEDSQDSDDEK	1216	sp|Q15185-4|TEBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1334	9.2222	2	1400.5216	1400.5216	R	M	123	135
PSM	FTDEEVDELYR	1217	sp|P19105|ML12A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15223	77.591	2	1414.6252	1414.6252	R	E	133	144
PSM	FYGEAGPPAPSPAPGPPVK	1218	sp|Q53EQ6-2|TIGD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=12946	66.011	2	1914.8917	1914.8917	R	E	137	156
PSM	GAVAAEGASDTEREEPTESQGLAAR	1219	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=8826	46.107	3	2581.1293	2581.1293	R	L	907	932
PSM	GDVENIEVVQK	1220	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=8678	45.437	2	1228.6299	1228.6299	K	M	1153	1164
PSM	GEDEEENNLEVR	1221	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=5985	32.292	2	1431.6114	1431.6114	K	E	90	102
PSM	GEDEEENNLEVR	1222	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6240	33.442	2	1431.6114	1431.6114	K	E	90	102
PSM	GPPQEEEEEEDEEEEATK	1223	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6769	35.913	3	2102.8288	2102.8288	R	E	202	220
PSM	GSTLDLSDLEAEK	1224	sp|O00767|ACOD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15822	80.76	2	1376.6671	1376.6671	K	L	197	210
PSM	GTDDSPKDSQEDLQER	1225	sp|Q969E4|TCAL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21	ms_run[2]:scan=3705	21.262	2	1898.7531	1898.7531	R	H	117	133
PSM	GVEEEEEDGEMR	1226	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=1335	9.2257	2	1423.5409	1423.5409	R	E	74	86
PSM	GVEEEEEDGEMR	1227	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=1559	10.371	2	1423.5409	1423.5409	R	E	74	86
PSM	GVEEEEEDGEMR	1228	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=2205	13.588	2	1423.5409	1423.5409	R	E	74	86
PSM	GVEEEEEDGEMRE	1229	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=3713	21.298	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1230	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=3975	22.526	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1231	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=4613	25.592	2	1536.5886	1536.5886	R	-	74	87
PSM	IAQLEEQLDNETK	1232	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9860	51.012	2	1529.7573	1529.7573	K	E	1816	1829
PSM	IDEPLEGSEDR	1233	sp|P61978-3|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6647	35.334	2	1258.5677	1258.5677	K	I	399	410
PSM	IDVDTEDVGDER	1234	sp|Q9Y2W6-3|TDRKH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7821	41.115	2	1361.5947	1361.5947	R	V	86	98
PSM	IEDVGSDEEDDSGKDK	1235	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=1728	11.2	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	1236	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=1936	12.223	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	1237	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=2784	16.602	2	1816.6888	1816.6888	K	K	250	266
PSM	IEEESEAMAEK	1238	sp|A5D8V6|VP37C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:35	ms_run[2]:scan=1710	11.1	2	1280.5442	1280.5442	K	F	111	122
PSM	IEGDETSTEAATR	1239	sp|P52434-3|RPAB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2321	14.219	2	1378.6212	1378.6212	R	L	63	76
PSM	IEPGVDPDDTYNETPYEK	1240	sp|Q9H4A4|AMPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12109	61.79	2	2080.9113	2080.9113	K	G	399	417
PSM	IIDEDEEVEADR	1241	sp|Q8IWD4|CC117_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6565	34.956	2	1431.6365	1431.6365	R	N	156	168
PSM	IQNTGDYYDLYGGEK	1242	sp|Q06124-3|PTN11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13620	69.402	2	1734.7737	1734.7737	K	F	56	71
PSM	KGGSYSQAASSDSAQGSDVSLTACK	1243	sp|Q09160|1A80_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	17-UNIMOD:21,20-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=7202	38.09	3	2621.0354	2621.0354	R	V	340	365
PSM	KGGSYSQAASSDSAQGSDVSLTACKV	1244	sp|Q09160|1A80_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	17-UNIMOD:21,20-UNIMOD:21,24-UNIMOD:4	ms_run[2]:scan=10799	55.418	3	2720.1038	2720.1038	R	-	340	366
PSM	LDDAIEDCTNAVK	1245	sp|Q99615-2|DNJC7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:4	ms_run[2]:scan=9816	50.818	2	1462.661	1462.6610	K	L	254	267
PSM	LDGESSELQEQMVEQQQR	1246	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:35	ms_run[2]:scan=8168	42.958	3	2148.9593	2148.9593	R	A	1077	1095
PSM	LDQMDEDELER	1247	sp|O14530-2|TXND9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35	ms_run[2]:scan=6519	34.751	2	1407.5824	1407.5824	K	L	36	47
PSM	LDTDDLDEIEK	1248	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9680	50.184	2	1304.5984	1304.5984	R	I	357	368
PSM	LDTDDLDEIEK	1249	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13180	67.23	2	1304.5984	1304.5984	R	I	357	368
PSM	LDYDEDASAMLK	1250	sp|Q8NFI4|F10A5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35	ms_run[2]:scan=9301	48.319	2	1385.6021	1385.6021	K	E	211	223
PSM	LDYDEDASAMLK	1251	sp|Q8NFI4|F10A5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14590	74.343	2	1369.6071	1369.6071	K	E	211	223
PSM	LEDLLQDSMDEK	1252	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:35	ms_run[2]:scan=12384	63.257	2	1450.6497	1450.6497	R	E	824	836
PSM	LEESYDMESVLR	1253	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=16559	84.687	2	1469.6708	1469.6708	K	N	276	288
PSM	LESIDGNEEESMK	1254	sp|Q8TEQ6|GEMI5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:35	ms_run[2]:scan=4740	26.194	2	1495.6348	1495.6348	K	E	755	768
PSM	LFEESDDKEDEDADGK	1255	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=4614	25.595	2	1920.715	1920.7150	K	E	672	688
PSM	LFEESDDKEDEDADGK	1256	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=6206	33.287	3	1920.715	1920.7150	K	E	672	688
PSM	LIEEISEVDCK	1257	sp|O60281-2|ZN292_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:4	ms_run[2]:scan=12027	61.373	2	1333.6435	1333.6435	K	D	99	110
PSM	LPNLSSPSAEGPPGPPSGPAPR	1258	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=13747	70.057	3	2161.0205	2161.0205	R	K	412	434
PSM	LSQVSDSVSGQTVVDPK	1259	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9885	51.133	2	1744.8843	1744.8843	R	G	255	272
PSM	MDAEVPDVNIEGPDAK	1260	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35	ms_run[2]:scan=12810	65.366	2	1714.772	1714.7720	K	L	1418	1434
PSM	MDSTANEVEAVK	1261	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35	ms_run[2]:scan=4823	26.632	2	1308.5867	1308.5867	K	V	425	437
PSM	MEAENLEQLIDQK	1262	sp|P11047|LAMC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35	ms_run[2]:scan=15421	78.635	2	1575.745	1575.7450	K	L	1291	1304
PSM	MQNDTAENETTEK	1263	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:35	ms_run[2]:scan=739	6.4015	2	1525.6202	1525.6202	R	E	131	144
PSM	NEDITEPQSILAAAEK	1264	sp|Q9Y2Q3-4|GSTK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17875	92.268	2	1727.8578	1727.8578	R	A	86	102
PSM	NEDSLVFVQTDK	1265	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=13280	67.746	2	1393.6725	1393.6725	K	S	124	136
PSM	NEEDDMVEMEEER	1266	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35	ms_run[2]:scan=6729	35.717	2	1669.6083	1669.6083	K	L	282	295
PSM	NEEDDMVEMEEER	1267	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:35	ms_run[2]:scan=8574	44.935	2	1669.6083	1669.6083	K	L	282	295
PSM	NIVVIDDDKSETCNEDLAGTTDEK	1268	sp|Q15723-4|ELF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=13442	68.548	3	2760.1685	2760.1685	K	S	206	230
PSM	NMDDYEDFDEK	1269	sp|Q68DH5|LMBD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35	ms_run[2]:scan=8446	44.308	2	1435.5086	1435.5086	R	H	286	297
PSM	NPDDITNEEYGEFYK	1270	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14682	74.809	2	1832.7741	1832.7741	R	S	300	315
PSM	NVELQCLDADDAK	1271	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4	ms_run[2]:scan=11466	58.651	2	1489.6719	1489.6719	R	A	815	828
PSM	NVELQCLDADDAK	1272	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4	ms_run[2]:scan=11928	60.915	2	1489.6719	1489.6719	R	A	815	828
PSM	QCVENADLPEGEK	1273	sp|Q99460-2|PSMD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4	ms_run[2]:scan=6244	33.464	2	1487.6562	1487.6562	K	K	111	124
PSM	QDVDDEYSMQYSAR	1274	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10149	52.336	2	1705.689	1705.6890	K	G	683	697
PSM	QMEVQLEEEYEDK	1275	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35	ms_run[2]:scan=10483	53.896	2	1684.7138	1684.7138	K	Q	1573	1586
PSM	REVLYDSEGLSGEER	1276	sp|Q9H7N4|SFR19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=11769	60.137	2	1897.7496	1897.7496	K	G	728	743
PSM	RPPSPDVIVLSDNEQPSSPR	1277	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=14595	74.365	3	2349.0403	2349.0403	R	V	97	117
PSM	SDDTAVYYCAR	1278	sp|P23083|HV102_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:4	ms_run[2]:scan=7168	37.912	2	1319.5452	1319.5452	R	-	107	118
PSM	SDLDYSQQQWDSK	1279	sp|A6NK89|RASFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10858	55.699	2	1598.6849	1598.6849	K	K	413	426
PSM	SDVLQPGAEVTTDDR	1280	sp|P53992-2|SC24C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9703	50.285	2	1601.7533	1601.7533	K	A	162	177
PSM	SEAEDEDDEDYVPYVPLR	1281	sp|Q9UJV9|DDX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17269	88.784	2	2139.912	2139.9120	R	Q	23	41
PSM	SEVSSDEDIQFR	1282	sp|P40939|ECHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10346	53.247	2	1410.6263	1410.6263	K	L	665	677
PSM	SGTPTQDEMMDKPTSSSVDTMSLLSK	1283	sp|Q5VT52-5|RPRD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21,9-UNIMOD:35,10-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=11437	58.522	3	2900.2014	2900.2014	R	I	704	730
PSM	SIAEEQYSDLEK	1284	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10142	52.308	2	1410.6515	1410.6515	R	E	930	942
PSM	SQENEEDGEEDPDR	1285	sp|P49810-2|PSN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1181	8.4841	2	1647.6132	1647.6132	R	Y	49	63
PSM	SQTTTERDSDTDVEEEELPVENR	1286	sp|Q14676-4|MDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=11084	56.847	3	2758.1454	2758.1454	R	E	445	468
PSM	SQVSEEEGKEVESDK	1287	sp|P11171-7|41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=4081	23.084	2	1758.7197	1758.7197	K	E	92	107
PSM	SSEHENAYENVPEEEGK	1288	sp|Q13113|PDZ1I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=6913	36.629	2	2026.7793	2026.7793	R	V	92	109
PSM	SSPPAPPLPPGSGSPGTPQALPR	1289	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=14454	73.648	2	2244.094	2244.0940	R	R	585	608
PSM	SSPVDLVTATDQK	1290	sp|P29218-2|IMPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11960	61.054	2	1359.6882	1359.6882	K	V	37	50
PSM	STAELEAEELEK	1291	sp|Q9ULW0|TPX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10654	54.722	2	1347.6406	1347.6406	K	L	385	397
PSM	SVEDDEEGHLICQSGDVLSAR	1292	sp|P49759|CLK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=16381	83.715	3	2394.9999	2394.9999	R	Y	140	161
PSM	SYEDLTESEDGAASGDSHK	1293	sp|Q86VX9-5|MON1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=8012	42.184	2	2076.7797	2076.7797	R	E	56	75
PSM	TEEIAEEEETVFPK	1294	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15592	79.535	2	1649.7672	1649.7672	K	A	41	55
PSM	TEELEEESFPER	1295	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11339	58.046	2	1493.6522	1493.6522	K	S	487	499
PSM	TGLYNYYDDEK	1296	sp|P50454|SERPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11444	58.554	2	1379.5881	1379.5881	R	E	240	251
PSM	TTPPVLDSDGSFFLYSK	1297	sp|P01857|IGHG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=20910	111.92	2	1872.9145	1872.9145	K	L	276	293
PSM	TVEEIEACMAGCDK	1298	sp|P12955-3|PEPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:4,9-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6707	35.611	2	1627.6528	1627.6528	R	A	407	421
PSM	TVFPGAVPVLPASPPPK	1299	sp|Q9UBC2-4|EP15R_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:21	ms_run[2]:scan=18754	97.504	2	1752.9216	1752.9216	K	D	217	234
PSM	VAEEDEDDDGGIMMR	1300	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=3788	21.647	2	1712.6505	1712.6505	K	S	751	766
PSM	VDEDSAEDTQSNDGKEVVEVGQK	1301	sp|Q9H2G2-2|SLK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=7436	39.224	3	2557.0705	2557.0705	K	L	561	584
PSM	VDVEVPDVSLEGPEGK	1302	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17072	87.64	3	1667.8254	1667.8254	K	L	1290	1306
PSM	VEEEAWDLDVK	1303	sp|Q8TER5-2|ARH40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15195	77.462	2	1331.6245	1331.6245	R	Q	734	745
PSM	VENCPDELYDIMK	1304	sp|P07948-2|LYN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=12873	65.675	2	1640.7062	1640.7062	R	M	444	457
PSM	VILLDGSEYTCDVEK	1305	sp|Q9Y2J2-4|E41L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:4	ms_run[2]:scan=16451	84.08	2	1739.8288	1739.8288	K	R	114	129
PSM	VLAVNQENEQLMEDYEK	1306	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:35	ms_run[2]:scan=12850	65.553	3	2066.9467	2066.9467	K	L	265	282
PSM	VQALEEANNDLENK	1307	sp|P35527|K1C9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10216	52.643	2	1585.7584	1585.7584	K	I	171	185
PSM	VTDTDFDGVEVR	1308	sp|Q6PIU2|NCEH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12129	61.881	2	1351.6256	1351.6256	K	V	82	94
PSM	VTPDIEESLLEPENEK	1309	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=17838	92.067	2	1840.8942	1840.8942	K	I	200	216
PSM	YDIEDGEAIDSR	1310	sp|Q13576-3|IQGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10481	53.89	2	1381.5998	1381.5998	K	S	782	794
PSM	YDNTSPEDMPQDFK	1311	sp|O94956-3|SO2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:35	ms_run[2]:scan=7701	40.56	2	1701.6828	1701.6828	R	A	122	136
PSM	YTGEDFDEDLR	1312	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11323	57.963	2	1358.5626	1358.5626	K	T	2967	2978
PSM	EISDDEAEEEKGEK	1313	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:27,3-UNIMOD:21	ms_run[1]:scan=2651	15.918920000000002	2	1668.6395	1668.6398	K	E	224	238
PSM	NPDDITQEEYGEFYK	1314	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=16200	82.71733666666667	2	1847.778480	1846.789740	R	S	292	307
PSM	DVDEIEAWISEK	1315	sp|Q13813|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=21530	116.39483500000001	2	1433.675751	1432.672190	R	L	1559	1571
PSM	GGTMTDLDEQEDESMETTGKDEDENSTGNK	1316	sp|Q8TAQ2|SMRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:35,14-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=5324	29.12714166666667	3	3375.253453	3374.244696	K	G	374	404
PSM	CDPHEATCYDDGK	1317	sp|P02751|FINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=5465	29.767176666666668	2	1549.5472	1549.5444	K	T	2288	2301
PSM	ETAPAETATPAPVEKSPAK	1318	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	16-UNIMOD:21	ms_run[1]:scan=5099	28.002828333333333	2	1973.9378	1973.9342	S	K	3	22
PSM	DDDDIDLFGSDDEEESEEAKR	1319	sp|P24534|EF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	10-UNIMOD:21	ms_run[1]:scan=15931	81.30110333333333	3	2508.939595	2507.933713	K	L	97	118
PSM	DLDDIEDENEQLK	1320	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=13081	66.69538666666666	2	1576.728141	1574.694776	R	Q	313	326
PSM	DTDDVPMILVGNK	1321	sp|P61224|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	7-UNIMOD:35	ms_run[1]:scan=17453	89.79742333333333	2	1431.709007	1431.691546	K	C	105	118
PSM	SETAPAAPAAPAPAEKTPVK	1322	sp|P10412|H14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8213	43.17371333333334	2	2024.9845	2024.9815	M	K	2	22
PSM	EAAVGVPPPAQPAPGEPTPPAPPSPDWTSSSR	1323	sp|Q8IV56|PRR15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	24-UNIMOD:21	ms_run[1]:scan=16635	85.11744666666667	3	3227.504622	3226.497224	K	E	26	58
PSM	LTVENSPKQEAGISEGQGTAGEEEEK	1324	sp|O43583|DENR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:21	ms_run[1]:scan=9537	49.480109999999996	3	2797.220971	2796.233859	K	K	68	94
PSM	QDENDDDDDWNPCK	1325	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28,13-UNIMOD:4	ms_run[1]:scan=11017	56.50234833333333	2	1748.5952	1747.5902	K	A	333	347
PSM	SSPPAPPLPPGSGSPGTPQALPR	1326	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	2-UNIMOD:21	ms_run[1]:scan=14780	75.314625	3	2245.099736	2244.093998	R	R	585	608
PSM	ANAMLDEDEDER	1327	sp|Q9BSL1|UBAC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:35	ms_run[1]:scan=2751	16.458879999999997	2	1423.566882	1422.556903	K	V	180	192
PSM	VGDDVEFEVSSDR	1328	sp|O75534|CSDE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=11536	58.98632833333333	2	1452.637991	1452.636868	K	R	65	78
PSM	GEDEEENNLEVR	1329	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=6143	33.01636	2	1431.613640	1431.611381	K	E	90	102
PSM	ATSEEDVSIKSPICEK	1330	sp|Q5UIP0|RIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	11-UNIMOD:21,14-UNIMOD:4	ms_run[1]:scan=9084	47.35637	2	1871.810424	1871.822376	K	Q	1606	1622
PSM	EDEISLEDLIER	1331	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=21295	114.67709166666667	2	1458.700598	1459.704219	K	E	227	239
PSM	SYESSEDCSEAAGSPAR	1332	sp|Q6P6C2|ALKB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	8-UNIMOD:4	ms_run[1]:scan=3656	21.032238333333332	2	1801.683200	1801.706086	K	K	371	388
PSM	AAEEEDEADPK	1333	sp|P20962|PTMS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=903	7.2023	2	1202.4939	1202.4939	R	R	82	93
PSM	AEAELCAEAEETR	1334	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4	ms_run[2]:scan=7978	41.965	2	1477.6355	1477.6355	R	G	915	928
PSM	ASDLEDEESAAR	1335	sp|Q86VM9-2|ZCH18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4891	26.979	2	1291.5528	1291.5528	R	G	45	57
PSM	ATDAEADVASLNR	1336	sp|P07951|TPM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8940	46.667	2	1331.6317	1331.6317	K	R	78	91
PSM	AVSPPHLDGPPSPR	1337	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=11245	57.602	2	1585.6691	1585.6691	K	S	516	530
PSM	CTEDMTEDELR	1338	sp|Q13148|TADBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:4,5-UNIMOD:35	ms_run[2]:scan=4490	25.036	2	1413.5388	1413.5388	R	E	198	209
PSM	CTESEEEEVTK	1339	sp|P54578-2|UBP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:4	ms_run[2]:scan=2240	13.792	2	1339.5449	1339.5449	K	G	222	233
PSM	DADLTDTAQTR	1340	sp|Q13630|FCL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3809	21.736	2	1205.5524	1205.5524	K	A	45	56
PSM	DAHDVSPTSTDTEAQLTVER	1341	sp|Q8IVF2-3|AHNK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=11077	56.814	3	2250.9642	2250.9642	R	Q	189	209
PSM	DDATPVRDEPMDAESITFK	1342	sp|Q7Z6E9-2|RBBP6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=13421	68.448	3	2231.9294	2231.9294	R	S	947	966
PSM	DDDEGPVSNQGYMPYLNR	1343	sp|Q9UH65|SWP70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:35	ms_run[2]:scan=12762	65.131	3	2084.8745	2084.8745	R	F	58	76
PSM	DDGSTLMEIDGDK	1344	sp|O96019-2|ACL6A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12566	64.141	2	1394.5871	1394.5871	R	G	6	19
PSM	DEDEGIPSENEEEKK	1345	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=4734	26.168	2	1826.7095	1826.7095	R	M	2318	2333
PSM	DEDFSPDGGYIPR	1346	sp|O95881|TXD12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13998	71.284	2	1466.6314	1466.6314	K	I	102	115
PSM	DICEEQVNSLPGSITK	1347	sp|P01024|CO3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4	ms_run[2]:scan=14271	72.621	2	1788.8564	1788.8564	K	A	1156	1172
PSM	DIDSEKEAAMEAEIK	1348	sp|O14776-2|TCRG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=9450	49.073	2	1773.738	1773.7380	K	A	614	629
PSM	DIEISTEEEKDTGDLK	1349	sp|Q4G0J3|LARP7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=11552	59.084	2	1900.8191	1900.8191	R	D	333	349
PSM	DIISIAEDEDLR	1350	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16737	85.724	2	1387.6831	1387.6831	R	V	178	190
PSM	DLEAPEVQESYR	1351	sp|P46379-2|BAG6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11157	57.188	2	1434.6627	1434.6627	R	Q	1082	1094
PSM	DLEVVEGSAAR	1352	sp|Q15746-4|MYLK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8228	43.247	2	1144.5724	1144.5724	R	F	1697	1708
PSM	DMNQVLDAYENK	1353	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:35	ms_run[2]:scan=10689	54.874	2	1454.6348	1454.6348	R	K	142	154
PSM	DNFTAIPEGTNGVEER	1354	sp|Q14195|DPYL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12636	64.511	2	1747.8013	1747.8013	K	M	346	362
PSM	DPDAQPGGELMLGGTDSK	1355	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=14497	73.861	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1356	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=20088	106.24	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1357	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=20397	108.36	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDMVQNTVSELIK	1358	sp|Q16698-2|DECR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35	ms_run[2]:scan=18847	98.07	2	1603.7763	1603.7763	R	V	111	125
PSM	DQGTYEDYVEGLR	1359	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16213	82.792	2	1543.6791	1543.6791	K	V	82	95
PSM	DQQPSGSEGEDDDAEAALKK	1360	sp|Q9NXG2|THUM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=6910	36.612	2	2168.8747	2168.8747	K	E	82	102
PSM	DQYELLCLDNTR	1361	sp|P02787|TRFE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:4	ms_run[2]:scan=17378	89.375	2	1538.7035	1538.7035	R	K	240	252
PSM	DSDDVPMVLVGNK	1362	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=12145	61.954	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDYAQLCNIPVTGR	1363	sp|Q14766-3|LTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:4	ms_run[2]:scan=15781	80.533	2	1822.8156	1822.8156	K	R	1190	1206
PSM	DSDQVAQSDGEESPAAEEQLLGEHIK	1364	sp|O94979-3|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:21	ms_run[2]:scan=16362	83.605	3	2861.224	2861.2240	K	E	520	546
PSM	DSISAVSSEKVSPSK	1365	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=6375	34.097	2	1599.7393	1599.7393	K	S	1241	1256
PSM	DTDDVPMILVGNK	1366	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=17641	90.911	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1367	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=18354	95.037	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1368	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=19177	100.17	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1369	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=19429	101.8	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1370	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=20511	109.16	2	1431.6915	1431.6915	K	C	86	99
PSM	DTTSDKDDSLGSQQTNEQCAQK	1371	sp|P23497-7|SP100_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=2993	17.717	3	2535.0068	2535.0068	K	A	185	207
PSM	DTTVISHSPNTSYDTALEAR	1372	sp|Q4VCS5-2|AMOT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=12868	65.65	3	2256.99	2256.9900	R	I	298	318
PSM	DYDEEEQGYDSEKEK	1373	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=3165	18.54	2	1942.6993	1942.6993	R	K	423	438
PSM	DYEAGQLYGLEK	1374	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14024	71.405	2	1384.6511	1384.6511	K	F	904	916
PSM	EADGSETPEPFAAEAK	1375	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9962	51.479	2	1647.7264	1647.7264	R	F	234	250
PSM	EADLTEETEENLR	1376	sp|Q5T7N2|LITD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11432	58.496	2	1547.6951	1547.6951	K	S	606	619
PSM	EAEGEQFVEEALEK	1377	sp|O14879|IFIT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18832	97.965	2	1606.7362	1606.7362	K	S	223	237
PSM	EALELTDTGLLSGSEER	1378	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18359	95.062	2	1818.8847	1818.8847	K	V	1302	1319
PSM	EALEVDWSSEK	1379	sp|Q9UBE0-2|SAE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13372	68.203	2	1291.5932	1291.5932	K	A	218	229
PSM	EALPAPSDDATALMTDPK	1380	sp|P07203|GPX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:35	ms_run[2]:scan=12208	62.304	2	1857.8666	1857.8666	R	L	131	149
PSM	EASALDFDVTDNR	1381	sp|O75581|LRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14273	72.633	2	1451.6529	1451.6529	K	I	663	676
PSM	EDDSYLFDLDNK	1382	sp|Q96KQ7-2|EHMT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17718	91.385	2	1472.6307	1472.6307	R	D	1047	1059
PSM	EDEIATMECINNGK	1383	sp|P49189-2|AL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=6362	34.03	2	1638.6865	1638.6865	R	S	18	32
PSM	EEFAIMQTPAGELYDK	1384	sp|Q92616|GCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35	ms_run[2]:scan=16603	84.947	2	1856.8502	1856.8502	R	S	761	777
PSM	EEGEEGEEECGR	1385	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4	ms_run[2]:scan=862	7.0226	2	1408.5049	1408.5049	K	D	1350	1362
PSM	EESLVEELSPASEK	1386	sp|Q9BXK5-4|B2L13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16385	83.734	2	1545.741	1545.7410	R	K	256	270
PSM	EEVVGGDDSDGLR	1387	sp|P25490|TYY1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6696	35.547	2	1346.595	1346.5950	R	A	110	123
PSM	EGEEPTVYSDEEEPKDESAR	1388	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=7225	38.198	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1389	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=7434	39.219	2	2374.9326	2374.9326	K	K	121	141
PSM	EISDDEAEEEKGEK	1390	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=2932	17.411	2	1686.6509	1686.6509	K	E	224	238
PSM	EIVEMNEIEEGK	1391	sp|Q9H2G2-2|SLK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=7881	41.392	2	1434.6548	1434.6548	K	N	604	616
PSM	EIVEMNEIEEGK	1392	sp|Q9H2G2-2|SLK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=8055	42.406	2	1434.6548	1434.6548	K	N	604	616
PSM	ELAETIAADDGTDPR	1393	sp|O75153|CLU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10218	52.651	2	1572.7267	1572.7267	K	S	679	694
PSM	ELEPEAAEEALENGPK	1394	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16375	83.683	2	1724.8105	1724.8105	K	E	348	364
PSM	EQSHAEISPPAESGQAVEECK	1395	sp|Q02952-3|AKA12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=8645	45.286	3	2361.9784	2361.9784	R	E	141	162
PSM	ESEDDLNKESEEEVGPTK	1396	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=5773	31.305	2	2113.8576	2113.8576	K	E	520	538
PSM	ESTVFEDLSDEAER	1397	sp|P02788-2|TRFL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17726	91.422	2	1625.7057	1625.7057	R	D	186	200
PSM	ETAEADVASLNR	1398	sp|P09493-2|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8469	44.42	2	1274.6103	1274.6103	R	R	23	35
PSM	ETENDDLTNVIQK	1399	sp|O95373|IPO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11180	57.294	2	1517.7209	1517.7209	R	M	552	565
PSM	ETEVIDPQDLLEGR	1400	sp|P31431|SDC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=19768	104.1	2	1612.7944	1612.7944	R	Y	23	37
PSM	ETNLDSLPLVDTHSK	1401	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21	ms_run[2]:scan=16323	83.418	2	1747.803	1747.8030	R	R	425	440
PSM	ETTCSKESNEELTESCETK	1402	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21,4-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=3074	18.084	2	2340.8975	2340.8975	R	K	289	308
PSM	ETVEEQVSTTER	1403	sp|Q13619-2|CUL4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6666	35.417	2	1406.6525	1406.6525	K	V	576	588
PSM	EVAEAYEVLSDK	1404	sp|P25686-2|DNJB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13552	69.054	2	1351.6507	1351.6507	K	H	48	60
PSM	EVTDMNLNVINEGGIDK	1405	sp|Q96TA1-2|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=14055	71.559	2	1875.8884	1875.8884	K	L	355	372
PSM	FTDEEVDELYR	1406	sp|P19105|ML12A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14819	75.513	2	1414.6252	1414.6252	R	E	133	144
PSM	FTDEEVDELYR	1407	sp|P19105|ML12A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15018	76.569	2	1414.6252	1414.6252	R	E	133	144
PSM	GAEADQIIEYLK	1408	sp|Q12904|AIMP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16583	84.832	2	1348.6874	1348.6874	K	Q	15	27
PSM	GEDIQTVNIDAR	1409	sp|Q5T5P2-3|SKT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10083	52.016	2	1329.6525	1329.6525	K	K	1091	1103
PSM	GSNTCELIFEDCK	1410	sp|P26440-2|IVD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=14265	72.592	2	1571.6596	1571.6596	R	I	220	233
PSM	GVEEEEEDGEMRE	1411	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=2584	15.56	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1412	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=2775	16.563	2	1552.5835	1552.5835	R	-	74	87
PSM	GVEEEEEDGEMRE	1413	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=3500	20.262	2	1552.5835	1552.5835	R	-	74	87
PSM	IASDEEIQGTK	1414	sp|Q8WX93-4|PALLD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3364	19.547	2	1189.5826	1189.5826	R	D	180	191
PSM	IAVAQYSDDVK	1415	sp|P12111-4|CO6A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9182	47.807	2	1207.6085	1207.6085	R	V	268	279
PSM	IDENSDKEMEVEESPEK	1416	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4407	24.625	3	2102.8239	2102.8239	K	I	495	512
PSM	IEDVGSDEEDDSGKDK	1417	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=857	7.0045	2	1816.6888	1816.6888	K	K	250	266
PSM	IEEDTENMAEK	1418	sp|Q9H9H4|VP37B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:35	ms_run[2]:scan=1091	8.0713	2	1323.55	1323.5500	K	F	117	128
PSM	IIDEDEEVEADR	1419	sp|Q8IWD4|CC117_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7323	38.682	2	1431.6365	1431.6365	R	N	156	168
PSM	ITDDMDQVELK	1420	sp|Q8WW22-3|DNJA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=7339	38.757	2	1321.6071	1321.6071	R	E	328	339
PSM	LDTDDLDEIEK	1421	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13581	69.201	2	1304.5984	1304.5984	R	I	357	368
PSM	LEDLLQDAQDEK	1422	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14132	71.923	2	1415.678	1415.6780	R	E	728	740
PSM	LEESYDMESVLR	1423	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=11227	57.514	2	1485.6657	1485.6657	K	N	276	288
PSM	LEESYDMESVLR	1424	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=11438	58.525	2	1485.6657	1485.6657	K	N	276	288
PSM	LEQLECLDDAEK	1425	sp|Q9Y5A7-2|NUB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4	ms_run[2]:scan=12479	63.726	2	1461.6657	1461.6657	R	K	294	306
PSM	LESDVSAQMEYCR	1426	sp|P02675|FIBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=6578	35.013	2	1602.6654	1602.6654	K	T	212	225
PSM	LGAAPEEESAYVAGEK	1427	sp|Q9UNZ2-6|NSF1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9699	50.266	2	1619.7679	1619.7679	R	R	46	62
PSM	LLDEEEATDNDLR	1428	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10413	53.565	2	1531.7002	1531.7002	R	A	457	470
PSM	MASPPAPSPAPPAISPIIK	1429	sp|Q00587-2|BORG5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=17017	87.33	2	1936.9733	1936.9733	R	N	99	118
PSM	MDTIDQDDELIR	1430	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:35	ms_run[2]:scan=11622	59.43	2	1478.6559	1478.6559	R	Y	1956	1968
PSM	MEDDAQVGQGEDLR	1431	sp|Q9UBI9|HDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:35	ms_run[2]:scan=5775	31.312	2	1577.6628	1577.6628	R	K	368	382
PSM	NEEDDMVEMEEER	1432	sp|P80303-2|NUCB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=3893	22.135	2	1685.6033	1685.6033	K	L	282	295
PSM	NEEPSEEEIDAPKPK	1433	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=6354	33.99	2	1790.7612	1790.7612	K	K	117	132
PSM	NSQGSEMFGDDDK	1434	sp|P15924-3|DESP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=2508	15.178	2	1444.5413	1444.5413	R	R	593	606
PSM	NVELQCLDADDAK	1435	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4	ms_run[2]:scan=10977	56.314	2	1489.6719	1489.6719	R	A	815	828
PSM	NVELQCLDADDAK	1436	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4	ms_run[2]:scan=11721	59.908	2	1489.6719	1489.6719	R	A	815	828
PSM	NVELQCLDADDAK	1437	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4	ms_run[2]:scan=12138	61.923	2	1489.6719	1489.6719	R	A	815	828
PSM	NVELQCLDADDAK	1438	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4	ms_run[2]:scan=12322	62.93	2	1489.6719	1489.6719	R	A	815	828
PSM	PAEDMEEEQAFK	1439	sp|P61978-3|HNRPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=6189	33.216	2	1438.5922	1438.5922	R	R	23	35
PSM	PVTVEPMDQLDDEEGLPEK	1440	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=13694	69.781	3	2155.9831	2155.9831	R	L	132	151
PSM	QAQAQESEEEEESR	1441	sp|Q9NVM6|DJC17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1132	8.2365	2	1648.6813	1648.6813	R	S	106	120
PSM	QCADLPEEDEELR	1442	sp|Q9P253|VPS18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:4	ms_run[2]:scan=10490	53.929	2	1602.6832	1602.6832	K	K	740	753
PSM	QEEENPAEETGEEK	1443	sp|O43768-8|ENSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2741	16.412	2	1617.6642	1617.6642	K	Q	5	19
PSM	QEMGEEEEENETFGLSR	1444	sp|Q0ZGT2-4|NEXN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35	ms_run[2]:scan=11549	59.068	2	2028.8218	2028.8218	R	E	349	366
PSM	RLEISPDSSPER	1445	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=7777	40.936	2	1544.6273	1544.6273	R	A	147	159
PSM	RLEISPDSSPER	1446	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=7974	41.944	2	1544.6273	1544.6273	R	A	147	159
PSM	SDSPTGDVLLDETLK	1447	sp|Q9H4A5-2|GLP3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17310	89.001	2	1588.7832	1588.7832	K	H	66	81
PSM	SDTSGDYEITLLK	1448	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16456	84.102	2	1440.6984	1440.6984	K	I	305	318
PSM	SDVDMDAAAEATR	1449	sp|O15085|ARHGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=3529	20.416	2	1366.5671	1366.5671	R	L	635	648
PSM	SEDFGVNEDLADSDAR	1450	sp|P04083|ANXA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13276	67.727	3	1738.7282	1738.7282	R	A	189	205
PSM	SEDGDDEEPPYR	1451	sp|O94885|SASH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=4446	24.788	2	1407.5426	1407.5426	K	G	541	553
PSM	SGDETPGSEVPGDK	1452	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3704	21.259	2	1373.5947	1373.5947	R	A	161	175
PSM	SIADSEESEAYK	1453	sp|Q9BY42|RTF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5566	30.265	2	1327.578	1327.5780	R	S	268	280
PSM	SKEDVTVSPSQEINAPPDENK	1454	sp|Q5T0W9|FA83B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=9705	50.296	3	2363.053	2363.0530	K	R	845	866
PSM	SLEDLQDEYDFK	1455	sp|P42224-2|STAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16910	86.728	2	1500.662	1500.6620	K	C	162	174
PSM	SSEDPNEDIVER	1456	sp|P01591|IGJ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5979	32.257	2	1388.6056	1388.6056	R	N	47	59
PSM	SSEEVDGQHPAQEEVPESPQTSGPEAENR	1457	sp|Q6JBY9|CPZIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=9100	47.425	3	3199.3215	3199.3215	R	C	267	296
PSM	SSPPAPPLPPGSGSPGTPQALPR	1458	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=14654	74.671	2	2244.094	2244.0940	R	R	585	608
PSM	STSLETQDDDNIR	1459	sp|Q6IA86-4|ELP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5935	32.035	2	1492.6641	1492.6641	K	L	242	255
PSM	STVTGERQSGDGQESTEPVENK	1460	sp|O15234|CASC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=3148	18.451	3	2414.0235	2414.0235	K	V	140	162
PSM	SVTNEDVTQEELGGAK	1461	sp|P05166|PCCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8908	46.517	2	1675.7901	1675.7901	K	T	233	249
PSM	SVVSDLEADDVK	1462	sp|P11388|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13921	70.929	2	1275.6194	1275.6194	K	G	1374	1386
PSM	SYTITGLQPGTDYK	1463	sp|P02751-12|FINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13826	70.449	2	1542.7566	1542.7566	R	I	1545	1559
PSM	TAEEEELAEEK	1464	sp|Q76FK4-2|NOL8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5225	28.628	2	1276.5671	1276.5671	K	K	834	845
PSM	TAVVVGTITDDVR	1465	sp|Q07020-2|RL18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13632	69.465	2	1344.7249	1344.7249	K	V	50	63
PSM	TDDYLDQPCYETINR	1466	sp|P50395-2|GDIB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:4	ms_run[2]:scan=13896	70.812	2	1901.8102	1901.8102	R	I	149	164
PSM	TEQGPQVDETQFK	1467	sp|P05091-2|ALDH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8320	43.708	2	1505.6998	1505.6998	K	K	309	322
PSM	TGQEVVFVAEPDNK	1468	sp|P04844-2|RPN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11445	58.557	2	1531.7518	1531.7518	K	N	411	425
PSM	TGSTPSIASTHSELSTYSNNSGNAAVIK	1469	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=14717	75.011	3	2873.308	2873.3080	R	Y	797	825
PSM	TGTAEMSSILEER	1470	sp|P25705-3|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35	ms_run[2]:scan=8737	45.698	2	1438.661	1438.6610	K	I	46	59
PSM	TNLDESDVQPVK	1471	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7267	38.418	2	1343.6569	1343.6569	R	E	129	141
PSM	TRSPSPDDILER	1472	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=11710	59.859	2	1544.6273	1544.6273	R	V	576	588
PSM	TSPVEGLSGNPADLEK	1473	sp|P23634-5|AT2B4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13332	68.001	2	1612.7944	1612.7944	K	R	60	76
PSM	TYSMICLAIDDDDKTDK	1474	sp|Q8IUC4-2|RHPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,4-UNIMOD:35,6-UNIMOD:4	ms_run[2]:scan=15922	81.261	3	2098.8476	2098.8476	K	T	463	480
PSM	VAVEEVDEEGK	1475	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5085	27.938	2	1202.5667	1202.5667	R	F	440	451
PSM	VDATEESDLAQQYGVR	1476	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13898	70.824	3	1779.8275	1779.8275	K	G	82	98
PSM	VDDDFTAQDYR	1477	sp|Q8IUI8-2|CRLF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=9697	50.26	2	1343.563	1343.5630	K	L	198	209
PSM	VDINTEDLEDGTCR	1478	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:4	ms_run[2]:scan=10985	56.351	2	1635.7046	1635.7046	K	V	2082	2096
PSM	VDPSLMEDSDDGPSLPTK	1479	sp|O15258|RER1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14456	73.655	2	1901.8564	1901.8564	K	Q	87	105
PSM	VDVSCEPLEGVEK	1480	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:4	ms_run[2]:scan=11922	60.885	2	1459.6865	1459.6865	R	C	768	781
PSM	VEEEAAPSIFDEPLER	1481	sp|P29536-2|LMOD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=18376	95.154	2	1829.8683	1829.8683	K	V	281	297
PSM	VELVTGEEDEK	1482	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6587	35.062	2	1246.5929	1246.5929	K	V	2023	2034
PSM	VETVSQPSESPKDTIDK	1483	sp|Q99590-2|SCAFB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=5534	30.123	2	1938.8823	1938.8823	K	T	452	469
PSM	VEVDTFMEAYDQK	1484	sp|Q9Y3A4|RRP7A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35	ms_run[2]:scan=13234	67.49	2	1589.6919	1589.6919	R	I	171	184
PSM	VFCVEEEDSESSLQK	1485	sp|Q14684-2|RRP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:4	ms_run[2]:scan=11613	59.385	2	1784.7775	1784.7775	R	R	366	381
PSM	VSESEGKLEGQATAVTPNK	1486	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=9185	47.824	3	2023.9463	2023.9463	K	N	12	31
PSM	WEGEDEDEDVK	1487	sp|O75822-3|EIF3J_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5072	27.878	2	1349.5259	1349.5259	R	L	39	50
PSM	WEGEDEDEDVK	1488	sp|O75822-3|EIF3J_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=5900	31.883	2	1349.5259	1349.5259	R	L	39	50
PSM	YADLTEDQLPSCESLK	1489	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:4	ms_run[2]:scan=15029	76.626	2	1867.851	1867.8510	R	D	142	158
PSM	YALYDATYETK	1490	sp|Q9Y281-3|COF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=12118	61.834	2	1336.6187	1336.6187	R	E	65	76
PSM	YDLDGDASMAK	1491	sp|Q9UHD2|TBK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:35	ms_run[2]:scan=5463	29.756	2	1200.4969	1200.4969	R	A	406	417
PSM	YEATIADMEDR	1492	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:35	ms_run[2]:scan=5860	31.701	2	1328.5554	1328.5554	K	L	1049	1060
PSM	YSGSEGSTQTLTK	1493	sp|P25815|S100P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3187	18.659	2	1357.6361	1357.6361	R	G	18	31
PSM	YYDVMSDEEIER	1494	sp|O15460-2|P4HA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35	ms_run[2]:scan=10190	52.523	2	1563.6399	1563.6399	R	I	341	353
PSM	LFEESDDKEDEDADGK	1495	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	5-UNIMOD:21	ms_run[1]:scan=6476	34.55385	3	1920.719117	1920.714994	K	E	672	688
PSM	TEELEEESFPER	1496	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=11442	58.54297333333333	2	1493.653612	1493.652183	K	S	487	499
PSM	NKPGPNIESGNEDDDASFK	1497	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	9-UNIMOD:21	ms_run[1]:scan=9755	50.54511333333333	2	2113.844141	2112.863724	K	I	206	225
PSM	ASDLEDEESAAR	1498	sp|Q86VM9|ZCH18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=4866	26.844971666666666	2	1291.554182	1291.552804	R	G	45	57
PSM	VNGDASPAAAESGAK	1499	sp|P29966|MARCS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=2426	14.74156	2	1344.616744	1343.631723	K	E	41	56
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	1500	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	22-UNIMOD:21	ms_run[1]:scan=7902	41.47375833333333	3	3062.339618	3061.351348	K	G	56	88
PSM	GNAEGSSDEEGKLVIDEPAK	1501	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:21	ms_run[1]:scan=10118	52.19141333333334	2	2124.932140	2123.925989	K	E	127	147
PSM	LEGALGADTTEDGDEK	1502	sp|Q9NZM1|MYOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=6569	34.97425	2	1619.720021	1619.716240	K	S	1094	1110
PSM	TGIEQGSDAGYLCESQK	1503	sp|P40939|ECHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	13-UNIMOD:4	ms_run[1]:scan=9970	51.52146166666667	2	1842.827358	1841.810158	K	F	310	327
PSM	CTSHSETPTVDDEEK	1504	sp|O95425|SVIL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:21	ms_run[1]:scan=7443	39.258113333333334	2	1796.6501	1796.6443	R	V	671	686
PSM	PDAQPGGELMLGGTDSK	1505	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	10-UNIMOD:35	ms_run[1]:scan=9931	51.34404	2	1687.7737	1687.7718	D	Y	237	254
PSM	PDAQPGGELMLGGTDSK	1506	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	10-UNIMOD:35	ms_run[1]:scan=9766	50.595485	3	1687.7711	1687.7718	D	Y	237	254
PSM	QDTEEDEEEDEKDK	1507	sp|Q9Y266|NUDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1749	11.315625	2	1720.6449	1720.6430	K	G	143	157
PSM	LDTDDLDEIEK	1508	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=13294	67.81722666666667	2	1304.600341	1304.598357	R	I	465	476
PSM	LDTDDLDEIEK	1509	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=13505	68.82784833333332	2	1305.624448	1304.598357	R	I	465	476
PSM	YLTESYGTGQDIDDR	1510	sp|Q9UM54|MYO6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=11211	57.44121666666666	2	1732.747128	1731.758774	R	I	167	182
PSM	QVAEAYEVLSDAK	1511	sp|O75190|DNJB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=20971	112.36139833333334	2	1404.6779	1404.6768	K	K	48	61
PSM	DTTVISHSPNTSYDTALEAR	1512	sp|Q4VCS5|AMOT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	11-UNIMOD:21	ms_run[1]:scan=13051	66.527225	3	2257.978245	2256.989987	R	I	707	727
PSM	ELQEMDKDDESLIK	1513	sp|P52566|GDIR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:27,5-UNIMOD:35	ms_run[1]:scan=12358	63.11574833333333	2	1689.7782	1689.7762	K	Y	34	48
PSM	DADDAEQAFER	1514	sp|O43586|PPIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=9082	47.344546666666666	2	1264.511620	1265.516024	R	I	150	161
PSM	YYSPCEEHPAETNQNEGAESGTIR	1515	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=9085	47.35968666666666	3	2819.107617	2818.117783	R	Q	182	206
PSM	GVDEDDPVNSAYNMK	1516	sp|Q96JI7|SPTCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	14-UNIMOD:35	ms_run[1]:scan=8360	43.90868	2	1668.697290	1668.693731	K	L	312	327
PSM	LESIDNHSSTGGQSDQGYGSK	1517	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:21	ms_run[1]:scan=6339	33.90978166666667	2	2246.901770	2245.912465	R	D	951	972
PSM	DEEMIGPIIDK	1518	sp|Q9NTK5|OLA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=14965	76.29806500000001	2	1258.592985	1258.611504	K	L	156	167
PSM	GSMPAYSGNNMDKSDSELNSEVAAR	1519	sp|Q53TN4|CYBR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:35,11-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=8884	46.397215	3	2742.083063	2741.094605	R	K	247	272
PSM	DTDDVPMILVGNK	1520	sp|P61224|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=17944	92.63906	2	1414.695758	1415.696631	K	C	105	118
PSM	LTGDVEELEIQEK	1521	sp|Q9UKF6|CPSF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=13613	69.36190833333333	2	1500.744351	1501.751169	K	P	533	546
PSM	DPDAQPGGELMLGGTDSK	1522	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=10510	54.01149833333333	2	1787.776593	1786.804344	R	Y	236	254
PSM	LESIDNHSSTGGQSDQGYGSK	1523	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:21	ms_run[1]:scan=6193	33.23450666666667	3	2246.903565	2245.912465	R	D	951	972
PSM	ESEDKPEIEDVGSDEEEEKK	1524	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	13-UNIMOD:21	ms_run[1]:scan=9585	49.727781666666665	3	2398.944488	2399.974122	K	D	251	271
PSM	AAEDDEDDDVDTK	1525	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2500	15.128	2	1436.5427	1436.5427	R	K	90	103
PSM	AAKPGPAEAPSPTASPSGDASPPATAPYDPR	1526	sp|Q9UPT8|ZC3H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=10807	55.455	3	3090.3373	3090.3373	R	V	1094	1125
PSM	AAYEAELGDAR	1527	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7147	37.812	2	1164.5411	1164.5411	K	K	79	90
PSM	ADAEEEAATR	1528	sp|Q13409-6|DC1I2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1256	8.8643	2	1061.4625	1061.4625	R	I	599	609
PSM	ADLEGSLDSK	1529	sp|Q15031|SYLM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6447	34.424	2	1033.4928	1033.4928	K	I	364	374
PSM	ADPEAAWEPTEAEAR	1530	sp|Q9UBT2-2|SAE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12357	63.112	2	1641.7271	1641.7271	R	A	115	130
PSM	AEDELLDLQDK	1531	sp|Q86V48-2|LUZP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14234	72.435	2	1287.6194	1287.6194	K	V	40	51
PSM	AEFEDQDDEAR	1532	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4007	22.687	2	1323.5215	1323.5215	R	V	864	875
PSM	AEFEDQDDEAR	1533	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4242	23.859	2	1323.5215	1323.5215	R	V	864	875
PSM	AEGAATEEEGTPK	1534	sp|P80723-2|BASP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1212	8.6523	2	1288.5783	1288.5783	K	E	26	39
PSM	AEIIDQDLYER	1535	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13600	69.291	2	1363.662	1363.6620	K	L	575	586
PSM	AELFTQSCADLDK	1536	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:4	ms_run[2]:scan=13116	66.87	2	1496.6817	1496.6817	K	W	1382	1395
PSM	AELMEISEDK	1537	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10622	54.578	2	1163.538	1163.5380	K	T	77	87
PSM	AEQEEMEVEER	1538	sp|P78356|PI42B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=2496	15.108	2	1393.5667	1393.5667	R	A	291	302
PSM	AGGDEDGEELEK	1539	sp|Q96L93-6|KI16B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2625	15.76	2	1247.5154	1247.5154	R	A	809	821
PSM	AGGEELDEGVAK	1540	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4709	26.044	2	1173.5513	1173.5513	R	D	635	647
PSM	ANAMLDEDEDER	1541	sp|Q9BSL1|UBAC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35	ms_run[2]:scan=2690	16.118	2	1422.5569	1422.5569	K	V	180	192
PSM	ASDAEGDVAALNR	1542	sp|P67936-2|TPM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7774	40.921	2	1287.6055	1287.6055	K	R	78	91
PSM	ATDGVTLTGINQTGDQSLPSKPSSVSSYEK	1543	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	23-UNIMOD:21	ms_run[2]:scan=15680	80.013	3	3146.4656	3146.4656	K	T	320	350
PSM	ATQQAEQLSNELATER	1544	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12319	62.917	3	1787.865	1787.8650	K	S	1762	1778
PSM	AVGEIVQDYDSDK	1545	sp|Q86YQ8-2|CPNE8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9333	48.469	2	1437.6624	1437.6624	K	M	15	28
PSM	AVSPPHLDGPPSPR	1546	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=10834	55.588	2	1585.6691	1585.6691	K	S	516	530
PSM	CESGFIEELPEETR	1547	sp|Q9BV68-2|RN126_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:4	ms_run[2]:scan=16192	82.675	2	1694.7458	1694.7458	R	S	32	46
PSM	DADDAEQAFER	1548	sp|O43586-2|PPIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8176	42.997	2	1265.516	1265.5160	R	I	150	161
PSM	DADDAEQAFER	1549	sp|O43586-2|PPIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8382	44.005	2	1265.516	1265.5160	R	I	150	161
PSM	DADDAEQAFER	1550	sp|O43586-2|PPIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8592	45.021	2	1265.516	1265.5160	R	I	150	161
PSM	DADDAVYELDGK	1551	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12677	64.718	2	1309.5674	1309.5674	R	E	49	61
PSM	DAQELYAAGENR	1552	sp|P50995-2|ANX11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7655	40.337	2	1335.6055	1335.6055	R	L	327	339
PSM	DCDLQEDACYNCGR	1553	sp|P62633-7|CNBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4,9-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=7856	41.275	3	1774.6345	1774.6345	K	G	49	63
PSM	DDATPVRDEPMDAESITFK	1554	sp|Q7Z6E9-2|RBBP6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=13325	67.973	2	2231.9294	2231.9294	R	S	947	966
PSM	DDLYAEQMER	1555	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=5115	28.081	2	1284.5292	1284.5292	R	E	761	771
PSM	DEDEDIQSILR	1556	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15590	79.528	2	1331.6205	1331.6205	K	T	80	91
PSM	DEDVFVCESR	1557	sp|Q86U86-5|PB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:4	ms_run[2]:scan=9797	50.732	2	1254.5187	1254.5187	R	Y	1053	1063
PSM	DEENTANSFLNYR	1558	sp|Q12864|CAD17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15339	78.228	2	1571.6852	1571.6852	R	I	368	381
PSM	DEFTNTCPSDK	1559	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:4	ms_run[2]:scan=4329	24.266	2	1312.5241	1312.5241	R	E	228	239
PSM	DEVLEVLEDGR	1560	sp|Q9H6S3-2|ES8L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16341	83.499	2	1272.6198	1272.6198	K	Q	128	139
PSM	DEVLEVLEDGR	1561	sp|Q9H6S3-2|ES8L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18240	94.371	2	1272.6198	1272.6198	K	Q	128	139
PSM	DFDGEDSDSPR	1562	sp|Q5VT25-3|MRCKA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3663	21.066	2	1238.4687	1238.4687	R	H	1591	1602
PSM	DFSAEYEEDGK	1563	sp|P04114|APOB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8043	42.354	2	1288.5095	1288.5095	R	Y	3953	3964
PSM	DGIEPMWEDEK	1564	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=11419	58.436	2	1363.5602	1363.5602	K	N	96	107
PSM	DIDDLELTLAK	1565	sp|A7E2Y1|MYH7B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18804	97.785	2	1244.65	1244.6500	K	A	1002	1013
PSM	DIISDTSGDFR	1566	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14179	72.16	2	1224.5622	1224.5622	K	K	158	169
PSM	DIVVQETMEDIDK	1567	sp|O43852-15|CALU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=11555	59.099	2	1549.7182	1549.7182	K	N	39	52
PSM	DLDDIEDENEQLK	1568	sp|Q96IZ0|PAWR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12747	65.064	3	1574.6948	1574.6948	R	Q	313	326
PSM	DLIQDQNMDEK	1569	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=4919	27.136	2	1363.5926	1363.5926	R	G	127	138
PSM	DLQFVEVTDVK	1570	sp|P02751-12|FINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17099	87.8	2	1291.666	1291.6660	R	V	912	923
PSM	DPDAQPGGELMLGGTDSK	1571	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=11663	59.629	3	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1572	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12982	66.184	3	1786.8043	1786.8043	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1573	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14468	73.718	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPTGMDPDDIWQLSSSLK	1574	sp|Q15005|SPCS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35	ms_run[2]:scan=20888	111.77	2	2019.9095	2019.9095	K	R	147	165
PSM	DQDNMQAELNR	1575	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6725	35.699	2	1332.5728	1332.5728	R	L	466	477
PSM	DQLDEAWTDER	1576	sp|Q63HR2-5|TNS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12775	65.196	2	1376.5844	1376.5844	K	F	277	288
PSM	DSDDYAQLCNIPVTGR	1577	sp|Q14766-3|LTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:4	ms_run[2]:scan=15390	78.475	2	1822.8156	1822.8156	K	R	1190	1206
PSM	DSDEATEDFMR	1578	sp|Q16877-2|F264_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:35	ms_run[2]:scan=5778	31.328	2	1330.4983	1330.4983	R	R	183	194
PSM	DSDQVAQSDGEESPAAEEQLLGEHIK	1579	sp|O94979-3|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=16909	86.724	3	2861.224	2861.2240	K	E	520	546
PSM	DSYESYGNSR	1580	sp|P38159-2|RBMX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3466	20.076	2	1176.4683	1176.4683	R	S	270	280
PSM	DTDDVPMILVGNK	1581	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35	ms_run[2]:scan=16994	87.2	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1582	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35	ms_run[2]:scan=17810	91.912	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1583	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35	ms_run[2]:scan=18182	94.021	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1584	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35	ms_run[2]:scan=18774	97.62	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1585	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35	ms_run[2]:scan=18846	98.066	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1586	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35	ms_run[2]:scan=20803	111.2	2	1431.6915	1431.6915	K	C	86	99
PSM	DVPNPNQDDDDDEGFSFNPLK	1587	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=19163	100.06	3	2376.9982	2376.9982	K	I	523	544
PSM	DYDEEEQGYDSEKEK	1588	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=1531	10.208	2	1942.6993	1942.6993	R	K	423	438
PSM	DYEPPSPSPAPGAPPPPPQR	1589	sp|P55196-1|AFAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=9644	50.013	3	2132.9568	2132.9568	R	N	1674	1694
PSM	DYSLDEFEANK	1590	sp|Q9NZM1-2|MYOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14711	74.977	2	1329.5725	1329.5725	R	I	1662	1673
PSM	DYSNFDQEFLNEK	1591	sp|Q05655|KPCD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17945	92.643	2	1647.7053	1647.7053	R	A	629	642
PSM	EADLAAQEEAAK	1592	sp|Q9Y3B7-2|RM11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4400	24.595	2	1244.5885	1244.5885	K	K	154	166
PSM	EATTEFSVDAR	1593	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8575	44.939	2	1224.5622	1224.5622	R	A	1273	1284
PSM	EDAGDNDDTEGAIGVR	1594	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7012	37.16	2	1632.6863	1632.6863	R	N	377	393
PSM	EDSAFDEYCNK	1595	sp|Q6UB99|ANR11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:4	ms_run[2]:scan=7917	41.541	2	1376.5191	1376.5191	R	N	810	821
PSM	EEAQAEIEQYR	1596	sp|O75348|VATG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9056	47.219	2	1364.6208	1364.6208	K	L	38	49
PSM	EEAQSLEDLAGFK	1597	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17702	91.299	2	1435.6831	1435.6831	K	E	734	747
PSM	EEQEELMDFER	1598	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14800	75.413	2	1453.6031	1453.6031	R	D	576	587
PSM	EESAGAAPGEGPEGVDGR	1599	sp|Q00722-3|PLCB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4689	25.955	2	1683.7336	1683.7336	R	V	947	965
PSM	EESLDSDLYAELR	1600	sp|P02775|CXCL7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18467	95.727	2	1538.71	1538.7100	K	C	50	63
PSM	EEVVGGDDSDGLR	1601	sp|P25490|TYY1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6465	34.503	2	1346.595	1346.5950	R	A	110	123
PSM	EGCGDDNVCNSNLK	1602	sp|P23229-4|ITA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=3480	20.149	2	1580.6195	1580.6195	K	L	619	633
PSM	EGEEAGPGDPLLEAVPK	1603	sp|Q16543|CDC37_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17329	89.101	2	1706.8363	1706.8363	K	T	353	370
PSM	EGEEPTVYSDEEEPKDESAR	1604	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=4231	23.808	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1605	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=6164	33.109	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1606	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=6604	35.137	2	2374.9326	2374.9326	K	K	121	141
PSM	EGGAGAVDEDDFIK	1607	sp|O75122-2|CLAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12341	63.033	2	1421.6311	1421.6311	K	A	65	79
PSM	ELEAELEDER	1608	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9916	51.277	2	1231.5568	1231.5568	R	K	1600	1610
PSM	ENTPSEANLQEEEVR	1609	sp|Q93062-4|RBPMS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8915	46.549	2	1743.7911	1743.7911	K	T	10	25
PSM	EQEELLAPADGTVELVR	1610	sp|P19971|TYPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18282	94.62	2	1867.9527	1867.9527	R	A	377	394
PSM	EQLDNQLDAYMSK	1611	sp|Q9Y3Y2-4|CHTOP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=10817	55.5	2	1569.6981	1569.6981	K	T	168	181
PSM	ESEDKPEIEDVGSDEEEEK	1612	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:21	ms_run[2]:scan=5597	30.401	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	1613	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:21	ms_run[2]:scan=5930	32.013	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	1614	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:21	ms_run[2]:scan=6731	35.73	2	2271.8792	2271.8792	K	K	251	270
PSM	ESESEEAEAGAAELR	1615	sp|Q8NAF0|ZN579_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9934	51.355	3	1576.6853	1576.6853	R	A	193	208
PSM	ESLELEDPSSGLGVTK	1616	sp|P04233-2|HG2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15336	78.213	2	1659.8203	1659.8203	K	Q	209	225
PSM	ESQHIPTAEGASGSNTEEEIR	1617	sp|Q63ZY3-3|KANK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=9207	47.916	3	2320.9809	2320.9809	R	M	567	588
PSM	EVDEQMLNVQNK	1618	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10069	51.952	2	1445.682	1445.6820	K	N	325	337
PSM	EYEEEFFQNSK	1619	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13120	66.889	2	1448.6096	1448.6096	R	L	481	492
PSM	EYQACGPAEEPTCK	1620	sp|Q02817|MUC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=4573	25.413	2	1638.6654	1638.6654	R	S	4767	4781
PSM	FEDEDSDDVPR	1621	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6304	33.738	2	1322.5263	1322.5263	K	K	698	709
PSM	FEDEDSDDVPR	1622	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6517	34.746	2	1322.5263	1322.5263	K	K	698	709
PSM	FTDEEVDELYR	1623	sp|P19105|ML12A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13606	69.322	2	1414.6252	1414.6252	R	E	133	144
PSM	GAGCDTSMETACGDSK	1624	sp|Q6N022|TEN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4,8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=779	6.6027	2	1661.5967	1661.5967	R	D	827	843
PSM	GAGDGSDEEVDGKADGAEAKPAE	1625	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=1923	12.161	3	2253.8911	2253.8911	K	-	1938	1961
PSM	GDACDDDIDGDR	1626	sp|P49747-2|COMP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4	ms_run[2]:scan=2098	13.094	2	1322.4681	1322.4681	R	I	315	327
PSM	GDACDDDIDGDR	1627	sp|P49747-2|COMP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4	ms_run[2]:scan=2704	16.185	2	1322.4681	1322.4681	R	I	315	327
PSM	GDFDENLNYPEQK	1628	sp|Q9UBQ0|VPS29_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11862	60.596	2	1567.6791	1567.6791	R	V	61	74
PSM	GLSEDTTEETLK	1629	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7805	41.051	2	1321.6249	1321.6249	K	E	578	590
PSM	GTDSQAMEEEKPEGHV	1630	sp|Q13451|FKBP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=6784	35.987	2	1822.7081	1822.7081	K	-	442	458
PSM	GVEEEEEDGEMR	1631	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=1802	11.567	2	1423.5409	1423.5409	R	E	74	86
PSM	GVEEEEEDGEMRE	1632	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=4324	24.245	2	1552.5835	1552.5835	R	-	74	87
PSM	IDENSDKEMEVEESPEK	1633	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=3982	22.555	3	2102.8239	2102.8239	K	I	495	512
PSM	IEDVGSDEEDDSGKDK	1634	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=1094	8.0821	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	1635	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=1340	9.2478	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDK	1636	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=2555	15.43	2	1816.6888	1816.6888	K	K	250	266
PSM	IEEFLEETLTPEK	1637	sp|Q9NZA1-3|CLIC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18468	95.731	2	1576.7872	1576.7872	K	Y	88	101
PSM	IPDSEMLMDEGTSDEK	1638	sp|Q9Y6X4|F169A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=8369	43.948	2	1827.739	1827.7390	R	G	492	508
PSM	ISPVEESEDVSNK	1639	sp|P31431|SDC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7231	38.227	2	1431.6729	1431.6729	R	V	116	129
PSM	ITESEEVVSR	1640	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4595	25.518	2	1147.5721	1147.5721	R	E	63	73
PSM	IYEDGDDDMK	1641	sp|Q9HB71-3|CYBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:35	ms_run[2]:scan=1483	9.9607	2	1215.4601	1215.4601	K	R	155	165
PSM	IYEFPETDDEEENK	1642	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12262	62.599	3	1756.7316	1756.7316	K	L	221	235
PSM	LDTDDLDEIEK	1643	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=12990	66.222	2	1304.5984	1304.5984	R	I	357	368
PSM	LDTDDLDEIEK	1644	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13790	70.265	2	1304.5984	1304.5984	R	I	357	368
PSM	LEDLLQDAQDEK	1645	sp|Q15149-7|PLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14357	73.097	2	1415.678	1415.6780	R	E	728	740
PSM	LEGALGADTTEDGDEK	1646	sp|Q9NZM1-2|MYOF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7010	37.153	2	1619.7162	1619.7162	K	S	1052	1068
PSM	LEQYTSAIEGTK	1647	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9469	49.159	2	1338.6667	1338.6667	R	S	418	430
PSM	LFEESDDKEDEDADGK	1648	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=3291	19.176	2	1920.715	1920.7150	K	E	672	688
PSM	LGIYDADGDGDFDVDDAK	1649	sp|Q12797-10|ASPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16946	86.93	3	1899.801	1899.8010	K	V	58	76
PSM	LIIEEDTENENEK	1650	sp|Q12830-4|BPTF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8436	44.264	2	1574.7312	1574.7312	R	K	477	490
PSM	LPLLPPESPGPLR	1651	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=19263	100.73	2	1464.7742	1464.7742	R	Q	765	778
PSM	LQETEMMDPELDYTLMR	1652	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35,7-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=14437	73.552	3	2161.9218	2161.9218	K	V	866	883
PSM	LVVVDENDVVK	1653	sp|P54619-2|AAKG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11909	60.83	2	1227.6711	1227.6711	R	G	268	279
PSM	MDETDASSAVK	1654	sp|Q13148|TADBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35	ms_run[2]:scan=1276	8.9542	2	1168.4918	1168.4918	K	V	85	96
PSM	MDLDEDTAEK	1655	sp|P56937-3|DHB7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35	ms_run[2]:scan=2388	14.559	2	1181.4758	1181.4758	K	F	267	277
PSM	MTGLVDEAIDTK	1656	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35	ms_run[2]:scan=11330	58.002	2	1307.6279	1307.6279	K	S	709	721
PSM	NDDDEEEAAR	1657	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=763	6.5181	2	1162.4374	1162.4374	R	E	24	34
PSM	NDDDNDIMETLCK	1658	sp|Q96HF1|SFRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35,12-UNIMOD:4	ms_run[2]:scan=9790	50.702	2	1597.6236	1597.6236	K	N	179	192
PSM	NSLQDQLDEEMEAK	1659	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=6350	33.969	2	1664.7199	1664.7199	R	Q	1346	1360
PSM	NVELQCLDADDAK	1660	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4	ms_run[2]:scan=10762	55.234	2	1489.6719	1489.6719	R	A	815	828
PSM	QDVDDEYSMQYSAR	1661	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:35	ms_run[2]:scan=7401	39.059	2	1721.6839	1721.6839	K	G	683	697
PSM	QSQVDFDNPDYER	1662	sp|Q9NWT6|HIF1N_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10012	51.706	2	1611.6801	1611.6801	R	F	239	252
PSM	QVAEAYEVLSDAK	1663	sp|Q8WWF6|DNJB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14401	73.355	2	1421.7038	1421.7038	K	K	48	61
PSM	RLEISPDSSPER	1664	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=6258	33.528	2	1544.6273	1544.6273	R	A	147	159
PSM	RLEISPDSSPER	1665	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=6929	36.71	2	1544.6273	1544.6273	R	A	147	159
PSM	RLEISPDSSPER	1666	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=8170	42.97	2	1544.6273	1544.6273	R	A	147	159
PSM	SDADENVSASDK	1667	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=959	7.448	2	1236.5106	1236.5106	R	R	1028	1040
PSM	SDAGLESDTAMK	1668	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=2301	14.125	2	1239.5289	1239.5289	R	K	7	19
PSM	SDAPTGDVLLDEALK	1669	sp|Q9H4A6|GOLP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18703	97.19	2	1542.7777	1542.7777	K	H	124	139
PSM	SDGLPWCSTTANYDTDDR	1670	sp|P14780|MMP9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:4	ms_run[2]:scan=15707	80.149	2	2072.8382	2072.8382	R	F	250	268
PSM	SDSEDICLFTK	1671	sp|O76021|RL1D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:4	ms_run[2]:scan=14527	74.027	2	1313.5809	1313.5809	R	D	90	101
PSM	SDSPVPTAPTSGGPKPSTASAVPELATDPELEK	1672	sp|Q86U44|MTA70_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=16434	83.987	3	3312.565	3312.5650	R	K	48	81
PSM	SEAQEEIGDLK	1673	sp|Q69YQ0-2|CYTSA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8804	46.014	2	1217.5776	1217.5776	K	R	765	776
PSM	SEDAEVLDATPSGIMK	1674	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:35	ms_run[2]:scan=11984	61.165	2	1677.7767	1677.7767	K	T	782	798
PSM	SEMEVQDAELK	1675	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35	ms_run[2]:scan=5278	28.906	2	1293.5758	1293.5758	K	A	291	302
PSM	SEVLLVSEDGK	1676	sp|Q9UJ70|NAGK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10317	53.121	2	1174.6081	1174.6081	R	I	15	26
PSM	SGELQGGPDDNLIEGGGTK	1677	sp|Q96A65|EXOC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11628	59.455	2	1842.8595	1842.8595	R	F	468	487
PSM	SIPLDEGEDEAQR	1678	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8315	43.681	2	1457.6634	1457.6634	R	R	2384	2397
PSM	SIPLDEGEDEAQR	1679	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8365	43.93	2	1457.6634	1457.6634	R	R	2384	2397
PSM	SLDEADSENKEEVSPLGSK	1680	sp|Q6ZV73-2|FGD6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=9686	50.21	3	2112.91	2112.9100	R	A	1197	1216
PSM	SQEPIPDDQKVSDDDK	1681	sp|Q86UE4|LYRIC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:21	ms_run[2]:scan=5875	31.771	2	1894.7833	1894.7833	K	E	415	431
PSM	SRTSVQTEDDQLIAGQSAR	1682	sp|P26232-3|CTNA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=9875	51.09	3	2220.9413	2220.9413	R	A	651	670
PSM	SSPPAPPLPPGSGSPGTPQALPR	1683	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=15042	76.695	2	2244.094	2244.0940	R	R	585	608
PSM	SVEHVSPDTADAESGK	1684	sp|Q8TDY2-2|RBCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=4570	25.394	2	1707.6989	1707.6989	K	E	261	277
PSM	SYEDDDDMDLQPNK	1685	sp|Q9BTE3-2|MCMBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:35	ms_run[2]:scan=6038	32.535	2	1699.6519	1699.6519	R	Q	167	181
PSM	TCVADESAENCDK	1686	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=701	6.1902	2	1497.5712	1497.5712	K	S	76	89
PSM	TCVADESAENCDK	1687	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=3141	18.42	2	1497.5712	1497.5712	K	S	76	89
PSM	TDDEQFADEK	1688	sp|Q9H9S4|CB39L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3603	20.771	2	1196.4833	1196.4833	R	N	313	323
PSM	TDPTTLTDEEINR	1689	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10362	53.314	2	1503.7053	1503.7053	K	F	505	518
PSM	TEEIAEEEETVFPK	1690	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15387	78.456	2	1649.7672	1649.7672	K	A	41	55
PSM	TEGDGVYTLNNEK	1691	sp|P00738|HPT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7538	39.777	2	1438.6576	1438.6576	R	Q	119	132
PSM	TESDEKSSIALTAPDAAADPK	1692	sp|Q8NFD5-4|ARI1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=10404	53.522	3	2195.9835	2195.9835	K	E	992	1013
PSM	TFMDMDQDSEEEK	1693	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:35,5-UNIMOD:35	ms_run[2]:scan=2565	15.479	2	1635.5916	1635.5916	K	E	41	54
PSM	TGENVEDAFLEAAK	1694	sp|P61106|RAB14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=18097	93.541	2	1492.7046	1492.7046	K	K	157	171
PSM	TLSSPSLQTDGIAATPVPPPPPPK	1695	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=16982	87.136	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TLTAEEAEEEWER	1696	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14769	75.258	2	1591.7002	1591.7002	R	R	154	167
PSM	TTPSYVAFTDTER	1697	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13083	66.707	2	1486.694	1486.6940	R	L	37	50
PSM	TVSASESEDRLVAEQETEPSK	1698	sp|Q9ULG6-3|CCPG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=10060	51.917	3	2371.0428	2371.0428	K	E	184	205
PSM	VAEEDEDDDGGIMMR	1699	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4686	25.937	2	1712.6505	1712.6505	K	S	751	766
PSM	VAEVLNDPENMEK	1700	sp|Q07866-8|KLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=7290	38.531	2	1502.6923	1502.6923	R	R	506	519
PSM	VAVEEVDEEGK	1701	sp|P02545-2|LMNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5286	28.946	2	1202.5667	1202.5667	R	F	440	451
PSM	VDDPDDLGER	1702	sp|P55082-2|MFAP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5232	28.664	2	1129.4887	1129.4887	R	I	115	125
PSM	VDVDVPDVNIEGPDAK	1703	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16075	82.023	3	1680.8206	1680.8206	K	L	3186	3202
PSM	VEAPEYIPISDDPK	1704	sp|Q1ED39|KNOP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14241	72.469	2	1571.7719	1571.7719	K	A	250	264
PSM	VEELEMTEDIR	1705	sp|Q92896|GSLG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35	ms_run[2]:scan=9314	48.389	2	1378.6286	1378.6286	R	L	807	818
PSM	VEELIESEAPPK	1706	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9945	51.404	2	1339.6871	1339.6871	K	A	10	22
PSM	VGGTSDVEVNEK	1707	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3192	18.684	2	1232.5885	1232.5885	K	K	406	418
PSM	VQEQLGNDVVEK	1708	sp|O15305-2|PMM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7133	37.749	2	1356.6885	1356.6885	K	Y	52	64
PSM	VSEVEEEKEPVPQPLPSDDTR	1709	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=11679	59.704	3	2459.1105	2459.1105	R	V	447	468
PSM	VTDTDFDGVEVR	1710	sp|Q6PIU2|NCEH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=11919	60.874	2	1351.6256	1351.6256	K	V	82	94
PSM	VTVDTGVIPASEEK	1711	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10715	54.992	2	1443.7457	1443.7457	K	A	285	299
PSM	VVDSMEDEVQR	1712	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35	ms_run[2]:scan=2704	16.185	2	1321.582	1321.5820	R	R	128	139
PSM	VVETELQEGATK	1713	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6061	32.639	2	1302.6667	1302.6667	K	Q	923	935
PSM	WSLEDDDDDEDDPAEAEK	1714	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13576	69.172	3	2092.7869	2092.7869	K	E	198	216
PSM	ISDLTTNLAEEEEK	1715	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=12553	64.08362666666667	2	1590.764564	1590.762462	R	A	1008	1022
PSM	EISDDEAEEEKGEK	1716	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:27,3-UNIMOD:21	ms_run[1]:scan=2842	16.92856833333333	2	1668.6403	1668.6398	K	E	224	238
PSM	SGDETPGSEVPGDK	1717	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=3871	22.035001666666666	2	1373.596146	1373.594668	R	A	161	175
PSM	IEENSLKEEESIEGEK	1718	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:21	ms_run[1]:scan=9883	51.126825	3	1942.832165	1941.845614	K	E	1566	1582
PSM	GVITDQNSDGYCQTGTMSR	1719	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:4,17-UNIMOD:35	ms_run[1]:scan=7282	38.492195	2	2105.861746	2104.878983	R	H	46	65
PSM	DQDNMQAELNR	1720	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:35	ms_run[1]:scan=1890	11.998288333333333	2	1348.567041	1348.567743	R	L	466	477
PSM	EVEDKESEGEEEDEDEDLSK	1721	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:21	ms_run[1]:scan=5075	27.888258333333333	2	2419.902209	2418.895931	K	Y	147	167
PSM	DPDAQPGGELMLGGTDSK	1722	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	11-UNIMOD:35	ms_run[1]:scan=11275	57.74742333333333	3	1803.787179	1802.799259	R	Y	236	254
PSM	QAIPLDENEGIYVQDVK	1723	sp|Q14764|MVP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28	ms_run[1]:scan=19469	102.06838166666667	2	1912.9439	1912.9413	R	T	378	395
PSM	LDTDDLDEIEK	1724	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=12987	66.205905	2	1304.572268	1304.598357	R	I	465	476
PSM	QAVEMKNDKSEEEQSSSSVK	1725	sp|P07910|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	10-UNIMOD:21	ms_run[1]:scan=2909	17.293893333333333	3	2318.948347	2318.993752	K	K	224	244
PSM	EQISDIDDAVR	1726	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:27	ms_run[1]:scan=10659	54.742266666666666	2	1241.5919	1241.5883	K	K	115	126
PSM	QDENDDDDDWNPCK	1727	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	13-UNIMOD:4	ms_run[1]:scan=8124	42.74031	2	1764.588527	1764.616937	K	A	333	347
PSM	LQGEHSQNGEEEPETEPVGEESISDAEK	1728	sp|Q5EBL4|RIPL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	6-UNIMOD:21	ms_run[1]:scan=11204	57.408815000000004	3	3134.276805	3133.288473	R	V	254	282
PSM	KEESEESDDDMGFGLFD	1729	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=19122	99.79870833333334	2	2045.718538	2044.713279	K	-	98	115
PSM	DADDAEQAFER	1730	sp|O43586|PPIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=10158	52.37872333333333	2	1266.514274	1265.516024	R	I	150	161
PSM	ALEESNYELEGK	1731	sp|P13645|K1C10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9037	47.12442333333333	2	1380.642635	1380.640890	R	I	166	178
PSM	DADDAVYELNGK	1732	sp|Q08170|SRSF4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=10549	54.19928833333333	2	1308.585170	1308.583375	R	D	47	59
PSM	FSDDEEEEEVVK	1733	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=8800	45.99571666666667	2	1454.613583	1453.609650	K	D	387	399
PSM	GEDSAEETEAKPAVVAPAPVVEAVSTPSAAFPSDATAENVK	1734	sp|Q12906-4|ILF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	8-UNIMOD:21	ms_run[1]:scan=19994	105.64353666666668	3	4117.927885	4117.925662	K	Q	479	520
PSM	ALEEEEGGTEVLSK	1735	sp|Q6P1R4|DUS1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=9028	47.077315000000006	2	1489.707961	1489.714784	R	N	357	371
PSM	LTLEGLEEDDDDR	1736	sp|Q9NPB8|GPCP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=15126	77.12337666666667	2	1517.667649	1518.668562	K	V	161	174
PSM	ELTVSNNDINEAGVR	1737	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=10519	54.054865	2	1630.781641	1629.795828	K	V	174	189
PSM	AAATPESQEPQAK	1738	sp|P49006|MRP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1232	8.7531	2	1326.6416	1326.6416	K	G	145	158
PSM	AAEDDEDDDVDTK	1739	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3127	18.35	2	1436.5427	1436.5427	R	K	90	103
PSM	ADDADEFGYSR	1740	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7706	40.587	2	1244.4946	1244.4946	R	-	900	911
PSM	ADPDGPEAQAEACSGER	1741	sp|Q9NX24|NHP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:4	ms_run[2]:scan=5532	30.116	2	1758.7115	1758.7115	K	T	6	23
PSM	AEEPVKSECTEEAEEGPAK	1742	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=5134	28.16	3	2168.8821	2168.8821	K	G	858	877
PSM	AEFEDQDDEAR	1743	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3794	21.674	2	1323.5215	1323.5215	R	V	864	875
PSM	AEFEDQDDEAR	1744	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4468	24.906	2	1323.5215	1323.5215	R	V	864	875
PSM	AEIIDQDLYER	1745	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13582	69.204	2	1363.662	1363.6620	K	L	575	586
PSM	AEPEAGEEQAGDDR	1746	sp|P56182|RRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1733	11.231	2	1472.6015	1472.6015	R	D	276	290
PSM	AGTQIENIDEDFR	1747	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12535	64.007	2	1506.6951	1506.6951	K	D	67	80
PSM	ALQPLEEGEDEEK	1748	sp|Q14764|MVP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8711	45.592	2	1485.6835	1485.6835	R	V	336	349
PSM	ANTSGDFEKDDDAYK	1749	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=6366	34.053	2	1754.6673	1754.6673	K	T	1990	2005
PSM	APSEEELHGDQTDFGQGSQSPQK	1750	sp|Q8TE77-4|SSH3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=9046	47.164	3	2551.05	2551.0500	K	Q	68	91
PSM	AVGEIVQDYDSDK	1751	sp|Q86YQ8-2|CPNE8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10951	56.199	2	1437.6624	1437.6624	K	M	15	28
PSM	CDGDFDCEDR	1752	sp|P98160|PGBM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=4254	23.908	2	1287.4132	1287.4132	R	T	344	354
PSM	CDQDMDEDDGR	1753	sp|O15169-2|AXIN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:4	ms_run[2]:scan=1203	8.6059	2	1354.4402	1354.4402	K	D	249	260
PSM	CTLPEHESPSQDISDACEAESTER	1754	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:4,8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=12567	64.145	3	2827.095	2827.0950	R	C	670	694
PSM	CYDDDDYESK	1755	sp|Q03164-2|KMT2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:4	ms_run[2]:scan=3253	18.984	2	1308.4452	1308.4452	K	M	1537	1547
PSM	DADDAVYELDGK	1756	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13711	69.866	2	1309.5674	1309.5674	R	E	49	61
PSM	DAELQDQEFGK	1757	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8229	43.251	2	1278.5728	1278.5728	R	R	859	870
PSM	DALNQATSQVESK	1758	sp|Q9P2E9|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9053	47.204	2	1389.6736	1389.6736	R	Q	807	820
PSM	DASTLQSQKAEGTGDAK	1759	sp|O00479|HMGN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=1599	10.584	2	1785.7782	1785.7782	R	-	74	91
PSM	DAVEDLESVGK	1760	sp|P81605|DCD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13752	70.08	2	1160.5561	1160.5561	K	G	86	97
PSM	DDATPVRDEPMDAESITFK	1761	sp|Q7Z6E9-2|RBBP6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=13225	67.441	3	2231.9294	2231.9294	R	S	947	966
PSM	DDDDGPVSSQGYMPYLNK	1762	sp|Q9H4E7|DEFI6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:35	ms_run[2]:scan=12552	64.08	3	2015.8419	2015.8419	R	Y	57	75
PSM	DECNVVEVVAR	1763	sp|O75607|NPM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4	ms_run[2]:scan=11822	60.394	2	1288.6082	1288.6082	K	N	77	88
PSM	DEGNYLDDALVR	1764	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14225	72.392	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEGNYLDDALVR	1765	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15734	80.297	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEGNYLDDALVR	1766	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16351	83.549	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEGNYLDDALVR	1767	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16536	84.554	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEGNYLDDALVR	1768	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16708	85.566	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEGNYLDDALVR	1769	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17112	87.887	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEGNYLDDALVR	1770	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16883	86.577	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEILPTTPISEQK	1771	sp|P23396|RS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13534	68.971	2	1469.7613	1469.7613	K	G	215	228
PSM	DEPDTNLVALMK	1772	sp|O95433-2|AHSA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=12244	62.511	2	1360.6544	1360.6544	K	E	126	138
PSM	DEPDTNLVALMK	1773	sp|O95433-2|AHSA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=12439	63.522	2	1360.6544	1360.6544	K	E	126	138
PSM	DGETLEELMK	1774	sp|P13797-3|PLST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=9740	50.476	2	1179.5329	1179.5329	R	L	212	222
PSM	DIDECDIVPDACK	1775	sp|Q12805-2|FBLN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4,12-UNIMOD:4	ms_run[2]:scan=12694	64.802	2	1548.6436	1548.6436	K	G	36	49
PSM	DILEPDAAEPDVQR	1776	sp|P57764|GSDMD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12437	63.511	2	1566.7526	1566.7526	K	G	63	77
PSM	DITSDTSGDFR	1777	sp|P04083|ANXA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8725	45.646	2	1212.5259	1212.5259	K	N	167	178
PSM	DLDAFENETAK	1778	sp|Q86WJ1-5|CHD1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11155	57.181	2	1251.5619	1251.5619	K	K	16	27
PSM	DLDDTSVVEDGR	1779	sp|Q9Y4D7-2|PLXD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8741	45.718	2	1319.5841	1319.5841	R	K	1622	1634
PSM	DLEDESTPIVK	1780	sp|Q9HD20-3|AT131_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10066	51.942	2	1244.6136	1244.6136	R	L	80	91
PSM	DLGGFDEDAEPR	1781	sp|Q9BRK5-4|CAB45_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10980	56.328	2	1319.563	1319.5630	K	R	86	98
PSM	DLSAYVVNNADDMDR	1782	sp|Q9Y496|KIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:35	ms_run[2]:scan=13708	69.849	2	1712.7312	1712.7312	K	I	183	198
PSM	DLTGEVEENER	1783	sp|Q9UMZ2-6|SYNRG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8733	45.679	2	1289.5735	1289.5735	K	Y	910	921
PSM	DMNEVETQFK	1784	sp|Q9NZ08|ERAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=7279	38.477	2	1255.5391	1255.5391	R	A	691	701
PSM	DNDPDVDLFAGTK	1785	sp|Q9Y4E1-3|WAC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15123	77.108	2	1405.6361	1405.6361	K	K	797	810
PSM	DPDAQPGGELMLGGTDSK	1786	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=8999	46.932	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	1787	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=19739	103.92	2	1802.7993	1802.7993	R	Y	236	254
PSM	DQDNMQAELNR	1788	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35	ms_run[2]:scan=1907	12.089	2	1348.5677	1348.5677	R	L	466	477
PSM	DQGTYEDYVEGLR	1789	sp|P60660-2|MYL6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16247	82.977	3	1543.6791	1543.6791	K	V	82	95
PSM	DSDDVPMVLVGNK	1790	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=17089	87.732	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDEADLVLAK	1791	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11173	57.266	2	1174.5717	1174.5717	K	E	144	155
PSM	DSDKESEDGEDEVSCETVK	1792	sp|Q96TC7-2|RMD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=5772	31.301	3	2236.8203	2236.8203	R	M	59	78
PSM	DSDQLDVIQENR	1793	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10734	55.08	2	1430.6638	1430.6638	K	Q	1478	1490
PSM	DSTSQHDDDNISTTSGFSSR	1794	sp|P49790-2|NU153_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	18-UNIMOD:21	ms_run[2]:scan=7769	40.898	3	2235.8553	2235.8553	K	A	171	191
PSM	DSYVGDEAQSK	1795	sp|P63261|ACTG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2601	15.639	2	1197.515	1197.5150	K	R	51	62
PSM	DTDDVPMILVGNK	1796	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=21149	113.64	2	1431.6915	1431.6915	K	C	86	99
PSM	DTDDVPMILVGNK	1797	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=19018	99.145	2	1431.6915	1431.6915	K	C	86	99
PSM	DVTGAEALLER	1798	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15028	76.622	2	1172.6037	1172.6037	K	H	1350	1361
PSM	DWDEIIPEEQR	1799	sp|O14647-2|CHD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17292	88.907	2	1428.6521	1428.6521	K	K	1042	1053
PSM	DYDEEEQGYDSEKEK	1800	sp|Q05519-2|SRS11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=3576	20.648	2	1942.6993	1942.6993	R	K	423	438
PSM	DYELLCLDGTR	1801	sp|P02787|TRFE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4	ms_run[2]:scan=17699	91.279	2	1353.6235	1353.6235	K	K	577	588
PSM	DYEPPSPSPAPGAPPPPPQR	1802	sp|P55196-1|AFAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=9663	50.104	2	2132.9568	2132.9568	R	N	1674	1694
PSM	DYETATLSDIK	1803	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13175	67.202	2	1254.598	1254.5980	R	A	440	451
PSM	DYETATLSDIK	1804	sp|O43707|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13306	67.874	2	1254.598	1254.5980	R	A	440	451
PSM	DYQDDTLELYNR	1805	sp|P49750-3|YLPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14376	73.204	2	1543.6791	1543.6791	R	E	1038	1050
PSM	DYVSQFEGSALGK	1806	sp|P02647|APOA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17308	88.99	2	1399.662	1399.6620	R	Q	52	65
PSM	EALENANTNTEVLK	1807	sp|Q9H444|CHM4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9076	47.321	2	1544.7682	1544.7682	R	N	94	108
PSM	EALPAPSDDATALMTDPK	1808	sp|P07203|GPX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:35	ms_run[2]:scan=12285	62.73	3	1857.8666	1857.8666	R	L	131	149
PSM	EAMEDGEIDGNK	1809	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35	ms_run[2]:scan=1431	9.6809	2	1322.5296	1322.5296	K	V	628	640
PSM	EATTDFTVDSR	1810	sp|O75369-5|FLNB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7584	40.014	2	1240.5572	1240.5572	R	P	1246	1257
PSM	EAYEEPPEQLR	1811	sp|Q99795|GPA33_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8702	45.552	2	1359.6307	1359.6307	R	E	279	290
PSM	EDVDDLVSQLR	1812	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=18591	96.49	2	1287.6307	1287.6307	K	Q	932	943
PSM	EEDSYLFDLDNK	1813	sp|Q9H9B1|EHMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17683	91.177	2	1486.6464	1486.6464	R	D	1169	1181
PSM	EEETKTSNGDLSDSTVSADPVVK	1814	sp|Q2M389|WASC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=9937	51.37	3	2487.0902	2487.0902	K	-	1151	1174
PSM	EEETKTSNGDLSDSTVSADPVVK	1815	sp|Q2M389|WASC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=9959	51.468	2	2487.0902	2487.0902	K	-	1151	1174
PSM	EEGAQTLEEDR	1816	sp|Q9BRZ2|TRI56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4526	25.205	2	1275.5579	1275.5579	R	A	429	440
PSM	EEIINYEFDTK	1817	sp|Q8TCT9-5|HM13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15586	79.511	2	1399.6507	1399.6507	K	D	151	162
PSM	EENAEQQALAAK	1818	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5621	30.508	2	1300.6259	1300.6259	R	R	475	487
PSM	EEQEELMDFER	1819	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=11391	58.295	2	1469.598	1469.5980	R	D	576	587
PSM	EESDGEYDEFGR	1820	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8776	45.889	2	1431.5426	1431.5426	R	K	118	130
PSM	EEVNETYGDGDGR	1821	sp|Q96P47-5|AGAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3468	20.088	2	1439.5801	1439.5801	K	T	480	493
PSM	EFEEDLTGIDDR	1822	sp|P09455|RET1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13903	70.847	2	1437.626	1437.6260	K	K	70	82
PSM	EFEEDLTGIDDR	1823	sp|P09455|RET1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14413	73.412	2	1437.626	1437.6260	K	K	70	82
PSM	EFTESQLQEGK	1824	sp|Q01995|TAGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7525	39.72	2	1294.6041	1294.6041	R	H	162	173
PSM	EGDGVYYNELETR	1825	sp|Q8N7H5-3|PAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12238	62.478	2	1543.6791	1543.6791	R	V	307	320
PSM	EGEEPTVYSDEEEPKDESAR	1826	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=5949	32.099	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	1827	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=7014	37.172	2	2374.9326	2374.9326	K	K	121	141
PSM	EGITTYFSGNCTMEDAK	1828	sp|Q9NY33-4|DPP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:4,13-UNIMOD:35	ms_run[2]:scan=14097	71.749	2	1938.7975	1938.7975	K	L	136	153
PSM	EGLDEVAGIINDAK	1829	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=19301	100.95	2	1442.7253	1442.7253	K	F	879	893
PSM	EIDSELEAMTEK	1830	sp|Q8NF91-4|SYNE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=8981	46.845	2	1409.6232	1409.6232	K	L	5507	5519
PSM	EISDDEAEEEKGEK	1831	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=1142	8.289	2	1686.6509	1686.6509	K	E	224	238
PSM	EISEGDEVEVYSR	1832	sp|P51114-2|FXR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10399	53.495	2	1510.6787	1510.6787	K	A	58	71
PSM	ELDEATESNEAMGR	1833	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:35	ms_run[2]:scan=3585	20.691	2	1566.6468	1566.6468	R	E	1906	1920
PSM	ELEEEVNNFQK	1834	sp|Q9NVA2|SEP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10329	53.173	2	1377.6412	1377.6412	K	K	387	398
PSM	ELENANDLLSATK	1835	sp|P12270|TPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14049	71.534	2	1416.7096	1416.7096	K	R	352	365
PSM	ELGSECGIEFDEEK	1836	sp|P39656-2|OST48_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4	ms_run[2]:scan=13295	67.821	2	1640.6876	1640.6876	R	T	103	117
PSM	ELISNASDALDK	1837	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11205	57.413	2	1274.6354	1274.6354	R	I	42	54
PSM	EMEEELVPTGSEPGDTR	1838	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=9857	51.001	2	1890.8153	1890.8153	R	A	19	36
PSM	EPQPEVAAAEEEK	1839	sp|O15427|MOT4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6289	33.667	2	1425.6624	1425.6624	K	L	416	429
PSM	EQQESLALEELELQK	1840	sp|Q13439-3|GOGA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17953	92.681	3	1785.8996	1785.8996	K	K	530	545
PSM	ERVPDSPSPAPSLEEGR	1841	sp|Q9UI36-2|DACH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=9824	50.855	2	1981.8184	1981.8184	K	R	434	451
PSM	ESDDGTEELEVR	1842	sp|Q9NQX3|GEPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7521	39.702	2	1377.5896	1377.5896	R	I	435	447
PSM	ESEDKPEIEDVGSDEEEEK	1843	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=6955	36.852	2	2271.8792	2271.8792	K	K	251	270
PSM	ESLDVYELDAK	1844	sp|Q13510-3|ASAH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14503	73.896	2	1280.6136	1280.6136	K	Q	294	305
PSM	ESSKVDANEEVEALIVK	1845	sp|P33527-8|MRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=17601	90.706	3	1938.9187	1938.9187	K	S	287	304
PSM	ETDSLSDEVTHNSNQNNSNCSSPSR	1846	sp|Q96RT1-7|ERBIN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,20-UNIMOD:4	ms_run[2]:scan=6653	35.359	3	2858.1047	2858.1047	K	M	639	664
PSM	EVTWEVLEGEVEK	1847	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=19982	105.56	2	1545.7563	1545.7563	K	E	300	313
PSM	FTDEEVDEMYR	1848	sp|P24844-2|MYL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=8896	46.459	2	1448.5766	1448.5766	R	E	80	91
PSM	FTDEEVDEMYR	1849	sp|P24844-2|MYL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13015	66.343	2	1432.5817	1432.5817	R	E	80	91
PSM	GDDGIFDDNFIEER	1850	sp|O60493-2|SNX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=19720	103.79	2	1640.6954	1640.6954	R	K	73	87
PSM	GDDGIFDDNFIEER	1851	sp|O60493-2|SNX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=19521	102.43	2	1640.6954	1640.6954	R	K	73	87
PSM	GDSGAAPDVDDK	1852	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1514	10.125	2	1145.4837	1145.4837	K	L	973	985
PSM	GEDEEENNLEVR	1853	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6036	32.528	3	1431.6114	1431.6114	K	E	90	102
PSM	GEENLMDAQVK	1854	sp|P50990-3|TCPQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35	ms_run[2]:scan=4596	25.521	2	1248.5656	1248.5656	K	A	198	209
PSM	GESPVDYDGGR	1855	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4245	23.874	2	1150.4891	1150.4891	K	T	243	254
PSM	GETESEEFEK	1856	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3690	21.194	2	1183.4881	1183.4881	R	L	283	293
PSM	GSETGSETHESDLAPSDK	1857	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=3835	21.844	2	1925.7528	1925.7528	R	E	1105	1123
PSM	GSETGSETHESDLAPSDK	1858	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=4520	25.179	2	1925.7528	1925.7528	R	E	1105	1123
PSM	GSTDNLMDDIER	1859	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=8788	45.943	2	1380.5827	1380.5827	R	A	306	318
PSM	GSTDNLMDDIER	1860	sp|P50990-3|TCPQ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=9148	47.648	2	1380.5827	1380.5827	R	A	306	318
PSM	GSVSSEASELDK	1861	sp|Q8TDB6|DTX3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6343	33.934	2	1207.5568	1207.5568	K	K	544	556
PSM	GVEEEEEDGEMRE	1862	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5750	31.192	2	1536.5886	1536.5886	R	-	74	87
PSM	HSSISPSTLTLK	1863	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=12613	64.393	2	1429.6255	1429.6255	R	S	435	447
PSM	IAAESSENVDCPENPK	1864	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:4	ms_run[2]:scan=5156	28.271	2	1758.773	1758.7730	K	I	578	594
PSM	IAELSEDDQK	1865	sp|Q9BZE4-3|NOG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4103	23.197	2	1146.5404	1146.5404	R	I	180	190
PSM	IEDLENEIEEVK	1866	sp|Q9H3R5|CENPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16930	86.84	2	1458.709	1458.7090	K	V	82	94
PSM	ITDEEELNDYK	1867	sp|Q9BZJ0-2|CRNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9034	47.109	2	1367.6093	1367.6093	K	L	53	64
PSM	IYDDYYPDLK	1868	sp|P78310-5|CXAR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14531	74.046	2	1303.5972	1303.5972	K	G	79	89
PSM	IYEDGDDDMK	1869	sp|Q9HB71-3|CYBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:35	ms_run[2]:scan=1680	10.969	2	1215.4601	1215.4601	K	R	155	165
PSM	IYEDGDDDMK	1870	sp|Q9HB71-3|CYBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4083	23.098	2	1199.4652	1199.4652	K	R	155	165
PSM	IYEFPETDDEEENK	1871	sp|Q16181-2|SEPT7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12186	62.196	2	1756.7316	1756.7316	K	L	221	235
PSM	KVTSPLQSPTK	1872	sp|Q6IQ23-3|PKHA7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=4295	24.096	2	1344.6091	1344.6091	R	A	474	485
PSM	LASGVEGSDIPDDGK	1873	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7649	40.303	2	1458.6838	1458.6838	K	L	503	518
PSM	LCSTEEETAELLSK	1874	sp|P49441|INPP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4	ms_run[2]:scan=15198	77.472	2	1608.7553	1608.7553	R	V	96	110
PSM	LDYDEDASAMLK	1875	sp|Q8NFI4|F10A5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35	ms_run[2]:scan=10032	51.794	2	1385.6021	1385.6021	K	E	211	223
PSM	LECNGENDCGDNSDER	1876	sp|P13671|CO6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4,9-UNIMOD:4	ms_run[2]:scan=1222	8.7025	2	1882.6694	1882.6694	K	D	156	172
PSM	LEQEEPLTDAER	1877	sp|Q5JTD0-2|TJAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7972	41.931	2	1428.6733	1428.6733	R	M	30	42
PSM	LESIDNHSSTGGQSDQGYGSK	1878	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=5625	30.527	3	2245.9125	2245.9125	R	D	951	972
PSM	LFEESDDKEDEDADGK	1879	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=3083	18.132	2	1920.715	1920.7150	K	E	672	688
PSM	LGMSADPDNEDATDK	1880	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35	ms_run[2]:scan=2406	14.646	2	1593.6464	1593.6464	R	V	335	350
PSM	LLEPEDVDVVDPDEK	1881	sp|Q8WXH0-2|SYNE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15981	81.551	2	1710.82	1710.8200	R	S	258	273
PSM	LLIYAVLPTGDVIGDSAK	1882	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=22689	124.89	2	1844.0295	1844.0295	R	Y	540	558
PSM	LNSELDLDDAILEK	1883	sp|Q9NWS8-2|RMND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=18976	98.87	2	1586.8039	1586.8039	K	F	78	92
PSM	LSSGDPSTSPSLSQTTPSKDTDDQSR	1884	sp|Q99504-2|EYA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:21	ms_run[2]:scan=7078	37.492	3	2773.1927	2773.1927	R	K	128	154
PSM	LTDISVTDPEK	1885	sp|Q9Y333|LSM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9600	49.814	2	1216.6187	1216.6187	K	Y	40	51
PSM	LVESDAEAEAVR	1886	sp|Q9BZJ0-2|CRNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6974	36.959	2	1287.6307	1287.6307	R	E	339	351
PSM	MEAENLEQLIDQK	1887	sp|P11047|LAMC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:35	ms_run[2]:scan=17419	89.618	2	1575.745	1575.7450	K	L	1291	1304
PSM	MENEEQPQDER	1888	sp|Q96EI5|TCAL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:35	ms_run[2]:scan=886	7.1291	2	1419.5572	1419.5572	K	K	18	29
PSM	NDFTEEEEAQVR	1889	sp|P63208|SKP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9372	48.657	2	1465.6321	1465.6321	K	K	143	155
PSM	NLDDTIDDEK	1890	sp|P0CB38|PAB4L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6899	36.559	2	1176.5146	1176.5146	K	L	299	309
PSM	NMDDYEDFDEK	1891	sp|Q68DH5|LMBD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=8236	43.29	2	1435.5086	1435.5086	R	H	286	297
PSM	NPDDITNEEYGEFYK	1892	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15121	77.102	3	1832.7741	1832.7741	R	S	300	315
PSM	NSQGSEMFGDDDK	1893	sp|P15924-3|DESP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=2287	14.063	2	1444.5413	1444.5413	R	R	593	606
PSM	PGGPPNPPGPSPK	1894	sp|O95785-2|WIZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=4112	23.244	2	1277.5806	1277.5806	R	A	239	252
PSM	QAIPLDENEGIYVQDVK	1895	sp|Q14764|MVP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16658	85.249	3	1929.9684	1929.9684	R	T	378	395
PSM	QETEEELIENDYR	1896	sp|Q96M89-2|CC138_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13415	68.418	2	1666.7322	1666.7322	K	V	103	116
PSM	QGSADSYTSRPSDSDVSLEEDR	1897	sp|O00305-4|CACB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=10099	52.089	3	2479.9976	2479.9977	R	E	49	71
PSM	QLDEGEISTIDK	1898	sp|P13674-3|P4HA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10907	55.965	2	1346.6565	1346.6565	R	V	193	205
PSM	QSYGEGDQDDR	1899	sp|Q6H8Q1-8|ABLM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1136	8.2595	2	1268.4905	1268.4905	R	S	345	356
PSM	QSYGESPQLLSPTPTEGDQDDR	1900	sp|Q6H8Q1-4|ABLM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13088	66.729	2	2419.0775	2419.0775	R	S	102	124
PSM	QTPADGEASGESEPAK	1901	sp|P55011-3|S12A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1390	9.5101	2	1572.6904	1572.6904	K	G	115	131
PSM	QTSKGEDVGYVASEITMSDEER	1902	sp|O94885|SASH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=15968	81.476	3	2526.0469	2526.0469	R	I	168	190
PSM	SEEDVQSMDAR	1903	sp|Q96EP1-5|CHFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:35	ms_run[2]:scan=1004	7.6751	2	1281.5143	1281.5143	R	N	280	291
PSM	SEILDESEDYR	1904	sp|Q8NE01|CNNM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10458	53.785	2	1354.5889	1354.5889	R	D	447	458
PSM	SEMMDDLATDAR	1905	sp|P55789|ALR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35,4-UNIMOD:35	ms_run[2]:scan=4153	23.43	2	1385.5439	1385.5439	R	G	24	36
PSM	SIDDSEMESPVDDVFYPGTGR	1906	sp|Q14938-6|NFIX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35	ms_run[2]:scan=17937	92.602	3	2330.9849	2330.9849	K	S	272	293
PSM	SISVPPSPSDIPPPGPPR	1907	sp|Q6IQ23-3|PKHA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=15005	76.5	2	1875.9132	1875.9132	R	V	137	155
PSM	SISVPPSPSDIPPPGPPR	1908	sp|Q6IQ23-3|PKHA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=15686	80.038	2	1875.9132	1875.9132	R	V	137	155
PSM	SLYDDVDTGEK	1909	sp|Q99715-4|COCA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9086	47.363	2	1240.5459	1240.5459	K	N	941	952
PSM	SMASGGGVPTDEEQATGLER	1910	sp|P10606|COX5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=9202	47.894	2	2006.8851	2006.8851	R	E	30	50
PSM	SNSKAEQLVLSGADSDEDTSR	1911	sp|O75128-2|COBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=11976	61.126	3	2287.9805	2287.9805	R	A	258	279
PSM	SQSESSDEVTELDLSHGK	1912	sp|Q86YS7|C2CD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=11304	57.874	3	2026.8368	2026.8368	R	K	657	675
PSM	SSSPAELDLKDDLQQTQGK	1913	sp|Q2PPJ7-3|RGPA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=14240	72.465	3	2138.9733	2138.9733	R	C	819	838
PSM	SSSPAELDLKDDLQQTQGK	1914	sp|Q2PPJ7-3|RGPA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=14969	76.316	3	2138.9733	2138.9733	R	C	819	838
PSM	SSTPSHGQTTATEPTPAQK	1915	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=1606	10.625	2	2004.879	2004.8790	R	T	153	172
PSM	SVSEINSDDELSGK	1916	sp|P82094|TMF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7822	41.118	2	1478.6736	1478.6736	R	G	338	352
PSM	SYCNDQSTGDIK	1917	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4	ms_run[2]:scan=3072	18.077	2	1386.5722	1386.5722	K	V	104	116
PSM	TCVADESAENCDK	1918	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=3716	21.308	2	1497.5712	1497.5712	K	S	76	89
PSM	TDTLEDLFPTTK	1919	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=19306	100.98	2	1379.682	1379.6820	K	I	470	482
PSM	TEDEQFNDEK	1920	sp|Q9Y376|CAB39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2477	15.011	2	1253.5048	1253.5048	R	T	314	324
PSM	TEEELLETTLK	1921	sp|P23141-3|EST1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15469	78.887	2	1304.6711	1304.6711	K	M	290	301
PSM	TENSLANENQQPIKSEPESEGEEPK	1922	sp|Q8NHM5-4|KDM2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:21	ms_run[2]:scan=8089	42.568	3	2863.2397	2863.2397	R	R	892	917
PSM	TESDEKSSIALTAPDAAADPK	1923	sp|Q8NFD5-4|ARI1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=9989	51.612	3	2195.9835	2195.9835	K	E	992	1013
PSM	TIDDLEETLASAK	1924	sp|P07951-2|TPM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17580	90.558	2	1404.6984	1404.6984	K	E	252	265
PSM	TIEEYAVCPDLK	1925	sp|P36871|PGM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:4	ms_run[2]:scan=13969	71.147	2	1436.6857	1436.6857	K	V	153	165
PSM	TITLEVEPSDTIENVK	1926	sp|P62987|RL40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=16932	86.851	2	1786.92	1786.9200	K	A	12	28
PSM	TLEDEEEQER	1927	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3407	19.76	2	1276.5419	1276.5419	R	E	19	29
PSM	TTDDLTEAWLQEK	1928	sp|O60234|GMFG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=17525	90.229	2	1548.7308	1548.7308	R	L	125	138
PSM	TTEMETIYDLGTK	1929	sp|Q9Y230-2|RUVB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35	ms_run[2]:scan=12839	65.502	2	1516.6967	1516.6967	K	M	120	133
PSM	VAAAAGSGPSPPGSPGHDR	1930	sp|Q9BTU6|P4K2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21,14-UNIMOD:21	ms_run[2]:scan=3910	22.212	2	1846.7401	1846.7401	R	E	38	57
PSM	VDDEPMDVDK	1931	sp|Q13123|RED_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35	ms_run[2]:scan=2372	14.485	2	1177.4809	1177.4809	K	G	389	399
PSM	VDIDEFDENK	1932	sp|Q9BPX5|ARP5L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11521	58.92	2	1222.5354	1222.5354	R	F	13	23
PSM	VEEDVASDLVMK	1933	sp|Q9NYU2-2|UGGG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=10840	55.613	2	1349.6384	1349.6384	R	V	914	926
PSM	VIEEQLEPAVEK	1934	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10394	53.471	2	1382.7293	1382.7293	K	I	1225	1237
PSM	VLAVNQENEQLMEDYEK	1935	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:35	ms_run[2]:scan=13074	66.66	3	2066.9467	2066.9467	K	L	265	282
PSM	VMEIVDADEK	1936	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35	ms_run[2]:scan=5031	27.705	2	1163.538	1163.5380	R	V	202	212
PSM	VQALEEANNDLENK	1937	sp|P35527|K1C9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10226	52.693	3	1585.7584	1585.7584	K	I	171	185
PSM	VSEEIEDIIK	1938	sp|O75223-3|GGCT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15560	79.391	2	1173.6129	1173.6129	K	K	78	88
PSM	VSQGVEDGPDTK	1939	sp|Q9UBE0-2|SAE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1519	10.146	2	1230.5728	1230.5728	K	R	184	196
PSM	YAELSEEDLK	1940	sp|Q4G0N4-2|NAKD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10516	54.043	2	1195.5608	1195.5608	R	Q	89	99
PSM	YDIEDGEAIDSR	1941	sp|Q13576-3|IQGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11820	60.387	2	1381.5998	1381.5998	K	S	782	794
PSM	YGVDIPEDENEK	1942	sp|P20591-2|MX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10018	51.731	2	1406.6202	1406.6202	K	M	360	372
PSM	YLSEVASGDNK	1943	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4352	24.383	2	1181.5564	1181.5564	R	Q	128	139
PSM	YPDLYPQEDEDEEEER	1944	sp|Q8N4Q1|MIA40_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13003	66.291	3	2054.8229	2054.8229	K	E	101	117
PSM	YTGEDFDEDLR	1945	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10872	55.772	2	1358.5626	1358.5626	K	T	2967	2978
PSM	QLEEAEEEAQR	1946	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=12349	63.077443333333335	2	1313.5745	1313.5730	R	A	1878	1889
PSM	QLEEAEEEASR	1947	sp|Q7Z406|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=12680	64.73276666666666	2	1272.5473	1272.5465	R	A	1902	1913
PSM	QNCELFEQLGEYKFQNALLVR	1948	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,3-UNIMOD:4	ms_run[1]:scan=24613	139.94083833333332	3	2581.2655	2581.2630	K	Y	414	435
PSM	EISDDEAEEEKGEK	1949	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:27,3-UNIMOD:21	ms_run[1]:scan=2892	17.21822166666667	2	1668.6182	1668.6402	K	E	224	238
PSM	QSFDDNDSEELEDKDSK	1950	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=9956	51.4526	2	2062.7519	2062.7523	K	S	106	123
PSM	EELQANGSAPAADKEEPAAAGSGAASPSAAEK	1951	sp|P29966|MARCS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	26-UNIMOD:21	ms_run[1]:scan=8072	42.48472666666667	3	3062.340211	3061.351348	K	G	56	88
PSM	GNAEGSSDEEGKLVIDEPAK	1952	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:21	ms_run[1]:scan=11105	56.94608	2	2124.914308	2123.925989	K	E	127	147
PSM	SQETGDLDVGGLQETDK	1953	sp|P23142|FBLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=11943	60.974608333333336	2	1791.807993	1790.817017	K	I	147	164
PSM	IEENSLKEEESIEGEK	1954	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:21	ms_run[1]:scan=9869	51.058565	2	1942.832315	1941.845614	K	E	1566	1582
PSM	IDEPLEGSEDR	1955	sp|P61978|HNRPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6427	34.33275666666667	2	1258.576048	1258.567725	K	I	423	434
PSM	EINSDQATQGNISSDR	1956	sp|Q29RF7|PDS5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=5359	29.27801	2	1734.766786	1733.781634	K	G	1220	1236
PSM	GVITDQNSDGYCQTGTMSR	1957	sp|P15924|DESP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:4	ms_run[1]:scan=9307	48.35315	2	2089.871644	2088.884068	R	H	46	65
PSM	SAEIDSDDTGGSAAQK	1958	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=2584	15.560301666666666	2	1550.670870	1550.669624	K	Q	814	830
PSM	DPDAQPGGELMLGGTDSK	1959	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:35	ms_run[1]:scan=11241	57.57743000000001	3	1803.787179	1802.799259	R	Y	236	254
PSM	EGEETEGSEEDDKENDKTEEMPNDSVLENK	1960	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:21,8-UNIMOD:21,21-UNIMOD:35	ms_run[1]:scan=8258	43.39427333333333	3	3603.340275	3601.333585	K	S	473	503
PSM	QDAQDLYEAGEKK	1961	sp|P09525|ANXA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=9917	51.280165000000004	2	1476.6757	1476.6727	R	W	173	186
PSM	DTDDVPMILVGNK	1962	sp|P61224|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:35	ms_run[1]:scan=16348	83.53528666666666	2	1431.693087	1431.691546	K	C	105	118
PSM	SIAEEQYSDLEK	1963	sp|O75116|ROCK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=10131	52.251261666666664	2	1410.654124	1410.651455	R	E	930	942
PSM	SGCSDLEEAVDSGADKK	1964	sp|Q92538|GBF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:21,3-UNIMOD:4	ms_run[1]:scan=11675	59.685565000000004	2	1847.732554	1846.729204	K	F	659	676
PSM	ADFDDRVSDEEK	1965	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=9512	49.365755	2	1466.6165	1466.6156	M	V	2	14
PSM	EQISDIDDAVR	1966	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:27	ms_run[1]:scan=12608	64.36610833333334	2	1241.5896	1241.5883	K	K	115	126
PSM	VDNALQSGNSQESVTEQDSK	1967	sp|P01834|IGKC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=6474	34.542475	3	2135.944589	2134.961449	K	D	43	63
PSM	NVELQCLDADDAK	1968	sp|P02730|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:4	ms_run[1]:scan=12650	64.57932166666667	2	1490.658535	1489.671873	R	A	880	893
PSM	NVELQCLDADDAK	1969	sp|P02730|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:4	ms_run[1]:scan=12434	63.50010666666667	2	1490.657852	1489.671873	R	A	880	893
PSM	SISVPPSPSDIPPPGPPR	1970	sp|Q6IQ23|PKHA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:21	ms_run[1]:scan=14781	75.31709833333333	2	1876.919754	1875.913180	R	V	563	581
PSM	SISVPPSPSDIPPPGPPR	1971	sp|Q6IQ23|PKHA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:21	ms_run[1]:scan=16281	83.17107166666666	2	1875.916047	1875.913180	R	V	563	581
PSM	DEFTNTCPSDK	1972	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=4311	24.181933333333333	2	1312.523140	1312.524146	R	E	228	239
PSM	EGGAGAVDEDDFIK	1973	sp|O75122|CLAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=12781	65.22127666666667	2	1422.644600	1421.631054	K	A	59	73
PSM	LEESYDMESVLR	1974	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:35	ms_run[1]:scan=11634	59.49182166666667	2	1485.667313	1485.665725	K	N	276	288
PSM	DEVLEVLEDGR	1975	sp|Q9H6S3|ES8L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=18507	95.97606833333333	2	1273.623265	1272.619761	K	Q	516	527
PSM	QYDEDGHTSEEK	1976	sp|Q9NSK0|KLC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=2052	12.838955	2	1419.5370	1419.5421	R	E	155	167
PSM	GQVIIISDSDDDDDER	1977	sp|Q7Z333|SETX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=11300	57.850190000000005	2	1790.773309	1790.780631	R	I	1011	1027
PSM	SEMEVQDAELK	1978	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=9107	47.45988333333333	2	1278.569676	1277.580933	K	A	345	356
PSM	EVDDLGPEVGDIK	1979	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=13824	70.4415	2	1384.674330	1384.672190	R	I	372	385
PSM	EETEEEVQDTR	1980	sp|P13569|CFTR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=3204	18.744261666666667	2	1364.599044	1363.573933	K	L	1469	1480
PSM	ENPPVEDSSDEDDKR	1981	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:27	ms_run[1]:scan=3619	20.840935	2	1712.7084	1712.7120	R	N	491	506
PSM	GSNTCELIFEDCK	1982	sp|P26440|IVD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=14241	72.46919	2	1571.659592	1571.659594	R	I	250	263
PSM	EYWNDPELDEGER	1983	sp|Q8N9T8|KRI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=14149	72.00571166666667	2	1650.690741	1650.679795	K	F	226	239
PSM	LPGPPPASPIPTEGPR	1984	sp|Q9H6A9|PCX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	8-UNIMOD:21	ms_run[1]:scan=12194	62.23634333333334	2	1661.819687	1661.817823	R	T	1902	1918
PSM	DSDDVPMVLVGNK	1985	sp|P01112|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:35	ms_run[1]:scan=15264	77.814825	2	1402.654915	1403.660246	K	C	105	118
PSM	NVELQCLDADDAK	1986	sp|P02730|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:4	ms_run[1]:scan=12544	64.04751833333333	2	1490.657852	1489.671873	R	A	880	893
PSM	ILNCDTITQVKEK	1987	sp|Q9HCM2|PLXA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:4,8-UNIMOD:21	ms_run[1]:scan=12873	65.67484166666667	2	1640.793365	1640.784475	K	I	1519	1532
PSM	QAVEMKNDKSEEEQSSSSVK	1988	sp|P07910|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:21	ms_run[1]:scan=3118	18.311410000000002	2	2318.948219	2318.993752	K	K	224	244
PSM	AACSAAAMEEDSEASSSR	1989	sp|Q05086-2|UBE3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4	ms_run[2]:scan=5876	31.775	2	1828.7204	1828.7204	K	I	173	191
PSM	ADGGTQVIDTK	1990	sp|P09622-2|DLDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3056	18.016	2	1103.5459	1103.5459	K	N	68	79
PSM	AEDTISILPDDPR	1991	sp|Q8WUH1|CHUR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15360	78.341	2	1440.7096	1440.7096	K	Q	121	134
PSM	AEEYTEETEER	1992	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3658	21.045	2	1384.563	1384.5630	K	E	792	803
PSM	AEFEDQDDEAR	1993	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3475	20.118	2	1323.5215	1323.5215	R	V	864	875
PSM	AEFEDQDDEAR	1994	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4684	25.93	2	1323.5215	1323.5215	R	V	864	875
PSM	AEFEDQDDEAR	1995	sp|Q14692|BMS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4567	25.384	2	1323.5215	1323.5215	R	V	864	875
PSM	AELVLIDEDDEK	1996	sp|Q8IXS6|PALM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14400	73.351	2	1387.6719	1387.6719	K	S	306	318
PSM	AESEQEAYLRED	1997	sp|Q9NR28-2|DBLOH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7427	39.19	2	1438.6212	1438.6212	R	-	175	187
PSM	AFTFDDEDDELSQLK	1998	sp|Q9H9C1-2|SPE39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=19159	100.04	2	1771.7788	1771.7788	K	E	19	34
PSM	AIEQADLLQEEDESPR	1999	sp|P61966|AP1S1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13335	68.017	3	1841.8643	1841.8643	K	S	134	150
PSM	ANSIGSTSASSVPNTDDEDSDYHQEAYK	2000	sp|Q9UH92-3|MLX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=10128	52.24	3	3067.2204	3067.2204	R	E	42	70
PSM	ATISDEEIER	2001	sp|Q9UQN3-2|CHM2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6775	35.949	2	1161.5513	1161.5513	K	Q	155	165
PSM	AVTEQGAELSNEER	2002	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5575	30.302	3	1531.7114	1531.7114	K	N	28	42
PSM	AVTEQGAELSNEER	2003	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5780	31.335	2	1531.7114	1531.7114	K	N	28	42
PSM	CDGDFDCEDR	2004	sp|P98160|PGBM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=3099	18.218	2	1287.4132	1287.4132	R	T	344	354
PSM	CDGDFDCEDR	2005	sp|P98160|PGBM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:4,7-UNIMOD:4	ms_run[2]:scan=3611	20.807	2	1287.4132	1287.4132	R	T	344	354
PSM	CYVDGSEEIGSDFK	2006	sp|P78310-5|CXAR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:4	ms_run[2]:scan=13291	67.802	2	1604.6665	1604.6665	R	I	146	160
PSM	DEFTNTCPSDK	2007	sp|Q9Y696|CLIC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4	ms_run[2]:scan=4318	24.21	2	1312.5241	1312.5241	R	E	228	239
PSM	DEGNYLDDALVR	2008	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16167	82.537	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEGNYLDDALVR	2009	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16613	84.999	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEVEVSDDDEKEPEVDYR	2010	sp|Q15746-4|MYLK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=10463	53.807	3	2246.874	2246.8740	K	T	1364	1382
PSM	DGDFENPVPYTGAVK	2011	sp|P30040|ERP29_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14338	72.99	2	1607.7468	1607.7468	R	V	123	138
PSM	DGEEAGAYDGPR	2012	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5060	27.821	2	1235.5055	1235.5055	R	T	108	120
PSM	DGSKSEDELDQASTPTDVR	2013	sp|P30279|CCND2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=8452	44.336	3	2128.8798	2128.8798	R	D	267	286
PSM	DLEPGEVPSDSDEDGEHK	2014	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=7466	39.379	2	2033.7739	2033.7739	R	S	1372	1390
PSM	DLIQDQNMDEK	2015	sp|Q9H307|PININ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:35	ms_run[2]:scan=4618	25.617	2	1363.5926	1363.5926	R	G	127	138
PSM	DMTSEQLDDILK	2016	sp|P05023-3|AT1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35	ms_run[2]:scan=16448	84.064	2	1422.6548	1422.6548	K	Y	641	653
PSM	DPDAQPGGELMLGGTDSK	2017	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:35	ms_run[2]:scan=19275	100.78	2	1802.7993	1802.7993	R	Y	236	254
PSM	DPDAQPGGELMLGGTDSK	2018	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15016	76.557	2	1786.8043	1786.8043	R	Y	236	254
PSM	DPDMVQNTVSELIK	2019	sp|Q16698-2|DECR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35	ms_run[2]:scan=18824	97.918	2	1603.7763	1603.7763	R	V	111	125
PSM	DSDDVPMVLVGNK	2020	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=16728	85.679	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	2021	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35	ms_run[2]:scan=17443	89.745	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	2022	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15675	79.986	2	1387.6653	1387.6653	K	C	105	118
PSM	DTDDVPMILVGNK	2023	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=17507	90.137	3	1415.6966	1415.6966	K	C	86	99
PSM	DVDGVTDINLGK	2024	sp|Q6UB35-2|C1TM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12920	65.888	2	1244.6248	1244.6248	K	L	178	190
PSM	DVEDEILWVGER	2025	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=20683	110.34	2	1458.6991	1458.6991	R	M	1493	1505
PSM	DVLLQVDDER	2026	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12435	63.504	2	1200.5986	1200.5986	K	R	1846	1856
PSM	EAALVQQEEEK	2027	sp|Q15020-4|SART3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4448	24.795	2	1272.6198	1272.6198	K	A	551	562
PSM	EADPESEADR	2028	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1315	9.1316	2	1117.4524	1117.4524	R	A	533	543
PSM	EAPALVAAGGAPEDDEEDDGR	2029	sp|Q8IWF6|DEN6A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10482	53.892	3	2082.8978	2082.8978	R	G	28	49
PSM	EASDPQPEEADGGLK	2030	sp|P52907|CAZA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5273	28.878	2	1541.6845	1541.6845	K	S	104	119
PSM	EAVCEVALDYK	2031	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:4	ms_run[2]:scan=12518	63.93	2	1295.6068	1295.6068	K	K	2259	2270
PSM	ECEDVMDWINDK	2032	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4,6-UNIMOD:35	ms_run[2]:scan=14897	75.932	2	1568.6123	1568.6123	R	E	157	169
PSM	EDAGDNDDTEGAIGVR	2033	sp|Q9H0S4-2|DDX47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6478	34.56	3	1632.6863	1632.6863	R	N	377	393
PSM	EDDVPQFTSAGENFDK	2034	sp|P28838-2|AMPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15021	76.584	2	1797.7693	1797.7693	K	L	15	31
PSM	EDEDALEQAR	2035	sp|O60885|BRD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4661	25.82	2	1174.5102	1174.5102	R	R	1264	1274
PSM	EEAPQWLESDSCQK	2036	sp|Q8IWB7|WDFY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:4	ms_run[2]:scan=12424	63.456	2	1705.7254	1705.7254	R	C	276	290
PSM	EEEPDSDYSVIR	2037	sp|Q9UGN4-3|CLM8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9835	50.904	2	1437.626	1437.6260	R	K	90	102
PSM	EELEELQEAFNK	2038	sp|Q14651|PLSI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=17820	91.971	2	1477.6937	1477.6937	R	I	11	23
PSM	EESDGEYDEFGR	2039	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8563	44.883	2	1431.5426	1431.5426	R	K	118	130
PSM	EESDSLGQDLR	2040	sp|O43293|DAPK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7898	41.458	2	1247.563	1247.5630	R	R	369	380
PSM	EEVNETYGDGDGR	2041	sp|Q96P47-5|AGAP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3272	19.085	2	1439.5801	1439.5801	K	T	480	493
PSM	EEVVGGDDSDGLR	2042	sp|P25490|TYY1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6253	33.502	2	1346.595	1346.5950	R	A	110	123
PSM	EEVVGGDDSDGLR	2043	sp|P25490|TYY1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6898	36.556	2	1346.595	1346.5950	R	A	110	123
PSM	EEYQLVQVEQK	2044	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10957	56.228	2	1391.6933	1391.6933	K	A	545	556
PSM	EGEELIQAEAR	2045	sp|Q96SQ9|CP2S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8784	45.925	2	1243.6044	1243.6044	R	C	144	155
PSM	EGEEPTVYSDEEEPKDESAR	2046	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=4515	25.161	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	2047	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=5251	28.763	2	2374.9326	2374.9326	K	K	121	141
PSM	EGEEPTVYSDEEEPKDESAR	2048	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=8684	45.464	3	2374.9326	2374.9326	K	K	121	141
PSM	EIEMSVDDDDINSSK	2049	sp|Q9NQW6-2|ANLN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35	ms_run[2]:scan=6895	36.54	2	1711.7094	1711.7094	R	V	512	527
PSM	EISEGDEVEVYSR	2050	sp|P51114-2|FXR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10178	52.471	2	1510.6787	1510.6787	K	A	58	71
PSM	ELGATECINPQDYK	2051	sp|P00325-2|ADH1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:4	ms_run[2]:scan=12091	61.695	2	1636.7403	1636.7403	K	K	195	209
PSM	ELISNASDALDK	2052	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8971	46.802	2	1274.6354	1274.6354	R	I	42	54
PSM	EMDEAATAEER	2053	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3333	19.391	2	1250.5085	1250.5085	K	G	671	682
PSM	ENEGFTVTAEGK	2054	sp|P01024|CO3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7529	39.737	2	1280.5885	1280.5885	K	G	1326	1338
PSM	EQESEKPSQELLEYNIQQK	2055	sp|Q99996-5|AKAP9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=14223	72.38	3	2399.0894	2399.0894	R	Q	3061	3080
PSM	ESEDKPEIEDVGSDEEEEK	2056	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=7468	39.39	3	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	2057	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=8696	45.525	3	2271.8792	2271.8792	K	K	251	270
PSM	ESQHIPTAEGASGSNTEEEIR	2058	sp|Q63ZY3-3|KANK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21	ms_run[2]:scan=9243	48.063	2	2320.9809	2320.9809	R	M	567	588
PSM	ETEEILADVLK	2059	sp|P56537|IF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=19268	100.75	2	1258.6656	1258.6656	R	V	124	135
PSM	ETTCSKESNEELTESCETK	2060	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,4-UNIMOD:4,16-UNIMOD:4	ms_run[2]:scan=3151	18.468	3	2340.8975	2340.8975	R	K	289	308
PSM	ETTCSKESNEELTESCETK	2061	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=4600	25.536	2	2340.8975	2340.8975	R	K	289	308
PSM	EVAATEEDVTR	2062	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3952	22.422	2	1218.5728	1218.5728	K	L	641	652
PSM	EVEVEVESMDK	2063	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35	ms_run[2]:scan=5706	30.977	2	1308.5755	1308.5755	R	A	593	604
PSM	EVEVEVESMDK	2064	sp|Q7KZF4|SND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35	ms_run[2]:scan=5804	31.439	2	1308.5755	1308.5755	R	A	593	604
PSM	EVLEDFAEDGEK	2065	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13261	67.646	2	1379.6093	1379.6093	K	K	876	888
PSM	EYELLSDELNQK	2066	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16124	82.3	2	1479.7093	1479.7093	K	S	515	527
PSM	EYEVDNDGVFEK	2067	sp|Q9ULG6-3|CCPG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11473	58.693	2	1442.6202	1442.6202	K	L	330	342
PSM	EYTDVYPEIIER	2068	sp|Q9UNF1-2|MAGD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16519	84.458	2	1525.73	1525.7300	K	A	294	306
PSM	EYVSNDAAQSDDEEKLQSQPTDTDGGR	2069	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=8590	45.014	3	3034.2313	3034.2313	K	L	369	396
PSM	FEDEDSDDVPR	2070	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5617	30.49	2	1322.5263	1322.5263	K	K	698	709
PSM	FEDEDSDDVPR	2071	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5821	31.512	2	1322.5263	1322.5263	K	K	698	709
PSM	FTDEEVDEMYR	2072	sp|P24844-2|MYL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35	ms_run[2]:scan=9143	47.625	2	1448.5766	1448.5766	R	E	80	91
PSM	GAEEMETVIPVDVMR	2073	sp|Q99497|PARK7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=13256	67.617	2	1706.7855	1706.7855	K	R	13	28
PSM	GDACDDDIDGDR	2074	sp|P49747-2|COMP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:4	ms_run[2]:scan=2271	13.97	2	1322.4681	1322.4681	R	I	315	327
PSM	GDDEEWNEVLNK	2075	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14568	74.242	2	1446.6263	1446.6263	R	A	895	907
PSM	GDVDDPLLDMK	2076	sp|Q9P2N6-8|KANL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:35	ms_run[2]:scan=11501	58.833	2	1232.5595	1232.5595	R	T	300	311
PSM	GEDNAIEMSEDFDGK	2077	sp|Q9NU22|MDN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:35	ms_run[2]:scan=9428	48.958	2	1671.657	1671.6570	K	M	4722	4737
PSM	GEDVENEEDEFAR	2078	sp|Q05823-2|RN5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9707	50.308	2	1537.6169	1537.6169	R	N	450	463
PSM	GENPFEIQDHSQDQQIEGDEEDEEK	2079	sp|Q5BKZ1-3|ZN326_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=14364	73.139	3	3024.1782	3024.1782	K	I	262	287
PSM	GGDEEENDEPPK	2080	sp|Q9UKX7-2|NUP50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1002	7.6679	2	1314.5212	1314.5212	K	V	307	319
PSM	GGSDDSSKDPIDVNYEK	2081	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=9378	48.691	3	1904.7677	1904.7677	R	L	780	797
PSM	GLEDTDGDGDSGK	2082	sp|Q8N8A6|DDX51_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1540	10.257	2	1264.5055	1264.5055	R	Y	460	473
PSM	GPAAPLTPGPQSPPTPLAPGQEK	2083	sp|O75398-5|DEAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=14104	71.781	2	2287.125	2287.1250	K	G	165	188
PSM	GPVAVTGASTPEGTAPPPPAAPAPPK	2084	sp|Q9H0W8-2|SMG9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=11386	58.276	3	2414.1883	2414.1883	K	G	109	135
PSM	GQEVETSVTYYR	2085	sp|O43169|CYB5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9440	49.019	2	1430.6678	1430.6678	K	L	13	25
PSM	GSDALSETSSVSHIEDLEK	2086	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21	ms_run[2]:scan=16040	81.852	2	2082.8994	2082.8994	R	V	622	641
PSM	GTSTQGTSTHASSTQLAMVDDQR	2087	sp|Q9NPG1|FZD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=7167	37.908	3	2474.0381	2474.0381	R	S	550	573
PSM	GYEIDEDIVSR	2088	sp|O14656|TOR1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13384	68.262	2	1294.6041	1294.6041	R	V	289	300
PSM	IEDMDDNCYLK	2089	sp|P09326|CD48_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=7679	40.455	2	1430.5694	1430.5694	K	L	141	152
PSM	IEDVGSDEEDDSGKDK	2090	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=2165	13.406	2	1816.6888	1816.6888	K	K	250	266
PSM	IPSAVSTVSMQNIHPK	2091	sp|P19634|SL9A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=11394	58.302	2	1883.8254	1883.8254	K	S	597	613
PSM	IQDYDVSLDK	2092	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10127	52.237	2	1194.5768	1194.5768	R	A	730	740
PSM	IYEDGDDDMK	2093	sp|Q9HB71-3|CYBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35	ms_run[2]:scan=1275	8.9507	2	1215.4601	1215.4601	K	R	155	165
PSM	LDDNEALIEK	2094	sp|P61011-2|SRP54_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8544	44.79	2	1158.5768	1158.5768	K	L	263	273
PSM	LDQEVAEVDK	2095	sp|Q99816-2|TS101_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5510	29.995	2	1144.5612	1144.5612	R	N	172	182
PSM	LDSSEMDHSENEDYTMSSPLPGK	2096	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=9846	50.954	3	2680.0194	2680.0194	R	K	1174	1197
PSM	LDTDDLDEIEK	2097	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12514	63.912	2	1304.5984	1304.5984	R	I	357	368
PSM	LESIDNHSSTGGQSDQGYGSK	2098	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=5166	28.324	3	2245.9125	2245.9125	R	D	951	972
PSM	LESIDNHSSTGGQSDQGYGSK	2099	sp|Q5VZ89-7|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=5725	31.084	3	2245.9125	2245.9125	R	D	951	972
PSM	LPDSDDDEDEETAIQR	2100	sp|Q96K21-4|ANCHR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8525	44.704	3	1846.7705	1846.7705	R	V	176	192
PSM	LQPTPPIPAPAPK	2101	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=11415	58.416	2	1405.7371	1405.7371	R	P	254	267
PSM	LQVDMDELEEK	2102	sp|P82094|TMF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35	ms_run[2]:scan=9877	51.102	2	1363.6177	1363.6177	R	N	642	653
PSM	LSADTYEDLK	2103	sp|Q8IY22-3|CMIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10245	52.78	2	1153.5503	1153.5503	K	A	594	604
PSM	LSDYDSSEEAIR	2104	sp|Q6PGP7|TTC37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7961	41.862	2	1383.6154	1383.6154	K	T	363	375
PSM	LTDEEVEMTR	2105	sp|Q10713|MPPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:35	ms_run[2]:scan=4852	26.788	2	1237.5496	1237.5496	R	M	176	186
PSM	MPEEEDEAPVLDVR	2106	sp|Q9UKL0|RCOR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35	ms_run[2]:scan=12459	63.611	2	1643.7349	1643.7349	K	Y	467	481
PSM	NDQDTWDYTNPNLSGQGDPGSNPNK	2107	sp|P14866-2|HNRPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13509	68.842	3	2733.1539	2733.1539	K	R	145	170
PSM	NLSPTPASPNQGPPPQVPVSPGPPK	2108	sp|Q9C0E8-3|LNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=13048	66.511	3	2539.2472	2539.2472	R	D	52	77
PSM	NPDDITQEEYGEFYK	2109	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15036	76.664	2	1846.7897	1846.7897	R	S	292	307
PSM	NSQEDSEDSEDKDVK	2110	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=973	7.5369	2	1803.6684	1803.6684	K	T	53	68
PSM	NSSEASSGDFLDLK	2111	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15027	76.619	2	1468.6682	1468.6682	R	G	40	54
PSM	NTGTEAPDYLATVDVDPK	2112	sp|Q13228-3|SBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16285	83.19	2	1904.9004	1904.9004	R	S	35	53
PSM	NVELQCLDADDAK	2113	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4	ms_run[2]:scan=12751	65.082	2	1489.6719	1489.6719	R	A	815	828
PSM	PAEAPMPAEPAPPGPASPGGAPEPPAAAR	2114	sp|Q9HBB8-2|CDHR5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=11030	56.569	3	2753.252	2753.2520	K	A	544	573
PSM	QAWATDDVAQIYDK	2115	sp|A5YKK6-3|CNOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=16324	83.422	2	1622.7577	1622.7577	K	C	1596	1610
PSM	QDNYNEEVADLK	2116	sp|Q8N3C0-3|ASCC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10323	53.147	2	1436.642	1436.6420	K	I	19	31
PSM	QDVDDEYGVSQALAR	2117	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13322	67.958	3	1664.7642	1664.7642	K	G	712	727
PSM	QEVEENLNEVYR	2118	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11431	58.492	2	1520.7107	1520.7107	R	Q	845	857
PSM	QGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVK	2119	sp|Q13263-2|TIF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=15871	80.994	3	3652.4937	3652.4937	K	R	353	388
PSM	QIQQELEQCDVPEDVR	2120	sp|Q9ULX3|NOB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:4	ms_run[2]:scan=13482	68.725	2	1984.916	1984.9160	K	V	216	232
PSM	QLEEEQQALQK	2121	sp|P07951|TPM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5797	31.41	2	1342.6729	1342.6729	K	K	38	49
PSM	QLEVEPEEPEAENK	2122	sp|P36776-3|LONM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8495	44.536	2	1639.7577	1639.7577	R	H	23	37
PSM	QLQQAQAAGAEQEVEK	2123	sp|P39748-2|FEN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6818	36.164	2	1726.8486	1726.8486	K	F	46	62
PSM	QQQEEEDLNLEDR	2124	sp|Q5T3I0|GPTC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9109	47.467	2	1644.7227	1644.7227	R	G	340	353
PSM	QSFDDNDSEELEDK	2125	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8360	43.909	2	1669.6591	1669.6591	K	D	106	120
PSM	QVCGDSIKPEETEQEVAADETR	2126	sp|Q96GM8-2|TOE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=12037	61.424	3	2570.0844	2570.0844	K	N	289	311
PSM	RALSSDSILSPAPDAR	2127	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=12662	64.637	2	1814.7965	1814.7965	R	A	391	407
PSM	RLEISPDSSPER	2128	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=6724	35.695	2	1544.6273	1544.6273	R	A	147	159
PSM	RLEISPDSSPER	2129	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=7343	38.779	2	1544.6273	1544.6273	R	A	147	159
PSM	RLEISPDSSPER	2130	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=7564	39.924	2	1544.6273	1544.6273	R	A	147	159
PSM	RLSPSASPPR	2131	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=4115	23.259	2	1226.521	1226.5210	R	R	386	396
PSM	SAVESGQADDER	2132	sp|P78318|IGBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=914	7.2546	2	1262.5375	1262.5375	K	V	177	189
PSM	SDIVDSLDEDR	2133	sp|Q8IY33-3|MILK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12506	63.872	2	1262.5626	1262.5626	R	L	441	452
PSM	SEDGVEGDLGETQSR	2134	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=7222	38.183	3	1577.6805	1577.6805	K	T	135	150
PSM	SEETLDEGPPK	2135	sp|Q00688|FKBP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4635	25.687	2	1200.551	1200.5510	K	Y	100	111
PSM	SELLGTDSAEPEMDVR	2136	sp|Q9NZ43-2|USE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:35	ms_run[2]:scan=11307	57.884	2	1763.7884	1763.7884	R	K	123	139
PSM	SETAPAETATPAPVEKSPAK	2137	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	17-UNIMOD:21	ms_run[2]:scan=6294	33.685	2	2060.9667	2060.9667	M	K	2	22
PSM	SFSPKSPLELGEK	2138	sp|Q15742-2|NAB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=14984	76.391	2	1577.678	1577.6780	R	L	157	170
PSM	SGDEEFKGEDELCDSGR	2139	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10480	53.887	3	2008.7357	2008.7357	R	Q	339	356
PSM	SGEEDEEILFK	2140	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14139	71.957	2	1294.5929	1294.5929	K	E	2925	2936
PSM	SGTPTQDEMMDKPTSSSVDTMSLLSK	2141	sp|Q5VT52-5|RPRD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,10-UNIMOD:35,21-UNIMOD:35	ms_run[2]:scan=13170	67.179	3	2884.2065	2884.2065	R	I	704	730
PSM	SGVGTGPPSPIALPPLR	2142	sp|Q92630|DYRK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=18771	97.605	2	1694.8757	1694.8757	R	A	40	57
PSM	SSPPAPPLPPGSGSPGTPQALPR	2143	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=14274	72.636	2	2244.094	2244.0940	R	R	585	608
PSM	STPESGDSDKESVGSSSTSNEGGR	2144	sp|Q6GQQ9-2|OTU7B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=1633	10.742	3	2435.9562	2435.9562	R	R	460	484
PSM	STSDLDKDDASYLR	2145	sp|Q8TEP8|CE192_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=10333	53.193	3	1664.6931	1664.6931	R	L	565	579
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	2146	sp|Q9BY89-2|K1671_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[2]:scan=9351	48.559	3	3138.2319	3138.2319	R	R	103	132
PSM	SVKEDSNLTLQEK	2147	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=7134	37.753	2	1569.7287	1569.7287	K	K	1443	1456
PSM	SYNPFDDDGEDEGAR	2148	sp|O95721|SNP29_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11484	58.751	2	1685.6441	1685.6441	K	P	7	22
PSM	TDCDIEDDR	2149	sp|Q13085-3|ACACA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4	ms_run[2]:scan=2748	16.448	2	1137.4244	1137.4244	K	L	1217	1226
PSM	TDDYLDQPCLETVNR	2150	sp|P31150|GDIA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:4	ms_run[2]:scan=14564	74.219	2	1837.8152	1837.8152	R	I	194	209
PSM	TDTDLYEFAK	2151	sp|Q96BP3-2|PPWD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13593	69.252	2	1201.5503	1201.5503	K	C	113	123
PSM	TDTESELDLISR	2152	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14670	74.748	2	1377.6624	1377.6624	K	L	761	773
PSM	TEELEEESFPER	2153	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11127	57.044	2	1493.6522	1493.6522	K	S	487	499
PSM	TEEPLFQVEDSSK	2154	sp|Q8NBF6-2|AVL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13937	71.006	2	1507.7042	1507.7042	K	G	293	306
PSM	TIQDGDSDELTIK	2155	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9825	50.859	2	1433.6886	1433.6886	K	R	1149	1162
PSM	TIQDGDSDELTIK	2156	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9714	50.344	2	1433.6886	1433.6886	K	R	1149	1162
PSM	TLSSPSLQTDGIAATPVPPPPPPK	2157	sp|Q9H7D0|DOCK5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=16264	83.072	3	2447.2349	2447.2349	R	S	1800	1824
PSM	TSDANETEDHLESLICK	2158	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=17548	90.365	2	2040.8347	2040.8347	K	V	21	38
PSM	TSSEGETKPQTSTVNK	2159	sp|Q6UY01-3|LRC31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=954	7.4233	2	1772.783	1772.7830	K	F	8	24
PSM	TTEYQLSTLEER	2160	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12851	65.555	2	1468.7046	1468.7046	K	D	381	393
PSM	TTKTPEDGDYSYEIIEK	2161	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=13074	66.66	3	2067.8926	2067.8926	K	T	1929	1946
PSM	TTYDSAEEENKENLYAGK	2162	sp|Q9HAW4-2|CLSPN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=8405	44.112	3	2140.8838	2140.8838	K	N	79	97
PSM	TYVGVVDGENELASPK	2163	sp|P09327-2|VILI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12638	64.523	2	1676.8257	1676.8257	R	L	206	222
PSM	VDADDIVEK	2164	sp|Q5T8I3-2|F102B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6649	35.345	2	1002.487	1002.4870	R	I	301	310
PSM	VDDDFTAQDYR	2165	sp|Q8IUI8-2|CRLF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9172	47.757	2	1343.563	1343.5630	K	L	198	209
PSM	VEAPEYIPISDDPK	2166	sp|Q1ED39|KNOP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14214	72.329	2	1571.7719	1571.7719	K	A	250	264
PSM	VEDVVVSDECR	2167	sp|Q96EK6|GNA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:4	ms_run[2]:scan=6501	34.665	2	1305.5871	1305.5871	R	G	119	130
PSM	VESLDVDSEAK	2168	sp|P49321|NASP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6522	34.761	2	1190.5667	1190.5667	K	K	34	45
PSM	VLSDSEDEEKDADVPGTSTR	2169	sp|Q8WWQ0|PHIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=9687	50.212	3	2228.9322	2228.9322	K	K	1279	1299
PSM	VTYTGDGSEHEGDTPELEAEPPR	2170	sp|Q96N77-2|ZN641_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=11219	57.478	3	2565.0544	2565.0544	R	M	170	193
PSM	VVGDVAYDEAK	2171	sp|P11586|C1TC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6390	34.158	2	1164.5663	1164.5663	K	E	252	263
PSM	YAEEELEQVR	2172	sp|Q13586-2|STIM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9811	50.792	2	1264.5935	1264.5935	K	E	316	326
PSM	YDEAASYIQSK	2173	sp|P04899-6|GNAI2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8274	43.477	2	1273.5826	1273.5826	K	F	245	256
PSM	YDIEDGEAIDSR	2174	sp|Q13576-3|IQGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9761	50.572	2	1381.5998	1381.5998	K	S	782	794
PSM	YDIEDGEAIDSR	2175	sp|Q13576-3|IQGA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10011	51.703	2	1381.5998	1381.5998	K	S	782	794
PSM	YEEEEEQSR	2176	sp|Q9Y5B9|SP16H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=949	7.406	2	1197.4786	1197.4786	R	S	1006	1015
PSM	YEEIDNAPEER	2177	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5934	32.031	2	1363.5892	1363.5892	K	A	92	103
PSM	YEIEETETVTK	2178	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8704	45.559	2	1340.6347	1340.6347	R	S	154	165
PSM	YLMEEDEDAYK	2179	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35	ms_run[2]:scan=7104	37.613	2	1420.5704	1420.5704	R	K	210	221
PSM	YLTESYGTGQDIDDR	2180	sp|Q9UM54-5|MYO6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10597	54.447	3	1731.7588	1731.7588	R	I	167	182
PSM	YTGEDFDEDLR	2181	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12065	61.551	2	1358.5626	1358.5626	K	T	2967	2978
PSM	VDVEVPDVSLEGPEGK	2182	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=17085	87.71380666666667	2	1667.828257	1667.825397	K	L	1290	1306
PSM	EDQSILCTGESGAGK	2183	sp|P35580|MYH10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:4	ms_run[1]:scan=8227	43.243613333333336	2	1550.689679	1550.688252	R	T	170	185
PSM	ELEDVTESAESMNR	2184	sp|Q7Z406|MYH14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=11283	57.77676999999999	2	1608.693519	1608.693731	R	E	1923	1937
PSM	EISDDEAEEEKGEK	2185	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:27,3-UNIMOD:21	ms_run[1]:scan=6080	32.72002333333334	2	1668.6401	1668.6398	K	E	224	238
PSM	EDEGEEAASPMLQIQR	2186	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:35	ms_run[1]:scan=10172	52.44524333333334	2	1818.799049	1817.810158	K	D	2402	2418
PSM	EFDEDSDEKEEEEDTYEK	2187	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:21	ms_run[1]:scan=8499	44.55786	2	2345.830747	2344.826789	R	V	619	637
PSM	CDYMDEVTYGELEK	2188	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:4	ms_run[1]:scan=16444	84.04560333333333	2	1749.677091	1750.706604	K	E	602	616
PSM	QNGDDPLLTYR	2189	sp|P02545|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=13510	68.84606	2	1273.5932	1273.5934	R	F	472	483
PSM	LGIYDADGDGDFDVDDAK	2190	sp|Q12797|ASPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=17673	91.12016	2	1899.794415	1899.801033	K	V	87	105
PSM	SNQQLENDLNLMDIK	2191	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	12-UNIMOD:35	ms_run[1]:scan=15842	80.85594666666667	2	1790.8382	1789.8512	R	I	902	917
PSM	VGGTSDVEVNEK	2192	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3368	19.566993333333333	2	1233.574032	1232.588461	K	K	406	418
PSM	LLDAEDVDVPSPDEK	2193	sp|Q9UPN3|MACF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=14195	72.23888333333333	2	1641.754620	1640.778112	R	S	270	285
PSM	IEENSLKEEESIEGEK	2194	sp|Q14839|CHD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:21	ms_run[1]:scan=9311	48.372105	2	1942.853301	1941.845614	K	E	1566	1582
PSM	IEYNDQNDGSCDVK	2195	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	11-UNIMOD:4	ms_run[1]:scan=4751	26.248211666666663	2	1656.6582	1655.6732	K	Y	594	608
PSM	SSGERARETGGAEGTGDAVLGEK	2196	sp|Q92667|AKAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6889	36.512366666666665	3	2233.046696	2233.057081	R	V	191	214
PSM	EVEDKESEGEEEDEDEDLSK	2197	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:21	ms_run[1]:scan=5600	30.41678	3	2419.900793	2418.895931	K	Y	147	167
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	2198	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:21	ms_run[1]:scan=5434	29.63922833333333	3	3337.338675	3336.355264	R	R	157	186
PSM	SETAPAETATPAPVEKSPAK	2199	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7615	40.153886666666665	2	2102.9797	2102.9768	M	K	2	22
PSM	DTSQSDKDLDDALDK	2200	sp|P20810|ICAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:21	ms_run[1]:scan=9885	51.133045	2	1744.704031	1744.704035	R	L	559	574
PSM	DSDDYAQLCNIPVTGR	2201	sp|Q14766|LTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:4	ms_run[1]:scan=16560	84.69072666666668	2	1823.802372	1822.815577	K	R	1569	1585
PSM	GVEEEEEDGEMRE	2202	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:35	ms_run[1]:scan=3781	21.62179666666667	2	1552.587272	1552.583512	R	-	74	87
PSM	CELLYEGPPDDEAAMGIK	2203	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4,15-UNIMOD:35	ms_run[1]:scan=19686	103.570475	2	2005.8725	2005.8644	R	S	369	387
PSM	QGSGSSQPMEVQEGYGFGSGDDPYSSAEPHVSGVK	2204	sp|Q13263|TIF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:21	ms_run[1]:scan=16952	86.96076166666667	3	3635.472611	3636.498817	K	R	435	470
PSM	GTDDSPKDSQEDLQER	2205	sp|Q969E4|TCAL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:21	ms_run[1]:scan=3683	21.162951666666665	3	1900.760461	1898.753110	R	H	117	133
PSM	ADFDDRVSDEEK	2206	sp|P52907|CAZA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=8873	46.339573333333334	2	1466.6149	1466.6156	M	V	2	14
PSM	ILQEYQVQYTPQGDSDNGK	2207	sp|O94925|GLSK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=12533	63.99947333333333	2	2183.005120	2182.017842	K	E	638	657
PSM	AEAESMYQIK	2208	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:35	ms_run[1]:scan=4947	27.289081666666664	2	1184.538698	1184.538340	R	Y	276	286
PSM	DVDASPSPLSVQDLK	2209	sp|Q8IWZ8|SUGP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=15284	77.92144	2	1569.790592	1569.788617	R	G	405	420
PSM	EIAEAYDVLSDPR	2210	sp|P25685|DNJB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:27	ms_run[1]:scan=20918	111.97851999999999	2	1458.6999	1458.6985	K	K	47	60
PSM	GCEDVDDTLSVR	2211	sp|Q8TF46|DI3L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:4	ms_run[1]:scan=9640	49.994755	2	1365.606514	1364.587809	K	T	481	493
PSM	AGGEEEDDDDEAAGGR	2212	sp|Q6DD87|ZN787_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1127	8.218065	2	1591.587439	1591.587017	R	C	357	373
PSM	VDVDEYDENK	2213	sp|O15511|ARPC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=5670	30.760498333333334	2	1224.516451	1224.514627	K	F	14	24
PSM	FTDEEVDELYR	2214	sp|P19105|ML12A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=15435	78.702735	2	1415.650486	1414.625240	R	E	133	144
PSM	VQGSDSDEEVVVATTR	2215	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9025	47.062486666666665	2	1690.803016	1690.800973	K	I	522	538
PSM	SISVPPSPSDIPPPGPPR	2216	sp|Q6IQ23|PKHA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:21	ms_run[1]:scan=15426	78.65796999999999	2	1876.918419	1875.913180	R	V	563	581
PSM	QIQQELEQCDVPEDVR	2217	sp|Q9ULX3|NOB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,9-UNIMOD:4	ms_run[1]:scan=17627	90.83873666666668	2	1967.8920	1967.8889	K	V	216	232
PSM	KGGSYSQAASSDSAQGSDVSLTACK	2218	sp|P01892|1A02_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	17-UNIMOD:21,20-UNIMOD:21,24-UNIMOD:4	ms_run[1]:scan=7407	39.09057166666667	3	2623.059297	2621.035373	R	V	340	365
PSM	LQAALEAEEPDDER	2219	sp|Q9BUJ2|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9205	47.90922333333334	2	1584.728177	1584.726745	R	E	33	47
PSM	EDYDSVEQDGDEPGPQR	2220	sp|Q9Y5S9|RBM8A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7385	38.97774833333333	3	1935.785256	1934.776609	R	S	52	69
PSM	DLGGFDEDAEPR	2221	sp|Q9BRK5|CAB45_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=11043	56.63133666666667	2	1319.564053	1319.562974	K	R	86	98
PSM	ADGGTQVIDTK	2222	sp|P09622|DLDH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3040	17.943406666666668	2	1103.546356	1103.545868	K	N	167	178
PSM	LDQMDEDELER	2223	sp|O14530|TXND9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:35	ms_run[1]:scan=6666	35.416995	2	1407.584646	1407.582390	K	L	36	47
PSM	QDDSPPRPIIGPALPPGFIK	2224	sp|Q8IXQ4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=22001	119.86793999999999	2	2178.0962	2177.0912	K	S	102	122
PSM	QDDSPPRPIIGPALPPGFIK	2225	sp|Q8IXQ4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=22143	120.87784333333333	2	2177.0944	2177.0917	K	S	102	122
PSM	SEMEVQDAELK	2226	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:35	ms_run[1]:scan=5390	29.421948333333333	2	1293.577504	1293.575848	K	A	345	356
PSM	TSLEDFYLDEER	2227	sp|P36955|PEDF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=18220	94.24820833333334	2	1515.674578	1515.672919	K	T	226	238
PSM	ENPPVEDSSDEDDKR	2228	sp|Q8TCJ2|STT3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:27	ms_run[1]:scan=3494	20.225913333333335	2	1712.7002	1712.7122	R	N	491	506
PSM	ETTCSKESNEELTESCETK	2229	sp|P01042|KNG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=3566	20.598958333333336	2	2341.902628	2340.897468	R	K	325	344
PSM	ETTCSKESNEELTESCETK	2230	sp|P01042|KNG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:4,8-UNIMOD:21,16-UNIMOD:4	ms_run[1]:scan=4666	25.84261	2	2341.887642	2340.897468	R	K	325	344
PSM	VFSNGADLSGVTEEAPLK	2231	sp|P01009|A1AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=17061	87.58355	2	1833.902163	1832.915609	K	L	335	353
PSM	MEADKDDTQQILK	2232	sp|Q13287|NMI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=11938	60.956965000000004	2	1575.7465	1575.7445	-	E	1	14
PSM	VEAPEYIPISDDPK	2233	sp|Q1ED39|KNOP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=14265	72.59162333333333	2	1571.773414	1571.771905	K	A	250	264
PSM	QMDESEQYLYGDDR	2234	sp|Q92845|KIFA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:35	ms_run[1]:scan=9245	48.07549	2	1764.686349	1763.694459	R	I	691	705
PSM	GDVVNQDDLYQALASGK	2235	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=18762	97.55166166666667	2	1792.849907	1791.863908	R	I	246	263
PSM	DFPELTMEVDGK	2236	sp|P38606|VATA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:35	ms_run[1]:scan=14725	75.05456666666666	2	1395.623470	1395.622798	R	V	290	302
PSM	EYCGVPGDGDEELLR	2237	sp|P02760|AMBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:4	ms_run[1]:scan=14544	74.10846833333333	2	1707.739220	1707.741015	R	F	335	350
PSM	QNVDVEAEDKDGDR	2238	sp|Q86YT6|MIB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=5512	30.002384999999997	2	1571.6721	1571.6694	K	A	486	500
PSM	QDLPNAMNAAEITDK	2239	sp|P84077|ARF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:35	ms_run[1]:scan=10673	54.80397666666667	2	1646.749104	1645.761751	K	L	128	143
PSM	SSGEIVYCGQVFEK	2240	sp|Q02543|RL18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:4	ms_run[1]:scan=13981	71.19984166666666	2	1601.738569	1601.739559	K	S	57	71
PSM	DISSSLNSLADSNAR	2241	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=15578	79.47426166666666	2	1549.7232	1548.7372	R	E	50	65
PSM	QLTQPETHFGR	2242	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=12888	65.73987	2	1375.5934	1375.5917	K	E	289	300
PSM	ALEKNTNVEAR	2243	sp|Q14517|FAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10663	54.75998166666667	2	1243.632371	1243.652064	K	T	122	133
PSM	EYEGYEVESSLK	2244	sp|Q96RT6|CTGE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=11745	60.02728333333334	2	1430.651744	1431.640556	K	N	72	84
PSM	LEELDDFEEGSQK	2245	sp|Q7Z3J2|CP062_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=13513	68.85678333333334	2	1540.669529	1537.678398	R	E	162	175
PSM	SVTEQGAELSNEER	2246	sp|P63104|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6599	35.11553	2	1548.693049	1547.706344	K	N	28	42
PSM	EVAEAATGEDASSPPPK	2247	sp|Q99536|VAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3759	21.520265	2	1654.770399	1654.768610	R	T	6	23
PSM	IEYNDQNDGSCDVK	2248	sp|O75369|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:4	ms_run[1]:scan=5032	27.7073	2	1656.659514	1655.673330	K	Y	594	608
PSM	SAAPSALGSGSPDSVAK	2249	sp|Q9P2J2|TUTLA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:21,14-UNIMOD:21	ms_run[1]:scan=8946	46.68851666666667	2	1660.695943	1660.674663	K	L	787	804
PSM	VDGIPNDSSDSEMEDK	2250	sp|Q9H6S0|YTDC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	13-UNIMOD:35	ms_run[1]:scan=5481	29.850488333333335	2	1753.698507	1752.699604	R	T	1082	1098
PSM	QDENDDDDDWNPCK	2251	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	13-UNIMOD:4	ms_run[1]:scan=9484	49.233536666666666	2	1763.588497	1764.616937	K	A	333	347
PSM	IGGDAGTSLNSNDYGYGGQK	2252	sp|Q96AE4|FUBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=10189	52.519626666666674	2	1974.847353	1972.876263	K	R	45	65
PSM	QLSALSSDGEGQGRPVPR	2253	sp|O15438|MRP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21,7-UNIMOD:21	ms_run[1]:scan=9752	50.529201666666665	2	2012.875216	2012.871800	R	R	906	924
PSM	STSVDHSSTDLESTDGMEGPPPPDACPEK	2254	sp|Q9BY89|K1671_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:21,17-UNIMOD:35,26-UNIMOD:4	ms_run[1]:scan=9307	48.35315	3	3138.234342	3138.231887	R	R	1596	1625
PSM	SNVCINGNHVYLEQPEAK	2255	sp|Q6WKZ4|RFIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:21,4-UNIMOD:4	ms_run[1]:scan=12898	65.78335	2	2151.929063	2150.945620	R	G	315	333
PSM	TGSTPSIASTHSELSTYSNNSGNAAVIK	2256	sp|Q9ULD2|MTUS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:21	ms_run[1]:scan=14560	74.19658666666668	3	2874.296321	2873.308027	R	Y	797	825
PSM	AAAEVNQDYGLDPK	2257	sp|P07954-2|FUMH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9028	47.077	2	1489.7049	1489.7049	R	I	59	73
PSM	AAEDDEDDDVDTKK	2258	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=957	7.4408	2	1644.604	1644.6040	R	Q	90	104
PSM	AAPEASSPPASPLQHLLPGK	2259	sp|Q96TA1-2|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=18044	93.225	2	2126.9803	2126.9803	K	A	673	693
PSM	AAPEASSPPASPLQHLLPGK	2260	sp|Q96TA1-2|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=18219	94.244	2	2126.9803	2126.9803	K	A	673	693
PSM	AASAYAVGDVK	2261	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5993	32.329	2	1050.5346	1050.5346	R	C	326	337
PSM	ADDDDVVVK	2262	sp|Q9Y4G6|TLN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3232	18.886	2	974.45566	974.4557	K	T	2483	2492
PSM	ADLAEEYSK	2263	sp|P68036-2|UB2L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5765	31.272	2	1024.4713	1024.4713	R	D	91	100
PSM	ADSHEGEVAEGK	2264	sp|Q99704-3|DOK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=860	7.0157	2	1307.5031	1307.5031	R	L	128	140
PSM	AEELLAEEK	2265	sp|O00429-7|DNM1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6875	36.439	2	1030.5183	1030.5183	K	S	395	404
PSM	AESDGEEKEEVK	2266	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=926	7.3083	2	1428.5657	1428.5657	K	E	2599	2611
PSM	AESEEMETSQAGSK	2267	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=684	6.1066	2	1498.6093	1498.6093	K	D	544	558
PSM	AESEQEAYLR	2268	sp|Q9NR28-2|DBLOH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5968	32.188	2	1194.5517	1194.5517	R	E	175	185
PSM	AKTQTPPVSPAPQPTEER	2269	sp|Q14247|SRC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=4898	27.025	2	2092.9232	2092.9232	R	L	397	415
PSM	ALEETQVSLDER	2270	sp|Q9H8L6|MMRN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10252	52.814	2	1388.6783	1388.6783	R	R	514	526
PSM	ALQPLEEGEDEEK	2271	sp|Q14764|MVP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7921	41.567	2	1485.6835	1485.6835	R	V	336	349
PSM	APSTPVPPSPAPAPGLTK	2272	sp|Q96EZ8-3|MCRS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=11231	57.528	2	1763.8859	1763.8859	K	R	87	105
PSM	ASSLDAHEETISIEK	2273	sp|Q8TF05-2|PP4R1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=10581	54.363	2	1708.7557	1708.7557	R	R	519	534
PSM	ASVDSGSSEEQGGSSR	2274	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=719	6.2765	2	1538.6445	1538.6445	R	A	623	639
PSM	ATDGVTLTGINQTGDQSLPSKPSSVSSYEK	2275	sp|Q9UNF0-2|PACN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	20-UNIMOD:21	ms_run[2]:scan=15876	81.021	3	3146.4656	3146.4656	K	T	320	350
PSM	CDVDETVSSATLSEETEKPK	2276	sp|O14981-2|BTAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=10485	53.908	3	2303.9716	2303.9716	K	L	370	390
PSM	CTEDMTEDELR	2277	sp|Q13148|TADBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:4	ms_run[2]:scan=7827	41.141	2	1397.5439	1397.5439	R	E	198	209
PSM	DADIGVAEAER	2278	sp|Q14254|FLOT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6867	36.406	2	1144.536	1144.5360	R	D	178	189
PSM	DADSSISVLEIHSQK	2279	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=13994	71.266	2	1707.7717	1707.7717	K	A	260	275
PSM	DAEDAVYGR	2280	sp|Q07955-3|SRSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4333	24.284	2	994.43559	994.4356	R	D	66	75
PSM	DAIAQAEMDLK	2281	sp|Q8NE86-3|MCU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=14702	74.927	2	1219.5755	1219.5755	K	R	273	284
PSM	DALNIETAIK	2282	sp|P07355|ANXA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14542	74.097	2	1086.5921	1086.5921	R	T	38	48
PSM	DAQRLSPIPEEVPK	2283	sp|Q96T23-3|RSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=13024	66.385	2	1657.8077	1657.8077	K	S	347	361
PSM	DDATPVRDEPMDAESITFK	2284	sp|Q7Z6E9-2|RBBP6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=13565	69.113	2	2231.9294	2231.9294	R	S	947	966
PSM	DDATPVRDEPMDAESITFK	2285	sp|Q7Z6E9-2|RBBP6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=15923	81.264	3	2215.9344	2215.9344	R	S	947	966
PSM	DDDDVVIGK	2286	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5398	29.466	2	974.45566	974.4557	K	V	171	180
PSM	DDDDVVIGK	2287	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5614	30.481	2	974.45566	974.4557	K	V	171	180
PSM	DDDDVVIGK	2288	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5820	31.509	2	974.45566	974.4557	K	V	171	180
PSM	DDDDVVIGK	2289	sp|O15144|ARPC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6305	33.74	2	974.45566	974.4557	K	V	171	180
PSM	DDDIFIITYPK	2290	sp|O00204-2|ST2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=20351	108.04	2	1338.6707	1338.6707	R	S	45	56
PSM	DDELNFDLDR	2291	sp|O60291-4|MGRN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16053	81.921	2	1250.5415	1250.5415	K	G	185	195
PSM	DDLYAEQMER	2292	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9490	49.262	2	1268.5343	1268.5343	R	E	761	771
PSM	DEDDNLGPK	2293	sp|Q8WU20|FRS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2313	14.186	2	1001.4302	1001.4302	R	T	367	376
PSM	DEDGESGGQRSEAEEGEVR	2294	sp|Q9H4G0-4|E41L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=2689	16.114	3	2114.8026	2114.8026	R	T	425	444
PSM	DEELSCTVVELK	2295	sp|P01011|AACT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=14726	75.058	2	1420.6756	1420.6756	R	Y	256	268
PSM	DEGNYLDDALVR	2296	sp|P09525-2|ANXA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17294	88.914	2	1378.6365	1378.6365	R	Q	79	91
PSM	DEPDTNLVALMK	2297	sp|O95433-2|AHSA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=18215	94.217	2	1344.6595	1344.6595	K	E	126	138
PSM	DESASETSTPSEHSAAPSPQVEVR	2298	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=8372	43.962	3	2577.0868	2577.0868	R	T	147	171
PSM	DESENLLNQAR	2299	sp|Q16363-2|LAMA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10280	52.955	2	1287.6055	1287.6055	K	E	660	671
PSM	DEVTGEAALR	2300	sp|Q9BZE9-4|ASPC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6246	33.472	2	1059.5197	1059.5197	R	G	66	76
PSM	DEYELLCPDNTR	2301	sp|P02788-2|TRFL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4	ms_run[2]:scan=14020	71.387	2	1523.6562	1523.6562	R	K	200	212
PSM	DGDDVIIIGVFK	2302	sp|P13667|PDIA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=21357	115.12	2	1289.6867	1289.6867	K	G	302	314
PSM	DGIEPMWEDEK	2303	sp|P06730|IF4E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=11626	59.449	2	1363.5602	1363.5602	K	N	96	107
PSM	DGVLEEQIER	2304	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10932	56.106	2	1186.583	1186.5830	K	L	685	695
PSM	DIELSDDPYDCIR	2305	sp|Q15024|EXOS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:4	ms_run[2]:scan=16696	85.494	2	1609.693	1609.6930	K	L	179	192
PSM	DIISIAEDEDLR	2306	sp|P12956-2|XRCC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=18290	94.665	2	1387.6831	1387.6831	R	V	178	190
PSM	DIQEDSGMEPR	2307	sp|O75844|FACE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35	ms_run[2]:scan=2563	15.472	2	1291.535	1291.5350	K	N	293	304
PSM	DLDTGEEVTR	2308	sp|Q14166|TTL12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5129	28.138	2	1133.52	1133.5200	R	D	231	241
PSM	DLEADEEDTR	2309	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4257	23.924	2	1191.4891	1191.4891	K	K	53	63
PSM	DLEGSDIDTR	2310	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5879	31.79	2	1119.5044	1119.5044	R	R	317	327
PSM	DLEGSDIDTR	2311	sp|P55060-4|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6110	32.866	2	1119.5044	1119.5044	R	R	317	327
PSM	DLETSCSDIR	2312	sp|Q14203-5|DCTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=6386	34.146	2	1194.5187	1194.5187	R	Q	652	662
PSM	DLSGLDAETLLK	2313	sp|P29350|PTN6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=19327	101.12	2	1273.6765	1273.6765	R	G	8	20
PSM	DMDDEESWIK	2314	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=11929	60.917	2	1282.5023	1282.5023	R	E	1752	1762
PSM	DMDDEESWIK	2315	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=13867	70.655	2	1282.5023	1282.5023	R	E	1752	1762
PSM	DMDDEESWIK	2316	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14295	72.751	2	1266.5074	1266.5074	R	E	1752	1762
PSM	DMDDEESWIK	2317	sp|Q13813-3|SPTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14479	73.773	2	1266.5074	1266.5074	R	E	1752	1762
PSM	DPDAQPGGELMLGGTDSK	2318	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=15961	81.442	2	1802.7993	1802.7993	R	Y	236	254
PSM	DQDNMQAELNR	2319	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35	ms_run[2]:scan=2083	13.018	2	1348.5677	1348.5677	R	L	466	477
PSM	DQLEQAQEER	2320	sp|Q4V328-3|GRAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3469	20.09	2	1244.5633	1244.5633	R	D	460	470
PSM	DQNTVETLQR	2321	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5056	27.804	2	1202.5891	1202.5891	R	M	1835	1845
PSM	DSDDVPMVLVGNK	2322	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=18080	93.447	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	2323	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=14297	72.76	2	1403.6602	1403.6602	K	C	105	118
PSM	DSDDVPMVLVGNK	2324	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15771	80.484	2	1387.6653	1387.6653	K	C	105	118
PSM	DSDDVPMVLVGNK	2325	sp|P01112-2|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15987	81.577	2	1387.6653	1387.6653	K	C	105	118
PSM	DSGSDQDLDGAGVR	2326	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5048	27.771	2	1390.5961	1390.5961	R	A	31	45
PSM	DSLLQDGEFSMDLR	2327	sp|P07737|PROF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=17470	89.899	3	1640.7352	1640.7352	R	T	76	90
PSM	DSPSKSSAEAQTPEDTPNK	2328	sp|O43493-4|TGON2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=1996	12.542	3	2067.8634	2067.8634	K	S	65	84
PSM	DTDDVPMILVGNK	2329	sp|P61224-3|RAP1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=22453	123.14	2	1431.6915	1431.6915	K	C	86	99
PSM	DVSGVVMECGLDVK	2330	sp|Q8WWV3-3|RT4I1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=13425	68.465	2	1522.7007	1522.7007	R	Y	122	136
PSM	DYETATLSEIK	2331	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14033	71.455	2	1268.6136	1268.6136	K	A	421	432
PSM	DYILEGEPGK	2332	sp|Q9UHB9-3|SRP68_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10390	53.449	2	1119.5448	1119.5448	R	V	24	34
PSM	EADLDVATITK	2333	sp|P57740-2|NU107_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11741	60.003	2	1174.6081	1174.6081	K	T	598	609
PSM	EAEGAPQVEAGK	2334	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2444	14.824	2	1184.5673	1184.5673	K	R	262	274
PSM	EAGDVCYADVQK	2335	sp|Q13242|SRSF9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=6259	33.532	2	1353.5871	1353.5871	R	D	133	145
PSM	EAIEGTYIDK	2336	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8324	43.727	2	1137.5554	1137.5554	K	K	49	59
PSM	EAMEDGEIDGNK	2337	sp|P19338|NUCL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35	ms_run[2]:scan=1622	10.7	2	1322.5296	1322.5296	K	V	628	640
PSM	EDLNCQEEEDPMNK	2338	sp|O75821|EIF3G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:4,12-UNIMOD:35	ms_run[2]:scan=3926	22.283	2	1765.6771	1765.6771	K	L	135	149
PSM	EDTEEYNLR	2339	sp|P51991-2|ROA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5904	31.902	2	1167.5044	1167.5044	K	D	113	122
PSM	EEAEEEIDFEK	2340	sp|Q15477|SKIV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10786	55.35	2	1366.5776	1366.5776	R	D	171	182
PSM	EEAQALEDLTGFK	2341	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=18745	97.454	2	1449.6987	1449.6987	K	E	978	991
PSM	EEEEDDDCPVR	2342	sp|Q8IWD4|CC117_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:4	ms_run[2]:scan=2139	13.29	2	1391.5147	1391.5147	R	K	74	85
PSM	EEEEDSFSGDFK	2343	sp|Q8N8V4|ANS4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10880	55.812	2	1417.5521	1417.5521	R	E	236	248
PSM	EEEEDSFSGDFK	2344	sp|Q8N8V4|ANS4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11080	56.829	2	1417.5521	1417.5521	R	E	236	248
PSM	EEEELNLPISPEEER	2345	sp|Q5JTD0-2|TJAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16383	83.722	2	1811.8425	1811.8425	R	Q	472	487
PSM	EEFPTLQAAGDQDK	2346	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12492	63.793	2	1547.7104	1547.7104	R	A	168	182
PSM	EEGAPGDPEAALEDNLAR	2347	sp|P33908-2|MA1A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16203	82.728	2	1852.8439	1852.8439	R	I	106	124
PSM	EELVAAVEDVR	2348	sp|P26232-3|CTNA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15335	78.21	2	1228.6299	1228.6299	K	K	87	98
PSM	EEPVDTDLIWAK	2349	sp|O75808|CAN15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17878	92.283	2	1414.698	1414.6980	R	M	670	682
PSM	EEQEELMDFER	2350	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=11178	57.287	2	1469.598	1469.5980	R	D	576	587
PSM	EESDGEYDEFGR	2351	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9002	46.947	2	1431.5426	1431.5426	R	K	118	130
PSM	EETVEDEIDVR	2352	sp|Q14149|MORC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11548	59.065	2	1332.6045	1332.6045	K	N	652	663
PSM	EGEEPTVYSDEEEPKDESAR	2353	sp|O00264-2|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=7853	41.264	2	2374.9326	2374.9326	K	K	121	141
PSM	EGGDGEEQDVGDAGR	2354	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2022	12.675	2	1489.5917	1489.5917	R	L	292	307
PSM	EGLELPEDEEEK	2355	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11488	58.774	2	1415.6304	1415.6304	K	K	547	559
PSM	EISDDEAEEEKGEK	2356	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=1550	10.308	2	1686.6509	1686.6509	K	E	224	238
PSM	EISDDEAEEEKGEK	2357	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=1751	11.332	2	1686.6509	1686.6509	K	E	224	238
PSM	EISDDEAEEEKGEK	2358	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3146	18.443	2	1686.6509	1686.6509	K	E	224	238
PSM	ELDENVEYEER	2359	sp|Q15291-2|RBBP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8128	42.763	2	1423.6103	1423.6103	K	E	338	349
PSM	ELNPEEGEMVEEK	2360	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=6834	36.252	2	1547.6661	1547.6661	K	Y	3761	3774
PSM	ELVEFAQDDDR	2361	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11310	57.899	2	1335.5943	1335.5943	K	L	116	127
PSM	EQISDIDDAVR	2362	sp|P53999|TCP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10879	55.81	2	1259.5994	1259.5994	K	K	115	126
PSM	ESEDKPEIEDVGSDEEEEK	2363	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=5899	31.879	3	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	2364	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=7670	40.408	3	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEK	2365	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=8482	44.482	3	2271.8792	2271.8792	K	K	251	270
PSM	ESEGFEEHVPSDNS	2366	sp|P62699|YPEL5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8004	42.129	2	1561.6169	1561.6169	R	-	108	122
PSM	ESLDVYELDAK	2367	sp|Q13510-3|ASAH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=13775	70.192	2	1280.6136	1280.6136	K	Q	294	305
PSM	ESLTEDEATQFLK	2368	sp|O43293|DAPK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16949	86.945	2	1509.7199	1509.7199	K	Q	109	122
PSM	ESSYACYYDEK	2369	sp|Q99538-3|LGMN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=8732	45.675	2	1413.5395	1413.5395	R	R	214	225
PSM	ETTCSKESNEELTESCETK	2370	sp|P01042-3|KNG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4,5-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=2942	17.458	3	2340.8975	2340.8975	R	K	289	308
PSM	EVDDLGPEVGDIK	2371	sp|O43143|DHX15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=13900	70.832	2	1384.6722	1384.6722	R	I	372	385
PSM	EVDEQMLNVQNK	2372	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=5866	31.729	2	1461.677	1461.6770	K	N	325	337
PSM	EVELNELEPEK	2373	sp|P08195-2|4F2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12885	65.725	2	1327.6507	1327.6507	K	Q	11	22
PSM	EVVEEAENGR	2374	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2713	16.233	2	1130.5204	1130.5204	K	D	22	32
PSM	EVYPDSGSADDER	2375	sp|O14678|ABCD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3915	22.236	2	1438.5848	1438.5848	K	I	480	493
PSM	GAVAEDGDELR	2376	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4371	24.466	2	1130.5204	1130.5204	K	T	8	19
PSM	GDEELDSLIK	2377	sp|Q71UI9-3|H2AV_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14858	75.727	2	1117.5503	1117.5503	R	A	55	65
PSM	GDVDVSVPEVEGK	2378	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11667	59.648	2	1328.646	1328.6460	K	L	2469	2482
PSM	GEDLTEEEDGGIIR	2379	sp|Q02790|FKBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12811	65.37	2	1531.7002	1531.7002	K	R	139	153
PSM	GESPVDYDGGR	2380	sp|Q15084-3|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4525	25.201	2	1150.4891	1150.4891	K	T	243	254
PSM	GGELVYTDSEAR	2381	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7408	39.093	2	1295.5994	1295.5994	K	D	2859	2871
PSM	GGGGDMAEPSEAGDAPPDDGPPGELGPDGPDGPEEK	2382	sp|P08621-2|RU17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=12003	61.255	3	3388.3797	3388.3797	R	G	302	338
PSM	GIDSDDVQDNSQLK	2383	sp|Q96QE3-2|ATAD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7122	37.701	3	1532.6954	1532.6954	R	A	611	625
PSM	GLDSGAETEEEKDTWEEK	2384	sp|P78559|MAP1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=11221	57.49	3	2131.8471	2131.8471	R	K	609	627
PSM	GMITVTDPDLIEK	2385	sp|A0AVT1-2|UBA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=13980	71.196	2	1446.7276	1446.7276	K	S	17	30
PSM	GNAEGSSDEEGKLVIDEPAK	2386	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=10429	53.645	3	2123.926	2123.9260	K	E	120	140
PSM	GPSQEEEDNHSDEEDR	2387	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=1240	8.7876	2	1951.6705	1951.6705	R	A	57	73
PSM	GSETDSAQDQPVK	2388	sp|P30419|NMT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1198	8.5813	2	1360.6107	1360.6107	K	M	68	81
PSM	GSETDTDSEIHESASDK	2389	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=3304	19.235	2	1886.7055	1886.7055	R	D	1019	1036
PSM	GSETGSETHESDLAPSDK	2390	sp|P48634|PRC2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=4120	23.275	2	1925.7528	1925.7528	R	E	1105	1123
PSM	GSVSDEEMMELR	2391	sp|P13796|PLSL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=10124	52.222	2	1397.5803	1397.5803	R	E	4	16
PSM	GTEAPAVVTEEEDDDEETAPPVIAPR	2392	sp|Q13177|PAK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15607	79.605	3	2736.2614	2736.2614	K	P	161	187
PSM	GVEEEEEDGEMRE	2393	sp|P62306|RUXF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5811	31.472	3	1536.5886	1536.5886	R	-	74	87
PSM	GVSQEKEAQISSAIVSSVQSK	2394	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=17338	89.146	3	2241.089	2241.0890	R	I	907	928
PSM	IDENSDKEMEVEESPEK	2395	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=4334	24.287	2	2102.8239	2102.8239	K	I	495	512
PSM	IESSLQEDEPENDAK	2396	sp|Q9NPL8|TIDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6781	35.971	2	1702.7534	1702.7534	K	K	250	265
PSM	IIVDDDDSK	2397	sp|Q9NZD8-2|SPG21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3433	19.914	2	1018.4819	1018.4819	K	I	22	31
PSM	IPMTPTSSFVSPPPPTASPHSNR	2398	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,4-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=13039	66.465	3	2580.1121	2580.1121	K	T	373	396
PSM	ITNDFYPEEDGK	2399	sp|P55884|EIF3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10507	53.998	2	1426.6252	1426.6252	K	T	217	229
PSM	IVITGDADIDHDQE	2400	sp|Q9Y2J2-4|E41L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10960	56.243	2	1539.7053	1539.7053	R	-	870	884
PSM	IWEDLDDDDPK	2401	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11905	60.811	2	1359.583	1359.5830	R	F	39	50
PSM	LDDDDEGVPSSALR	2402	sp|Q00535-2|CDK5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9641	49.998	2	1487.674	1487.6740	R	E	37	51
PSM	LDTDDLDEIEK	2403	sp|Q9UMR2-3|DD19B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=13911	70.88	2	1304.5984	1304.5984	R	I	357	368
PSM	LDVTSVEDYK	2404	sp|P48643-2|TCPE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12510	63.895	2	1167.5659	1167.5659	K	A	173	183
PSM	LEAADEGSGDVK	2405	sp|Q02218-3|ODO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2242	13.803	2	1189.5463	1189.5463	K	Y	337	349
PSM	LEESYDMESVLR	2406	sp|P35237|SPB6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=11646	59.55	2	1485.6657	1485.6657	K	N	276	288
PSM	LEGQEEEEDNR	2407	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1231	8.7496	2	1346.5586	1346.5586	R	D	358	369
PSM	LESENDEYER	2408	sp|O94906|PRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2910	17.298	2	1282.5313	1282.5313	K	A	651	661
PSM	LFEESDDKEDEDADGK	2409	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=6851	36.33	3	1920.715	1920.7150	K	E	672	688
PSM	LPLLPPESPGPLR	2410	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=19108	99.721	2	1464.7742	1464.7742	R	Q	765	778
PSM	LPLLPPESPGPLR	2411	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=19418	101.73	2	1464.7742	1464.7742	R	Q	765	778
PSM	LSELQETSEQAQSK	2412	sp|Q5T1M5-2|FKB15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6181	33.185	2	1576.758	1576.7580	K	F	684	698
PSM	LSSEQEKEEIASK	2413	sp|Q96Q89-4|KI20B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=4606	25.561	2	1556.6971	1556.6971	R	S	204	217
PSM	LYEDSDDLK	2414	sp|P02549-2|SPTA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6102	32.83	2	1096.4924	1096.4924	K	N	587	596
PSM	MASPPAPSPAPPAISPIIK	2415	sp|Q00587-2|BORG5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=16198	82.705	2	1936.9733	1936.9733	R	N	99	118
PSM	MDTIDQDDELIR	2416	sp|Q93008-1|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=13964	71.124	2	1462.661	1462.6610	R	Y	1956	1968
PSM	NEEEGNSEEIK	2417	sp|O75844|FACE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1467	9.8721	2	1276.5419	1276.5419	R	A	304	315
PSM	NNASTDYDLSDK	2418	sp|P39023|RL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5291	28.971	2	1341.5685	1341.5685	K	S	301	313
PSM	NPDDITQEEYGEFYK	2419	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15493	79.032	3	1846.7897	1846.7897	R	S	292	307
PSM	NSQEDSEDSEDKDVK	2420	sp|Q9H1E3|NUCKS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=488	4.9975	2	1803.6684	1803.6684	K	T	53	68
PSM	NTDEALDYICK	2421	sp|O95786-2|DDX58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:4	ms_run[2]:scan=12933	65.946	2	1340.5918	1340.5918	K	L	374	385
PSM	NVELQCLDADDAK	2422	sp|P02730-2|B3AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=14210	72.311	2	1489.6719	1489.6719	R	A	815	828
PSM	PAAMISQPPTPPTGQPVR	2423	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=10079	51.997	2	1939.9227	1939.9227	R	E	985	1003
PSM	PVTVEPMDQLDDEEGLPEK	2424	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=13165	67.151	2	2155.9831	2155.9831	R	L	132	151
PSM	QDFDEDDILK	2425	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14071	71.642	2	1236.551	1236.5510	K	E	51	61
PSM	QDFDEDDILK	2426	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14277	72.651	2	1236.551	1236.5510	K	E	51	61
PSM	QLEEAEEEAQR	2427	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4092	23.138	2	1330.6001	1330.6001	R	A	1878	1889
PSM	QTNPSAMEVEEDDPVPEIR	2428	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35	ms_run[2]:scan=14732	75.083	3	2170.9688	2170.9688	R	R	714	733
PSM	RLEISPDSSPER	2429	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=7126	37.719	2	1544.6273	1544.6273	R	A	147	159
PSM	RLEISPDSSPER	2430	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=7810	41.072	3	1544.6273	1544.6273	R	A	147	159
PSM	RPPSPDVIVLSDNEQPSSPR	2431	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=13668	69.661	3	2349.0403	2349.0403	R	V	97	117
PSM	RPPSPDVIVLSDNEQPSSPR	2432	sp|Q86YP4-2|P66A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=13870	70.674	3	2349.0403	2349.0403	R	V	97	117
PSM	SAEIDSDDTGGSAAQK	2433	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1850	11.803	3	1550.6696	1550.6696	K	Q	814	830
PSM	SDENEDPSVVGEFK	2434	sp|Q9NZM1-2|MYOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11743	60.015	2	1550.6736	1550.6736	K	G	1466	1480
PSM	SEDLDNSIDK	2435	sp|Q9UQE7|SMC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4903	27.057	2	1134.5041	1134.5041	R	T	880	890
PSM	SELDELQEEVAR	2436	sp|Q70EL1-6|UBP54_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15952	81.396	2	1416.6733	1416.6733	K	R	739	751
PSM	SETAPAETATPAPVEKSPAK	2437	sp|P16401|H15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:21	ms_run[2]:scan=6127	32.943	2	2060.9667	2060.9667	M	K	2	22
PSM	SGDEEFKGEDELCDSGR	2438	sp|O43823|AKAP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=8518	44.662	3	2008.7357	2008.7357	R	Q	339	356
PSM	SGDETPGSEVPGDK	2439	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3923	22.272	2	1373.5947	1373.5947	R	A	161	175
PSM	SGDETPGSEVPGDK	2440	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4130	23.32	2	1373.5947	1373.5947	R	A	161	175
PSM	SGVGTGPPSPIALPPLR	2441	sp|Q92630|DYRK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=18934	98.621	2	1694.8757	1694.8757	R	A	40	57
PSM	SISVPPSPSDIPPPGPPR	2442	sp|Q6IQ23-3|PKHA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=15244	77.702	2	1875.9132	1875.9132	R	V	137	155
PSM	SPSEAADEEKEPQK	2443	sp|Q9H6Z4-2|RANB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=1185	8.5068	2	1623.6665	1623.6665	R	N	219	233
PSM	SQDSEEHDSTFPLIDSSSQNQIR	2444	sp|Q8IXW5-2|RPAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=16486	84.269	3	2699.1348	2699.1348	K	K	480	503
PSM	SSDPDYLAAVDK	2445	sp|P16278-3|BGAL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12433	63.498	2	1279.5932	1279.5932	R	W	119	131
PSM	SSSQPSSCCSDPSKPGGNVEGATQSLAEQMR	2446	sp|Q13501-2|SQSTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21,8-UNIMOD:4,9-UNIMOD:4,30-UNIMOD:35	ms_run[2]:scan=10695	54.904	3	3334.3537	3334.3538	K	K	198	229
PSM	SSSSLLASPGHISVK	2447	sp|A0FGR8-5|ESYT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,4-UNIMOD:21	ms_run[2]:scan=14059	71.581	2	1628.7212	1628.7212	R	E	143	158
PSM	STYEQVDLIGK	2448	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12411	63.393	2	1251.6347	1251.6347	K	K	392	403
PSM	SVSESHTSCPAESASDAAPLQR	2449	sp|Q8WUA7-3|TB22A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=8146	42.857	3	2365.9846	2365.9846	K	S	96	118
PSM	SYCNDQSTGDIK	2450	sp|P00492|HPRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:4	ms_run[2]:scan=3094	18.191	2	1386.5722	1386.5722	K	V	104	116
PSM	TGDLGIPPNPEDRSPSPEPIYNSEGK	2451	sp|Q15637-5|SF01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:21,16-UNIMOD:21	ms_run[2]:scan=15182	77.4	3	2925.2471	2925.2471	R	R	192	218
PSM	TLNAETPKSSPLPAK	2452	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21,10-UNIMOD:21	ms_run[2]:scan=6688	35.506	2	1712.7787	1712.7787	R	G	208	223
PSM	TMLDEDDVK	2453	sp|Q14562|DHX8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=3933	22.325	2	1080.4645	1080.4645	R	V	132	141
PSM	TQLEELEDELQATEDAK	2454	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=21002	112.57	3	1960.9113	1960.9113	K	L	1539	1556
PSM	TRSPSPDDILER	2455	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=11507	58.858	2	1544.6273	1544.6273	R	V	576	588
PSM	TTYLVLDEADR	2456	sp|P17844-2|DDX5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14370	73.174	2	1294.6405	1294.6405	R	M	163	174
PSM	TVEIPDPVEAGEEVK	2457	sp|P21980|TGM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15985	81.57	2	1610.8039	1610.8039	K	V	635	650
PSM	VAEEDEDDDGGIMMR	2458	sp|P19634|SL9A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=4077	23.064	3	1712.6505	1712.6505	K	S	751	766
PSM	VASETHSEGSEYEELPK	2459	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9602	49.821	2	1970.8146	1970.8146	R	R	1130	1147
PSM	VDDSSEDKTEFTVK	2460	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=7608	40.125	2	1678.6975	1678.6975	K	N	551	565
PSM	VDEDEEALK	2461	sp|Q9BY43|CHM4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3553	20.537	2	1046.4768	1046.4768	K	Q	207	216
PSM	VDNEILDYK	2462	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11482	58.74	2	1107.5448	1107.5448	K	D	34	43
PSM	VEELEENISHLSEK	2463	sp|Q96PY5|FMNL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=12345	63.051	2	1734.7713	1734.7713	R	L	395	409
PSM	VEGDMQVPDLDIK	2464	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16764	85.866	2	1457.7072	1457.7072	K	G	3898	3911
PSM	VETVSQPSESPKDTIDK	2465	sp|Q99590-2|SCAFB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=6534	34.815	3	1938.8823	1938.8823	K	T	452	469
PSM	VETVSQPSESPKDTIDK	2466	sp|Q99590-2|SCAFB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=6575	35.003	2	1938.8823	1938.8823	K	T	452	469
PSM	VNDSDDLIMTENEVGK	2467	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=11699	59.8	3	1793.7989	1793.7989	R	I	686	702
PSM	VPMILVGNK	2468	sp|P61225|RAP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35	ms_run[2]:scan=10102	52.105	2	985.56304	985.5630	R	V	109	118
PSM	VVDSMEDEVQR	2469	sp|Q9Y285-2|SYFA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35	ms_run[2]:scan=2581	15.55	2	1321.582	1321.5820	R	R	128	139
PSM	VVEGFTDEEK	2470	sp|Q15386|UBE3C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6568	34.971	2	1151.5346	1151.5346	R	R	999	1009
PSM	YDLDGDASMAK	2471	sp|Q9UHD2|TBK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=4575	25.42	2	1200.4969	1200.4969	R	A	406	417
PSM	YIDDEDLDR	2472	sp|Q9BRD0-2|BUD13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7546	39.828	2	1152.4935	1152.4935	R	M	391	400
PSM	YIDDEDLDR	2473	sp|Q9BRD0-2|BUD13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7562	39.913	2	1152.4935	1152.4935	R	M	391	400
PSM	YLMEEDEDAYK	2474	sp|P46777|RL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10974	56.303	2	1404.5755	1404.5755	R	K	210	221
PSM	YYSPCEEHPAETNQNEGAESGTIR	2475	sp|A5YM69|ARG35_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=8680	45.444	3	2818.1178	2818.1178	R	Q	182	206
PSM	LDADMPEVAVEGPNGK	2476	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:35	ms_run[1]:scan=10043	51.840405	2	1657.752990	1656.766502	K	W	2353	2369
PSM	ELEDATETADAMNREVSSLK	2477	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:27,17-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=9094	47.401720000000005	3	2349.9417	2349.9432	R	N	1899	1919
PSM	LEDEILVMDDQNNK	2478	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	8-UNIMOD:35	ms_run[1]:scan=11997	61.22490833333334	2	1691.7582	1690.7712	K	L	983	997
PSM	EDQTEYLEER	2479	sp|Q58FF7|H90B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7516	39.67400666666666	2	1311.566750	1310.562640	K	R	166	176
PSM	GVVDSDDLPLNVSR	2480	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=15084	76.89800666666666	2	1485.731172	1484.747087	K	E	435	449
PSM	VFDDESDEKEDEEYADEK	2481	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:21	ms_run[1]:scan=10082	52.012535	3	2271.821672	2270.826395	K	G	637	655
PSM	NGQHVASSPIPVVISQSEIGDASR	2482	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:21	ms_run[1]:scan=17897	92.37603333333334	3	2528.193667	2527.206796	K	V	2026	2050
PSM	QYDIDDAIAK	2483	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=15145	77.21706666666667	2	1133.5240	1133.5235	R	N	4339	4349
PSM	QEPESEEEEEEKQEK	2484	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=5265	28.840168333333335	2	1939.7242	1938.7252	K	E	579	594
PSM	GYDSAGVGFDGGNDK	2485	sp|Q06210|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8685	45.4681	2	1458.592610	1457.605902	R	D	34	49
PSM	EEIQSSISGVTAAYNR	2486	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=14229	72.40694	2	1723.839501	1723.837693	R	E	723	739
PSM	MDDREDLVYQAK	2487	sp|P62258|1433E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=12542	64.04031833333333	2	1523.6943	1523.6921	-	L	1	13
PSM	EVEDKESEGEEEDEDEDLSK	2488	sp|O95218|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:21	ms_run[1]:scan=5387	29.40950833333333	3	2419.901263	2418.895931	K	Y	147	167
PSM	QKDYETATLSEIK	2489	sp|P12814|ACTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=13761	70.12128833333333	2	1507.7438	1507.7401	R	A	419	432
PSM	NYQQNYQNSESGEKNEGSESAPEGQAQQR	2490	sp|P67809|YBOX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:21	ms_run[1]:scan=4941	27.257340000000003	3	3337.342618	3336.355264	R	R	157	186
PSM	CDPHEATCYDDGK	2491	sp|P02751|FINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4	ms_run[1]:scan=6066	32.66104333333333	2	1549.5456	1549.5444	K	T	2288	2301
PSM	EGPEPPEEVPPPTTPPVPK	2492	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	14-UNIMOD:21	ms_run[1]:scan=13087	66.72548833333333	2	2072.971937	2072.970755	K	V	597	616
PSM	GDQPAASGDSDDDEPPPLPR	2493	sp|O00264|PGRC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9236	48.035628333333335	2	2035.851572	2034.876657	R	L	48	68
PSM	GIINDDEDDEDLMMASGR	2494	sp|O75717|WDHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=12264	62.610216666666666	2	2027.795740	2026.809566	K	P	352	370
PSM	TDEAFFDSENDPEK	2495	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=11941	60.96760666666667	2	1642.665170	1642.663476	K	C	1974	1988
PSM	EESEPEVKEDVIEK	2496	sp|P78559|MAP1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=8648	45.295276666666666	2	1738.756968	1738.755008	R	A	642	656
PSM	ASLNGADIYSGCCTLK	2497	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	12-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=13523	68.90774666666667	2	1729.766173	1728.781106	K	I	249	265
PSM	DVDEAYMNK	2498	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5323	29.123771666666666	2	1083.454894	1083.454275	K	V	199	208
PSM	ELQSQISDTSVVLSMDNSR	2499	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:35	ms_run[1]:scan=14490	73.82674333333334	2	2124.987911	2124.000478	R	S	234	253
PSM	SQGDSNPAAIPHAAEDIQGDDR	2500	sp|P68402|PA1B2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=12512	63.905683333333336	3	2305.0231	2305.0202	M	W	2	24
PSM	SDGLPWCSTTANYDTDDR	2501	sp|P14780|MMP9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=15953	81.39936833333333	3	2073.825884	2072.838163	R	F	250	268
PSM	TEFDQEIDMGSLNPGK	2502	sp|P52789|HXK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:35	ms_run[1]:scan=13765	70.14022333333332	2	1795.799002	1795.793445	R	Q	275	291
PSM	NGFQDSPCEDEWESR	2503	sp|O43516|WIPF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:4	ms_run[1]:scan=12929	65.928165	2	1855.696209	1854.711506	R	F	439	454
PSM	MDTIDQDDELIR	2504	sp|Q93008|USP9X_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:35	ms_run[1]:scan=13025	66.38905166666667	2	1478.655556	1478.655889	R	Y	1956	1968
PSM	VEEAEPEEFVVEK	2505	sp|Q13185|CBX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=13066	66.61063833333333	2	1532.732495	1532.724620	K	V	22	35
PSM	SDGEDGSLDQDNR	2506	sp|Q6H8Q1|ABLM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1699	11.053031666666666	2	1406.561499	1406.554595	R	K	446	459
PSM	ELGSECGIEFDEEK	2507	sp|P39656|OST48_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4	ms_run[1]:scan=13697	69.79127	2	1641.686936	1640.687583	R	T	140	154
PSM	AACSAAAMEEDSEASSSR	2508	sp|Q05086|UBE3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:4,8-UNIMOD:35	ms_run[1]:scan=2676	16.04276	2	1844.717114	1844.715271	K	I	196	214
PSM	VDDDFTAQDYR	2509	sp|Q8IUI8|CRLF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9786	50.687645	2	1343.564654	1343.562974	K	L	202	213
PSM	AGLESGAEPGDGDSDTTK	2510	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=4152	23.42679	2	1705.724039	1705.727868	K	K	481	499
PSM	TLTTVQGIADDYDK	2511	sp|O60739|EIF1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=14727	75.06169333333334	2	1538.748696	1538.746418	K	K	43	57
PSM	EEIINYEFDTK	2512	sp|Q8TCT9|HM13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:27	ms_run[1]:scan=18496	95.90219	2	1381.6410	1381.6396	K	D	151	162
PSM	QDDSPPRPIIGPALPPGFIK	2513	sp|Q8IXQ4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=21995	119.83128166666667	2	2177.0946	2177.0917	K	S	102	122
PSM	SVSNGTAKPATSENFDEDLK	2514	sp|Q96K49|TM87B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:21	ms_run[1]:scan=11255	57.65473333333334	3	2189.940561	2188.952539	K	W	494	514
PSM	CQTAEADSESDHEVPEPESEMK	2515	sp|Q9BPX3|CND3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:4,8-UNIMOD:21,21-UNIMOD:35	ms_run[1]:scan=6071	32.68362333333334	3	2600.963555	2599.956774	R	M	966	988
PSM	GMNGDSSENQALGPQPNQDDK	2516	sp|Q9Y4K1|CRBG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:35	ms_run[1]:scan=4377	24.492813333333334	2	2217.910963	2216.924018	R	A	358	379
PSM	VFSNGADLSGVTEEAPLK	2517	sp|P01009|A1AT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=16783	85.97023333333334	2	1833.902385	1832.915609	K	L	335	353
PSM	GSNTCELIFEDCK	2518	sp|P26440|IVD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4,12-UNIMOD:4	ms_run[1]:scan=14214	72.32940833333333	2	1571.659592	1571.659594	R	I	250	263
PSM	QADYDKDEVGDR	2519	sp|P35442|TSP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=5114	28.077918333333336	2	1392.5801	1392.5788	R	C	764	776
PSM	WSNIYEDNGDDAPQNAK	2520	sp|Q8N6N3|CA052_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=10627	54.599030000000006	2	1936.8092	1935.8232	K	K	128	145
PSM	DAEAEGLSGTTLLPK	2521	sp|Q9UI14|PRAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=15634	79.76086833333333	2	1501.789816	1500.767154	K	L	10	25
PSM	DADDAEQAFER	2522	sp|O43586|PPIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=9123	47.539521666666666	2	1264.511620	1265.516024	R	I	150	161
PSM	EEIINYEFDTK	2523	sp|Q8TCT9|HM13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=16194	82.68625166666668	2	1400.635732	1399.650727	K	D	151	162
PSM	DSDDVPMVLVGNK	2524	sp|P01112|RASH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:35	ms_run[1]:scan=13877	70.71302333333333	2	1405.652204	1403.660246	K	C	105	118
PSM	GEDEEENNLEVR	2525	sp|P04843|RPN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=5594	30.38509	2	1430.615651	1431.611381	K	E	90	102
PSM	FSDDEEEEEVVK	2526	sp|Q5JSZ5|PRC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=8827	46.11084833333334	2	1452.593646	1453.609650	K	D	387	399
PSM	LLDEEEATDNDLR	2527	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=10528	54.09434666666667	2	1532.687268	1531.700196	R	A	457	470
PSM	QVVDMRTNPGDPR	2528	sp|Q9Y6N7|ROBO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:21	ms_run[1]:scan=10217	52.646856666666665	2	1564.702480	1563.686491	R	E	1539	1552
PSM	QNCELFEQLGEYK	2529	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:4	ms_run[1]:scan=18418	95.42744499999999	2	1657.759151	1656.745372	K	F	414	427
PSM	VVVAENFDEIVNNENK	2530	sp|P30101|PDIA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=17152	88.12871	2	1832.881735	1831.895208	K	D	380	396
PSM	ETDSLSDEVTHNSNQNNSNCSSPSR	2531	sp|Q96RT1|ERBIN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=6841	36.28158833333334	3	2860.095995	2858.104652	K	M	639	664
PSM	ETDSLSDEVTHNSNQNNSNCSSPSR	2532	sp|Q96RT1|ERBIN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:21,20-UNIMOD:4	ms_run[1]:scan=7035	37.283384999999996	3	2860.098496	2858.104652	K	M	639	664
PSM	LFEESDDKEDEDADGK	2533	sp|O43719|HTSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:21	ms_run[1]:scan=6642	35.31712833333333	3	1920.719117	1920.714994	K	E	672	688
PSM	SSPTPAPTCSSTSTTTSLF	2534	sp|Q5VX71-3|SUSD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:4,15-UNIMOD:21,16-UNIMOD:21	ms_run[1]:scan=13918	70.91382333333333	2	2088.832998	2088.800000	K	-	272	291
PSM	GDDEEWNEVLNK	2535	sp|Q9H0A0|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=14732	75.08341333333333	2	1446.629434	1446.626303	R	A	967	979
PSM	SVSNGTAKPATSENFDEDLK	2536	sp|Q96K49|TM87B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:21	ms_run[1]:scan=11046	56.6463	3	2189.937969	2188.952539	K	W	494	514
PSM	VSQGSKDPAEGDGAQPEETPR	2537	sp|Q14697|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:21	ms_run[1]:scan=4079	23.076613333333334	3	2232.948711	2233.948850	R	D	186	207
PSM	DSPVCPHFTTNGNENSSIEK	2538	sp|P50851|LRBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=10649	54.70042666666667	3	2312.927817	2311.941657	K	T	978	998