MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_NT_JPST000210
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\121102_CRC_T_Fr12.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\121102_CRC_T_Fr12.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P54727|RD23B_HUMAN	UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	47.0	null	145-UNIMOD:28,160-UNIMOD:21,155-UNIMOD:21,162-UNIMOD:21	0.07	47.0	11	1	0
PRT	sp|Q9Y6A5|TACC3_HUMAN	Transforming acidic coiled-coil-containing protein 3 OS=Homo sapiens OX=9606 GN=TACC3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46.0	null	242-UNIMOD:4,250-UNIMOD:21,249-UNIMOD:21	0.03	46.0	4	1	0
PRT	sp|Q9NXL2-1|ARH38_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45.0	null	34-UNIMOD:21	0.09	45.0	4	1	0
PRT	sp|P83916|CBX1_HUMAN	Chromobox protein homolog 1 OS=Homo sapiens OX=9606 GN=CBX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45.0	null		0.10	45.0	2	1	0
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44.0	null		0.10	44.0	5	1	0
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	42.0	null	38-UNIMOD:35	0.16	42.0	19	2	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null		0.06	42.0	2	1	0
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	329-UNIMOD:21,154-UNIMOD:21,151-UNIMOD:21	0.04	41.0	4	2	0
PRT	sp|O94979-7|SC31A_HUMAN	Isoform 7 of Protein transport protein Sec31A OS=Homo sapiens OX=9606 GN=SEC31A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	532-UNIMOD:21	0.02	41.0	4	1	0
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|P02751-12|FINC_HUMAN	Isoform 12 of Fibronectin OS=Homo sapiens OX=9606 GN=FN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null	87-UNIMOD:4,97-UNIMOD:4,1976-UNIMOD:21	0.02	40.0	3	2	1
PRT	sp|Q7L014|DDX46_HUMAN	Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens OX=9606 GN=DDX46 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.02	40.0	2	1	0
PRT	sp|O95218-2|ZRAB2_HUMAN	Isoform 2 of Zinc finger Ran-binding domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ZRANB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40.0	null		0.05	40.0	2	1	0
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	40.0	null	553-UNIMOD:28,554-UNIMOD:21	0.04	40.0	2	1	0
PRT	sp|Q9UHX1-4|PUF60_HUMAN	Isoform 4 of Poly(U)-binding-splicing factor PUF60 OS=Homo sapiens OX=9606 GN=PUF60	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	2804-UNIMOD:21,2813-UNIMOD:35,2251-UNIMOD:21	0.02	39.0	4	3	2
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q14C86-2|GAPD1_HUMAN	Isoform 2 of GTPase-activating protein and VPS9 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=GAPVD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39.0	null	1043-UNIMOD:21,1059-UNIMOD:35,1050-UNIMOD:35	0.02	39.0	2	1	0
PRT	sp|Q9NVK5-3|FGOP2_HUMAN	Isoform 3 of FGFR1 oncogene partner 2 OS=Homo sapiens OX=9606 GN=FGFR1OP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.11	38.0	1	1	1
PRT	sp|Q86UU1-3|PHLB1_HUMAN	Isoform 3 of Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	578-UNIMOD:21,516-UNIMOD:21,520-UNIMOD:21	0.04	38.0	2	2	2
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	22-UNIMOD:21,36-UNIMOD:4,21-UNIMOD:21	0.02	38.0	8	1	0
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	1171-UNIMOD:21,1173-UNIMOD:21	0.02	38.0	4	1	0
PRT	sp|Q9C0H5|RHG39_HUMAN	Rho GTPase-activating protein 39 OS=Homo sapiens OX=9606 GN=ARHGAP39 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	286-UNIMOD:21	0.02	38.0	1	1	1
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.05	38.0	1	1	1
PRT	sp|Q9NXG2|THUM1_HUMAN	THUMP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THUMPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	88-UNIMOD:21	0.07	37.0	1	1	1
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	37.0	null	1314-UNIMOD:21,1316-UNIMOD:4,390-UNIMOD:21,1307-UNIMOD:21,852-UNIMOD:27,860-UNIMOD:21	0.05	37.0	6	4	2
PRT	sp|P49759|CLK1_HUMAN	Dual specificity protein kinase CLK1 OS=Homo sapiens OX=9606 GN=CLK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	341-UNIMOD:21,138-UNIMOD:21,151-UNIMOD:4	0.10	37.0	2	2	2
PRT	sp|Q8WYA6-4|CTBL1_HUMAN	Isoform 4 of Beta-catenin-like protein 1 OS=Homo sapiens OX=9606 GN=CTNNBL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	19-UNIMOD:35	0.03	37.0	1	1	1
PRT	sp|P14923|PLAK_HUMAN	Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	457-UNIMOD:4	0.02	36.0	6	1	0
PRT	sp|Q9Y5P4-2|C43BP_HUMAN	Isoform 2 of Collagen type IV alpha-3-binding protein OS=Homo sapiens OX=9606 GN=COL4A3BP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.03	36.0	2	1	0
PRT	sp|P50579-3|MAP2_HUMAN	Isoform 3 of Methionine aminopeptidase 2 OS=Homo sapiens OX=9606 GN=METAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.04	36.0	2	1	0
PRT	sp|Q14699|RFTN1_HUMAN	Raftlin OS=Homo sapiens OX=9606 GN=RFTN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	199-UNIMOD:21,211-UNIMOD:4	0.04	36.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	255-UNIMOD:21,226-UNIMOD:21	0.05	36.0	9	5	4
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	112-UNIMOD:21	0.07	36.0	2	1	0
PRT	sp|Q6PJT7-5|ZC3HE_HUMAN	Isoform 5 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	409-UNIMOD:21	0.05	36.0	2	2	2
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	4	2	1
PRT	sp|P05387|RLA2_HUMAN	60S acidic ribosomal protein P2 OS=Homo sapiens OX=9606 GN=RPLP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	109-UNIMOD:35	0.30	36.0	2	2	1
PRT	sp|Q7Z6E9-2|RBBP6_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	1243-UNIMOD:21	0.03	36.0	2	2	2
PRT	sp|Q9H1E3|NUCKS_HUMAN	Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.09	36.0	1	1	1
PRT	sp|A6NHR9-2|SMHD1_HUMAN	Isoform 2 of Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SMCHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	458-UNIMOD:4	0.01	36.0	1	1	1
PRT	sp|O60264|SMCA5_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens OX=9606 GN=SMARCA5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.02	36.0	1	1	1
PRT	sp|Q6P0Q8|MAST2_HUMAN	Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	874-UNIMOD:21	0.01	36.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	830-UNIMOD:21	0.03	36.0	12	1	0
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	420-UNIMOD:35,423-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|P0DP25|CALM3_HUMAN	Calmodulin-3 OS=Homo sapiens OX=9606 GN=CALM3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.12	35.0	2	1	0
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	118-UNIMOD:21	0.04	35.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	398-UNIMOD:21,2130-UNIMOD:385,2130-UNIMOD:4,2132-UNIMOD:21,2135-UNIMOD:35,2664-UNIMOD:21,2702-UNIMOD:21,295-UNIMOD:21,297-UNIMOD:21	0.03	35.0	6	5	4
PRT	sp|O95400|CD2B2_HUMAN	CD2 antigen cytoplasmic tail-binding protein 2 OS=Homo sapiens OX=9606 GN=CD2BP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.06	35.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	35.0	null	1943-UNIMOD:21,1373-UNIMOD:35,1379-UNIMOD:4,911-UNIMOD:28,917-UNIMOD:4	0.04	35.0	10	5	2
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	126-UNIMOD:21,158-UNIMOD:21	0.14	35.0	3	2	1
PRT	sp|Q96M89-2|CC138_HUMAN	Isoform 2 of Coiled-coil domain-containing protein 138 OS=Homo sapiens OX=9606 GN=CCDC138	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.03	35.0	1	1	1
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	1898-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q15942-2|ZYX_HUMAN	Isoform 2 of Zyxin OS=Homo sapiens OX=9606 GN=ZYX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	151-UNIMOD:21	0.06	35.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	64-UNIMOD:21,272-UNIMOD:21,121-UNIMOD:21	0.12	35.0	10	3	1
PRT	sp|Q9UMN6|KMT2B_HUMAN	Histone-lysine N-methyltransferase 2B OS=Homo sapiens OX=9606 GN=KMT2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	1095-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	90-UNIMOD:21,208-UNIMOD:21,211-UNIMOD:21	0.18	35.0	3	2	1
PRT	sp|Q9P1Y6-2|PHRF1_HUMAN	Isoform 2 of PHD and RING finger domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PHRF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	936-UNIMOD:21,949-UNIMOD:4,814-UNIMOD:21	0.03	35.0	3	2	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	245-UNIMOD:21,244-UNIMOD:21	0.04	35.0	3	2	1
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.11	35.0	3	1	0
PRT	sp|Q9UKC9-2|FBXL2_HUMAN	Isoform 2 of F-box/LRR-repeat protein 2 OS=Homo sapiens OX=9606 GN=FBXL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	336-UNIMOD:21	0.06	35.0	2	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	35.0	1	1	1
PRT	sp|P48741|HSP77_HUMAN	Putative heat shock 70 kDa protein 7 OS=Homo sapiens OX=9606 GN=HSPA7 PE=5 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	3	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	524-UNIMOD:21,527-UNIMOD:35,521-UNIMOD:21	0.02	34.0	6	1	0
PRT	sp|P18858-3|DNLI1_HUMAN	Isoform 3 of DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	534-UNIMOD:4	0.02	34.0	2	1	0
PRT	sp|P02775|CXCL7_HUMAN	Platelet basic protein OS=Homo sapiens OX=9606 GN=PPBP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.13	34.0	2	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.02	34.0	2	1	0
PRT	sp|Q14103-3|HNRPD_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	83-UNIMOD:21,82-UNIMOD:21	0.06	34.0	3	2	1
PRT	sp|Q9C004|SPY4_HUMAN	Protein sprouty homolog 4 OS=Homo sapiens OX=9606 GN=SPRY4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	115-UNIMOD:35,125-UNIMOD:21	0.06	34.0	3	1	0
PRT	sp|P07355|ANXA2_HUMAN	Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.06	34.0	5	1	0
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q9ULI0-2|ATD2B_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 2B OS=Homo sapiens OX=9606 GN=ATAD2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	16-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|Q9UMS6-5|SYNP2_HUMAN	Isoform 5 of Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	209-UNIMOD:21,537-UNIMOD:21	0.06	34.0	6	2	1
PRT	sp|O94880|PHF14_HUMAN	PHD finger protein 14 OS=Homo sapiens OX=9606 GN=PHF14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	84-UNIMOD:21	0.02	34.0	1	1	1
PRT	sp|P27695|APEX1_HUMAN	DNA-(apurinic or apyrimidinic site) lyase OS=Homo sapiens OX=9606 GN=APEX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null		0.05	34.0	1	1	1
PRT	sp|Q4KMQ1-2|TPRN_HUMAN	Isoform 2 of Taperin OS=Homo sapiens OX=9606 GN=TPRN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	111-UNIMOD:21	0.06	34.0	2	1	0
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null	859-UNIMOD:21,861-UNIMOD:21	0.03	34.0	6	1	0
PRT	sp|Q06330|SUH_HUMAN	Recombining binding protein suppressor of hairless OS=Homo sapiens OX=9606 GN=RBPJ PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	270-UNIMOD:28	0.03	34.0	1	1	1
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null		0.04	34.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.15	33.0	14	3	2
PRT	sp|Q9UPS6-2|SET1B_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	450-UNIMOD:21,462-UNIMOD:35	0.01	33.0	1	1	1
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	1954-UNIMOD:21	0.03	33.0	4	3	2
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	594-UNIMOD:21,598-UNIMOD:21,418-UNIMOD:35,426-UNIMOD:35,429-UNIMOD:21	0.07	33.0	4	3	2
PRT	sp|Q69YN4-4|VIR_HUMAN	Isoform 4 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	184-UNIMOD:21	0.02	33.0	3	1	0
PRT	sp|Q9H9J4-2|UBP42_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	1166-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P98175-4|RBM10_HUMAN	Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of MORC family CW-type zinc finger protein 2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	715-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|P53985|MOT1_HUMAN	Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	461-UNIMOD:21	0.03	33.0	2	1	0
PRT	sp|Q9C0K0-2|BC11B_HUMAN	Isoform 2 of B-cell lymphoma/leukemia 11B OS=Homo sapiens OX=9606 GN=BCL11B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	607-UNIMOD:21	0.02	33.0	3	1	0
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	72-UNIMOD:21,62-UNIMOD:21	0.35	33.0	2	2	2
PRT	sp|Q04323-2|UBXN1_HUMAN	Isoform 2 of UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	199-UNIMOD:21,202-UNIMOD:21	0.11	33.0	4	2	1
PRT	sp|P02671|FIBA_HUMAN	Fibrinogen alpha chain OS=Homo sapiens OX=9606 GN=FGA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	603-UNIMOD:35,609-UNIMOD:21	0.02	33.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	87-UNIMOD:21,31-UNIMOD:21	0.27	33.0	3	2	1
PRT	sp|P11142-2|HSP7C_HUMAN	Isoform 2 of Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.03	33.0	3	1	0
PRT	sp|Q5TH69|BIG3_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 3 OS=Homo sapiens OX=9606 GN=ARFGEF3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	287-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|Q8N5H7-3|SH2D3_HUMAN	Isoform 3 of SH2 domain-containing protein 3C OS=Homo sapiens OX=9606 GN=SH2D3C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	86-UNIMOD:21	0.04	33.0	1	1	1
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	281-UNIMOD:4,1057-UNIMOD:21	0.03	33.0	4	2	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=HIST1H1E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1,18-UNIMOD:21	0.10	33.0	1	1	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33.0	null	1260-UNIMOD:28,1263-UNIMOD:21	0.01	33.0	1	1	1
PRT	sp|P52756|RBM5_HUMAN	RNA-binding protein 5 OS=Homo sapiens OX=9606 GN=RBM5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33.0	null	78-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|Q9UKS6|PACN3_HUMAN	Protein kinase C and casein kinase substrate in neurons protein 3 OS=Homo sapiens OX=9606 GN=PACSIN3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.04	32.0	1	1	1
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	246-UNIMOD:35	0.05	32.0	2	1	0
PRT	sp|P23511-2|NFYA_HUMAN	Isoform Short of Nuclear transcription factor Y subunit alpha OS=Homo sapiens OX=9606 GN=NFYA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	297-UNIMOD:21,300-UNIMOD:35,311-UNIMOD:35	0.08	32.0	1	1	1
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1543-UNIMOD:21,1547-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|Q5T6J7|GNTK_HUMAN	Probable gluconokinase OS=Homo sapiens OX=9606 GN=IDNK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null		0.07	32.0	2	1	0
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	74-UNIMOD:21,158-UNIMOD:21	0.18	32.0	2	2	2
PRT	sp|P20020-6|AT2B1_HUMAN	Isoform K of Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens OX=9606 GN=ATP2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1119-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|Q9NYU1|UGGG2_HUMAN	UDP-glucose:glycoprotein glucosyltransferase 2 OS=Homo sapiens OX=9606 GN=UGGT2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.01	32.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	375-UNIMOD:35,390-UNIMOD:21,71-UNIMOD:21,388-UNIMOD:21	0.08	32.0	5	2	1
PRT	sp|O95831-6|AIFM1_HUMAN	Isoform 6 of Apoptosis-inducing factor 1, mitochondrial OS=Homo sapiens OX=9606 GN=AIFM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	2	1	0
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	733-UNIMOD:4,749-UNIMOD:21,216-UNIMOD:21	0.04	32.0	2	2	2
PRT	sp|P29692-3|EF1D_HUMAN	Isoform 3 of Elongation factor 1-delta OS=Homo sapiens OX=9606 GN=EEF1D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	138-UNIMOD:21	0.13	32.0	2	1	0
PRT	sp|Q9P206-3|K1522_HUMAN	Isoform 3 of Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	982-UNIMOD:21,990-UNIMOD:21	0.02	32.0	8	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	32.0	null	113-UNIMOD:21	0.03	32.0	6	3	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	682-UNIMOD:21,253-UNIMOD:21	0.04	32.0	5	3	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	587-UNIMOD:35,590-UNIMOD:21	0.02	32.0	3	1	0
PRT	sp|O43707|ACTN4_HUMAN	Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	240-UNIMOD:35	0.04	32.0	2	2	2
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	66-UNIMOD:21	0.06	32.0	3	1	0
PRT	sp|O15231-9|ZN185_HUMAN	Isoform 9 of Zinc finger protein 185 OS=Homo sapiens OX=9606 GN=ZNF185	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	103-UNIMOD:21,104-UNIMOD:4	0.06	32.0	1	1	1
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	799-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	1441-UNIMOD:21,1443-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|Q9H3Z4-2|DNJC5_HUMAN	Isoform 2 of DnaJ homolog subfamily C member 5 OS=Homo sapiens OX=9606 GN=DNAJC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	10-UNIMOD:21	0.11	32.0	1	1	1
PRT	sp|O60568|PLOD3_HUMAN	Multifunctional procollagen lysine hydroxylase and glycosyltransferase LH3 OS=Homo sapiens OX=9606 GN=PLOD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|Q53GD3|CTL4_HUMAN	Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	5-UNIMOD:28	0.02	32.0	2	1	0
PRT	sp|Q9BTC0|DIDO1_HUMAN	Death-inducer obliterator 1 OS=Homo sapiens OX=9606 GN=DIDO1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	1456-UNIMOD:21	0.01	32.0	2	1	0
PRT	sp|Q6JBY9|CPZIP_HUMAN	CapZ-interacting protein OS=Homo sapiens OX=9606 GN=RCSD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	114-UNIMOD:35,123-UNIMOD:21,127-UNIMOD:21,120-UNIMOD:21,126-UNIMOD:21	0.05	31.0	5	1	0
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.12	31.0	2	1	0
PRT	sp|Q9BUB5-3|MKNK1_HUMAN	Isoform 3 of MAP kinase-interacting serine/threonine-protein kinase 1 OS=Homo sapiens OX=9606 GN=MKNK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	178-UNIMOD:4,185-UNIMOD:21	0.06	31.0	2	1	0
PRT	sp|Q9Y4E6-2|WDR7_HUMAN	Isoform 2 of WD repeat-containing protein 7 OS=Homo sapiens OX=9606 GN=WDR7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	769-UNIMOD:35	0.01	31.0	1	1	1
PRT	sp|Q9Y265|RUVB1_HUMAN	RuvB-like 1 OS=Homo sapiens OX=9606 GN=RUVBL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q9NQT8-2|KI13B_HUMAN	Isoform 2 of Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	163-UNIMOD:21	0.05	31.0	3	1	0
PRT	sp|P11717|MPRI_HUMAN	Cation-independent mannose-6-phosphate receptor OS=Homo sapiens OX=9606 GN=IGF2R PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	572-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	225-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q9Y4F5-3|C170B_HUMAN	Isoform 3 of Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	759-UNIMOD:21,585-UNIMOD:21	0.03	31.0	5	2	0
PRT	sp|Q8IYB3-2|SRRM1_HUMAN	Isoform 2 of Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	767-UNIMOD:21,773-UNIMOD:21,461-UNIMOD:21,775-UNIMOD:21,392-UNIMOD:21	0.06	31.0	4	3	2
PRT	sp|Q01082|SPTB2_HUMAN	Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1215-UNIMOD:35,1218-UNIMOD:35	0.02	31.0	3	3	3
PRT	sp|P49411|EFTU_HUMAN	Elongation factor Tu, mitochondrial OS=Homo sapiens OX=9606 GN=TUFM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|Q05D32-2|CTSL2_HUMAN	Isoform 2 of CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	28-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|O43310|CTIF_HUMAN	CBP80/20-dependent translation initiation factor OS=Homo sapiens OX=9606 GN=CTIF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	299-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	207-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	221-UNIMOD:35	0.02	31.0	1	1	1
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|O14558|HSPB6_HUMAN	Heat shock protein beta-6 OS=Homo sapiens OX=9606 GN=HSPB6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	16-UNIMOD:21	0.09	31.0	1	1	1
PRT	sp|Q93073-2|SBP2L_HUMAN	Isoform 2 of Selenocysteine insertion sequence-binding protein 2-like OS=Homo sapiens OX=9606 GN=SECISBP2L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	251-UNIMOD:21,275-UNIMOD:4	0.03	31.0	1	1	1
PRT	sp|P08913|ADA2A_HUMAN	Alpha-2A adrenergic receptor OS=Homo sapiens OX=9606 GN=ADRA2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	246-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|Q8N3D4|EH1L1_HUMAN	EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	1257-UNIMOD:21	0.01	31.0	9	1	0
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	448-UNIMOD:21	0.03	31.0	6	1	0
PRT	sp|Q9H334-6|FOXP1_HUMAN	Isoform 6 of Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	364-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P61266-2|STX1B_HUMAN	Isoform 2 of Syntaxin-1B OS=Homo sapiens OX=9606 GN=STX1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	14-UNIMOD:21	0.06	31.0	2	1	0
PRT	sp|Q9NRX5|SERC1_HUMAN	Serine incorporator 1 OS=Homo sapiens OX=9606 GN=SERINC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null		0.03	31.0	5	1	0
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	207-UNIMOD:21	0.07	31.0	2	1	0
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	591-UNIMOD:21,604-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	525-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|Q9UMS6|SYNP2_HUMAN	Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	31.0	null	604-UNIMOD:21,753-UNIMOD:28,755-UNIMOD:21	0.03	31.0	8	2	0
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	1882-UNIMOD:35,1884-UNIMOD:21,1889-UNIMOD:4	0.01	31.0	1	1	1
PRT	sp|Q15459-2|SF3A1_HUMAN	Isoform 2 of Splicing factor 3A subunit 1 OS=Homo sapiens OX=9606 GN=SF3A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	348-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P29590-2|PML_HUMAN	Isoform PML-5 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	527-UNIMOD:21,518-UNIMOD:21	0.02	30.0	4	1	0
PRT	sp|P05023-2|AT1A1_HUMAN	Isoform 2 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	16-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|P08133-2|ANXA6_HUMAN	Isoform 2 of Annexin A6 OS=Homo sapiens OX=9606 GN=ANXA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q01105-2|SET_HUMAN	Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=H2AFY	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	129-UNIMOD:21	0.04	30.0	3	1	0
PRT	sp|Q5JTV8|TOIP1_HUMAN	Torsin-1A-interacting protein 1 OS=Homo sapiens OX=9606 GN=TOR1AIP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	154-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q15027|ACAP1_HUMAN	Arf-GAP with coiled-coil, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ACAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	389-UNIMOD:21,395-UNIMOD:35	0.03	30.0	1	1	1
PRT	sp|Q92614-3|MY18A_HUMAN	Isoform 3 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	102-UNIMOD:21,145-UNIMOD:21	0.03	30.0	2	2	2
PRT	sp|Q5VWG9|TAF3_HUMAN	Transcription initiation factor TFIID subunit 3 OS=Homo sapiens OX=9606 GN=TAF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	755-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	218-UNIMOD:21	0.05	30.0	1	1	1
PRT	sp|P49750-1|YLPM1_HUMAN	Isoform 1 of YLP motif-containing protein 1 OS=Homo sapiens OX=9606 GN=YLPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O75363|BCAS1_HUMAN	Breast carcinoma-amplified sequence 1 OS=Homo sapiens OX=9606 GN=BCAS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	314-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q15084-3|PDIA6_HUMAN	Isoform 3 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q14149|MORC3_HUMAN	MORC family CW-type zinc finger protein 3 OS=Homo sapiens OX=9606 GN=MORC3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O75128-5|COBL_HUMAN	Isoform 5 of Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	235-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|O15297-2|PPM1D_HUMAN	Isoform 2 of Protein phosphatase 1D OS=Homo sapiens OX=9606 GN=PPM1D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	21-UNIMOD:35,40-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	2	2
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	2181-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	18-UNIMOD:21	0.05	30.0	2	1	0
PRT	sp|O00264-2|PGRC1_HUMAN	Isoform 2 of Membrane-associated progesterone receptor component 1 OS=Homo sapiens OX=9606 GN=PGRMC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	129-UNIMOD:21	0.17	30.0	1	1	1
PRT	sp|Q9BV40|VAMP8_HUMAN	Vesicle-associated membrane protein 8 OS=Homo sapiens OX=9606 GN=VAMP8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	48-UNIMOD:21	0.15	30.0	1	1	1
PRT	sp|Q00059-2|TFAM_HUMAN	Isoform 2 of Transcription factor A, mitochondrial OS=Homo sapiens OX=9606 GN=TFAM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	163-UNIMOD:21	0.07	30.0	1	1	1
PRT	sp|Q8N8E2-2|ZN513_HUMAN	Isoform 2 of Zinc finger protein 513 OS=Homo sapiens OX=9606 GN=ZNF513	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	191-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q15583-4|TGIF1_HUMAN	Isoform 4 of Homeobox protein TGIF1 OS=Homo sapiens OX=9606 GN=TGIF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	137-UNIMOD:21	0.06	30.0	1	1	1
PRT	sp|Q9BUT9|MCRI2_HUMAN	MAPK regulated corepressor interacting protein 2 OS=Homo sapiens OX=9606 GN=MCRIP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	78-UNIMOD:21	0.16	30.0	1	1	1
PRT	sp|Q2M3V2|SWAHA_HUMAN	Ankyrin repeat domain-containing protein SOWAHA OS=Homo sapiens OX=9606 GN=SOWAHA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	260-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|O43312-2|MTSS1_HUMAN	Isoform 2 of Metastasis suppressor protein 1 OS=Homo sapiens OX=9606 GN=MTSS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	287-UNIMOD:21,299-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|P57682|KLF3_HUMAN	Krueppel-like factor 3 OS=Homo sapiens OX=9606 GN=KLF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	250-UNIMOD:21,92-UNIMOD:21,96-UNIMOD:21,97-UNIMOD:35	0.09	30.0	5	2	1
PRT	sp|Q70CQ2-3|UBP34_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 34 OS=Homo sapiens OX=9606 GN=USP34	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	3124-UNIMOD:21,3134-UNIMOD:4,3138-UNIMOD:35	0.01	30.0	3	1	0
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	50-UNIMOD:21,49-UNIMOD:21	0.04	30.0	4	1	0
PRT	sp|Q9H4G0-4|E41L1_HUMAN	Isoform 4 of Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	399-UNIMOD:21,498-UNIMOD:21,503-UNIMOD:21	0.06	30.0	4	2	1
PRT	sp|P31947-2|1433S_HUMAN	Isoform 2 of 14-3-3 protein sigma OS=Homo sapiens OX=9606 GN=SFN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|Q9UEY8-2|ADDG_HUMAN	Isoform 1 of Gamma-adducin OS=Homo sapiens OX=9606 GN=ADD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	651-UNIMOD:21,647-UNIMOD:21	0.03	30.0	2	2	2
PRT	sp|Q8WY36-2|BBX_HUMAN	Isoform 2 of HMG box transcription factor BBX OS=Homo sapiens OX=9606 GN=BBX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	814-UNIMOD:21,819-UNIMOD:21	0.02	30.0	3	1	0
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	125-UNIMOD:21	0.00	30.0	1	1	1
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	2873-UNIMOD:21,2860-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	243-UNIMOD:21,246-UNIMOD:4,620-UNIMOD:4	0.04	30.0	2	2	2
PRT	sp|Q02952|AKA12_HUMAN	A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	219-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P46937|YAP1_HUMAN	Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	107-UNIMOD:28,109-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q14257|RCN2_HUMAN	Reticulocalbin-2 OS=Homo sapiens OX=9606 GN=RCN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|Q96IG2|FXL20_HUMAN	F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	417-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null		0.11	30.0	1	1	1
PRT	sp|Q8IX12|CCAR1_HUMAN	Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens OX=9606 GN=CCAR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	685-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q8N163|CCAR2_HUMAN	Cell cycle and apoptosis regulator protein 2 OS=Homo sapiens OX=9606 GN=CCAR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	569-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q5JUR7|TEX30_HUMAN	Testis-expressed protein 30 OS=Homo sapiens OX=9606 GN=TEX30 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	112-UNIMOD:35,113-UNIMOD:4	0.09	29.0	1	1	1
PRT	sp|P62263|RS14_HUMAN	40S ribosomal protein S14 OS=Homo sapiens OX=9606 GN=RPS14 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	75-UNIMOD:35	0.15	29.0	2	1	0
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	2430-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|Q9Y3A5|SBDS_HUMAN	Ribosome maturation protein SBDS OS=Homo sapiens OX=9606 GN=SBDS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	84-UNIMOD:4	0.15	29.0	2	2	2
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	263-UNIMOD:21	0.03	29.0	2	2	2
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	5620-UNIMOD:21,5832-UNIMOD:21,135-UNIMOD:21,5841-UNIMOD:21,5332-UNIMOD:21	0.02	29.0	11	7	4
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	366-UNIMOD:21	0.05	29.0	6	1	0
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	290-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q9NVH2-4|INT7_HUMAN	Isoform 4 of Integrator complex subunit 7 OS=Homo sapiens OX=9606 GN=INTS7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	289-UNIMOD:21	0.02	29.0	1	1	0
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null		0.02	29.0	4	1	0
PRT	sp|Q9NYJ1|COA4_HUMAN	Cytochrome c oxidase assembly factor 4 homolog, mitochondrial OS=Homo sapiens OX=9606 GN=COA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.18	29.0	2	1	0
PRT	sp|Q8N128|F177A_HUMAN	Protein FAM177A1 OS=Homo sapiens OX=9606 GN=FAM177A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.06	29.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	2	1	0
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	451-UNIMOD:21,453-UNIMOD:21,494-UNIMOD:21	0.08	29.0	4	2	1
PRT	sp|Q6VY07|PACS1_HUMAN	Phosphofurin acidic cluster sorting protein 1 OS=Homo sapiens OX=9606 GN=PACS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	406-UNIMOD:35,411-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q49MG5-2|MAP9_HUMAN	Isoform 2 of Microtubule-associated protein 9 OS=Homo sapiens OX=9606 GN=MAP9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	73-UNIMOD:35,79-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|O60244|MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	1124-UNIMOD:35,1127-UNIMOD:35,1136-UNIMOD:21,1144-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q96RN5-3|MED15_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	488-UNIMOD:35,492-UNIMOD:21	0.03	29.0	4	1	0
PRT	sp|P55287|CAD11_HUMAN	Cadherin-11 OS=Homo sapiens OX=9606 GN=CDH11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	714-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|P41162|ETV3_HUMAN	ETS translocation variant 3 OS=Homo sapiens OX=9606 GN=ETV3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	239-UNIMOD:35,245-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	820-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|A7KAX9-2|RHG32_HUMAN	Isoform 2 of Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	357-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	805-UNIMOD:21	0.01	29.0	2	1	0
PRT	sp|A0FGR8-5|ESYT2_HUMAN	Isoform 5 of Extended synaptotagmin-2 OS=Homo sapiens OX=9606 GN=ESYT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	97-UNIMOD:35,108-UNIMOD:21,112-UNIMOD:21,123-UNIMOD:35	0.10	29.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	345-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|P06702|S10A9_HUMAN	Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	63-UNIMOD:35	0.14	29.0	1	1	1
PRT	sp|O95817|BAG3_HUMAN	BAG family molecular chaperone regulator 3 OS=Homo sapiens OX=9606 GN=BAG3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	373-UNIMOD:4,386-UNIMOD:21,377-UNIMOD:21,385-UNIMOD:21,381-UNIMOD:21	0.04	29.0	4	1	0
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.04	29.0	1	1	1
PRT	sp|P24821-6|TENA_HUMAN	Isoform 6 of Tenascin OS=Homo sapiens OX=9606 GN=TNC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	2	2	2
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	29.0	null	384-UNIMOD:385,384-UNIMOD:4,385-UNIMOD:4,393-UNIMOD:4,58-UNIMOD:4	0.06	29.0	2	2	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	2716-UNIMOD:28,2718-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=HIST1H1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1,18-UNIMOD:21	0.09	29.0	1	1	1
PRT	sp|Q9H7N4|SFR19_HUMAN	Splicing factor, arginine/serine-rich 19 OS=Homo sapiens OX=9606 GN=SCAF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	496-UNIMOD:28,498-UNIMOD:21,500-UNIMOD:21	0.02	29.0	3	1	0
PRT	sp|Q14244-5|MAP7_HUMAN	Isoform 5 of Ensconsin OS=Homo sapiens OX=9606 GN=MAP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	219-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9UDW1|QCR9_HUMAN	Cytochrome b-c1 complex subunit 9 OS=Homo sapiens OX=9606 GN=UQCR10 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.29	28.0	1	1	1
PRT	sp|Q8WUA4|TF3C2_HUMAN	General transcription factor 3C polypeptide 2 OS=Homo sapiens OX=9606 GN=GTF3C2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	888-UNIMOD:35,893-UNIMOD:21,895-UNIMOD:21	0.02	28.0	4	1	0
PRT	sp|Q6UXY1-2|BI2L2_HUMAN	Isoform 2 of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	231-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1223-UNIMOD:21,1234-UNIMOD:35,1243-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|Q9Y2W2|WBP11_HUMAN	WW domain-binding protein 11 OS=Homo sapiens OX=9606 GN=WBP11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	181-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q13247|SRSF6_HUMAN	Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|O14974-5|MYPT1_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	212-UNIMOD:21,221-UNIMOD:35,319-UNIMOD:21,609-UNIMOD:21	0.08	28.0	3	3	3
PRT	sp|Q14498-2|RBM39_HUMAN	Isoform 2 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	136-UNIMOD:21	0.03	28.0	12	1	0
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q8IW45-3|NNRD_HUMAN	Isoform 3 of ATP-dependent (S)-NAD(P)H-hydrate dehydratase OS=Homo sapiens OX=9606 GN=NAXD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|Q14746-2|COG2_HUMAN	Isoform 2 of Conserved oligomeric Golgi complex subunit 2 OS=Homo sapiens OX=9606 GN=COG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	36-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q8WWM7-6|ATX2L_HUMAN	Isoform 6 of Ataxin-2-like protein OS=Homo sapiens OX=9606 GN=ATXN2L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	628-UNIMOD:4,632-UNIMOD:21,630-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	1	1	1
PRT	sp|Q96C19|EFHD2_HUMAN	EF-hand domain-containing protein D2 OS=Homo sapiens OX=9606 GN=EFHD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	74-UNIMOD:21	0.13	28.0	3	2	1
PRT	sp|P49848-4|TAF6_HUMAN	Isoform 4 of Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	623-UNIMOD:21,634-UNIMOD:4,616-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|A6NEL2|SWAHB_HUMAN	Ankyrin repeat domain-containing protein SOWAHB OS=Homo sapiens OX=9606 GN=SOWAHB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	742-UNIMOD:21,740-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|Q9NPQ8-2|RIC8A_HUMAN	Isoform 2 of Synembryn-A OS=Homo sapiens OX=9606 GN=RIC8A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	420-UNIMOD:35	0.05	28.0	1	1	1
PRT	sp|Q9NYB9-2|ABI2_HUMAN	Isoform 2 of Abl interactor 2 OS=Homo sapiens OX=9606 GN=ABI2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	301-UNIMOD:21	0.03	28.0	4	1	0
PRT	sp|O43314|VIP2_HUMAN	Inositol hexakisphosphate and diphosphoinositol-pentakisphosphate kinase 2 OS=Homo sapiens OX=9606 GN=PPIP5K2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.01	28.0	1	1	1
PRT	sp|Q9BV36-3|MELPH_HUMAN	Isoform 3 of Melanophilin OS=Homo sapiens OX=9606 GN=MLPH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	335-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|P05114|HMGN1_HUMAN	Non-histone chromosomal protein HMG-14 OS=Homo sapiens OX=9606 GN=HMGN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	7-UNIMOD:21	0.15	28.0	2	1	0
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1179-UNIMOD:35,1182-UNIMOD:21,1189-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|P61006-2|RAB8A_HUMAN	Isoform 2 of Ras-related protein Rab-8A OS=Homo sapiens OX=9606 GN=RAB8A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.06	28.0	1	1	1
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1153-UNIMOD:21,1152-UNIMOD:21	0.01	28.0	3	1	0
PRT	sp|E7EW31|PROB1_HUMAN	Proline-rich basic protein 1 OS=Homo sapiens OX=9606 GN=PROB1 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	820-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P43405-2|KSYK_HUMAN	Isoform Short of Tyrosine-protein kinase SYK OS=Homo sapiens OX=9606 GN=SYK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	284-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	28-UNIMOD:21,27-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|Q8IY26|PLPP6_HUMAN	Phospholipid phosphatase 6 OS=Homo sapiens OX=9606 GN=PLPP6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	70-UNIMOD:21	0.08	28.0	1	1	1
PRT	sp|Q9BUH6|PAXX_HUMAN	Protein PAXX OS=Homo sapiens OX=9606 GN=PAXX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	148-UNIMOD:21	0.07	28.0	1	1	1
PRT	sp|Q96S55-2|WRIP1_HUMAN	Isoform 2 of ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	153-UNIMOD:21	0.02	28.0	3	1	0
PRT	sp|Q5VUA4|ZN318_HUMAN	Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	40-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|O15213|WDR46_HUMAN	WD repeat-containing protein 46 OS=Homo sapiens OX=9606 GN=WDR46 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	41-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q96RV3-2|PCX1_HUMAN	Isoform 2 of Pecanex-like protein 1 OS=Homo sapiens OX=9606 GN=PCNX1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	420-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9C0B5-2|ZDHC5_HUMAN	Isoform 2 of Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	372-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q9UI08-4|EVL_HUMAN	Isoform 4 of Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	331-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q96NY7-2|CLIC6_HUMAN	Isoform A of Chloride intracellular channel protein 6 OS=Homo sapiens OX=9606 GN=CLIC6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	377-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q13283|G3BP1_HUMAN	Ras GTPase-activating protein-binding protein 1 OS=Homo sapiens OX=9606 GN=G3BP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	230-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q2M2I3|FA83E_HUMAN	Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	324-UNIMOD:21,319-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|O43491-2|E41L2_HUMAN	Isoform 2 of Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	180-UNIMOD:21	0.02	28.0	2	1	0
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	262-UNIMOD:21,263-UNIMOD:35,269-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q9UKM9|RALY_HUMAN	RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	288-UNIMOD:21,135-UNIMOD:21	0.14	28.0	5	2	0
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|Q8N108|MIER1_HUMAN	Mesoderm induction early response protein 1 OS=Homo sapiens OX=9606 GN=MIER1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	488-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|O15068|MCF2L_HUMAN	Guanine nucleotide exchange factor DBS OS=Homo sapiens OX=9606 GN=MCF2L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	992-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q8NE71|ABCF1_HUMAN	ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	228-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q8IWS0|PHF6_HUMAN	PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	155-UNIMOD:21	0.07	28.0	1	1	1
PRT	sp|Q9NQW6-2|ANLN_HUMAN	Isoform 2 of Anillin OS=Homo sapiens OX=9606 GN=ANLN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	182-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q8IYB7-3|DI3L2_HUMAN	Isoform 3 of DIS3-like exonuclease 2 OS=Homo sapiens OX=9606 GN=DIS3L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	396-UNIMOD:4	0.03	27.0	1	1	1
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	567-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|P49754-2|VPS41_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 41 homolog OS=Homo sapiens OX=9606 GN=VPS41	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1726-UNIMOD:21,2406-UNIMOD:21,623-UNIMOD:4,631-UNIMOD:4,2144-UNIMOD:21,2152-UNIMOD:4,2120-UNIMOD:21,2362-UNIMOD:21,2370-UNIMOD:4,2328-UNIMOD:21	0.05	27.0	9	8	7
PRT	sp|Q5T5P2-3|SKT_HUMAN	Isoform 3 of Sickle tail protein homolog OS=Homo sapiens OX=9606 GN=KIAA1217	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1237-UNIMOD:21,1239-UNIMOD:4	0.02	27.0	1	1	1
PRT	sp|Q8NFA2-4|NOXO1_HUMAN	Isoform 4 of NADPH oxidase organizer 1 OS=Homo sapiens OX=9606 GN=NOXO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	330-UNIMOD:21	0.08	27.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q9H7P6|MB12B_HUMAN	Multivesicular body subunit 12B OS=Homo sapiens OX=9606 GN=MVB12B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	226-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|P51003-2|PAPOA_HUMAN	Isoform 2 of Poly(A) polymerase alpha OS=Homo sapiens OX=9606 GN=PAPOLA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	24-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P78364|PHC1_HUMAN	Polyhomeotic-like protein 1 OS=Homo sapiens OX=9606 GN=PHC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	645-UNIMOD:21,658-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q9UNF0-2|PACN2_HUMAN	Isoform 2 of Protein kinase C and casein kinase substrate in neurons protein 2 OS=Homo sapiens OX=9606 GN=PACSIN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	346-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|P09012|SNRPA_HUMAN	U1 small nuclear ribonucleoprotein A OS=Homo sapiens OX=9606 GN=SNRPA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	131-UNIMOD:21,144-UNIMOD:35,147-UNIMOD:35	0.11	27.0	1	1	1
PRT	sp|Q93084-4|AT2A3_HUMAN	Isoform SERCA3G of Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens OX=9606 GN=ATP2A3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	576-UNIMOD:35,581-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	561-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	589-UNIMOD:35,592-UNIMOD:35,161-UNIMOD:21	0.04	27.0	4	2	1
PRT	sp|Q6PL18|ATAD2_HUMAN	ATPase family AAA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ATAD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	327-UNIMOD:21,141-UNIMOD:21	0.03	27.0	4	2	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	132-UNIMOD:35	0.09	27.0	1	1	1
PRT	sp|Q9H3Y8-2|PPDPF_HUMAN	Isoform 2 of Pancreatic progenitor cell differentiation and proliferation factor OS=Homo sapiens OX=9606 GN=PPDPF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	23-UNIMOD:21,30-UNIMOD:4,35-UNIMOD:4	0.41	27.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	2	2
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	132-UNIMOD:21	0.02	27.0	3	1	0
PRT	sp|Q9BRP0-2|OVOL2_HUMAN	Isoform 2 of Transcription factor Ovo-like 2 OS=Homo sapiens OX=9606 GN=OVOL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	137-UNIMOD:21	0.13	27.0	1	1	1
PRT	sp|Q92613|JADE3_HUMAN	Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	566-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	309-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	2228-UNIMOD:21	0.00	27.0	1	1	1
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	88-UNIMOD:21,83-UNIMOD:21,94-UNIMOD:21	0.09	27.0	3	1	0
PRT	sp|O60231|DHX16_HUMAN	Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens OX=9606 GN=DHX16 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q99733|NP1L4_HUMAN	Nucleosome assembly protein 1-like 4 OS=Homo sapiens OX=9606 GN=NAP1L4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	125-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q9NYF3|FA53C_HUMAN	Protein FAM53C OS=Homo sapiens OX=9606 GN=FAM53C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	232-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q9GZR2-2|REXO4_HUMAN	Isoform 2 of RNA exonuclease 4 OS=Homo sapiens OX=9606 GN=REXO4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	246-UNIMOD:4,247-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|Q9UKI8|TLK1_HUMAN	Serine/threonine-protein kinase tousled-like 1 OS=Homo sapiens OX=9606 GN=TLK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	38-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q8N3V7-2|SYNPO_HUMAN	Isoform 2 of Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	804-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	264-UNIMOD:21	0.06	27.0	2	2	2
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	446-UNIMOD:21,453-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q13576-3|IQGA2_HUMAN	Isoform 3 of Ras GTPase-activating-like protein IQGAP2 OS=Homo sapiens OX=9606 GN=IQGAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	849-UNIMOD:35,852-UNIMOD:21,855-UNIMOD:35	0.02	27.0	1	1	1
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1012-UNIMOD:21,620-UNIMOD:21,1010-UNIMOD:21	0.02	27.0	5	2	1
PRT	sp|P85298-4|RHG08_HUMAN	Isoform 4 of Rho GTPase-activating protein 8 OS=Homo sapiens OX=9606 GN=ARHGAP8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	424-UNIMOD:21,427-UNIMOD:35	0.05	27.0	6	1	0
PRT	sp|Q92896|GSLG1_HUMAN	Golgi apparatus protein 1 OS=Homo sapiens OX=9606 GN=GLG1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P48735|IDHP_HUMAN	Isocitrate dehydrogenase [NADP], mitochondrial OS=Homo sapiens OX=9606 GN=IDH2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	53-UNIMOD:35,58-UNIMOD:35	0.04	27.0	1	1	1
PRT	sp|P02545-2|LMNA_HUMAN	Isoform C of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.03	27.0	1	1	1
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	167-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|O75369-7|FLNB_HUMAN	Isoform 7 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	2145-UNIMOD:21,2153-UNIMOD:4,2147-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q9HD45|TM9S3_HUMAN	Transmembrane 9 superfamily member 3 OS=Homo sapiens OX=9606 GN=TM9SF3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	261-UNIMOD:35,264-UNIMOD:35	0.02	27.0	2	1	0
PRT	sp|P51858|HDGF_HUMAN	Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	133-UNIMOD:21,193-UNIMOD:35,199-UNIMOD:21	0.21	27.0	2	2	1
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	1538-UNIMOD:28,1542-UNIMOD:21,1539-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q96TA1|NIBL1_HUMAN	Niban-like protein 1 OS=Homo sapiens OX=9606 GN=FAM129B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	665-UNIMOD:21	0.04	27.0	4	1	0
PRT	sp|Q9NWW5|CLN6_HUMAN	Ceroid-lipofuscinosis neuronal protein 6 OS=Homo sapiens OX=9606 GN=CLN6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	8-UNIMOD:28,23-UNIMOD:21	0.07	27.0	2	1	0
PRT	sp|Q02410|APBA1_HUMAN	Amyloid-beta A4 precursor protein-binding family A member 1 OS=Homo sapiens OX=9606 GN=APBA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	80-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q7Z412|PEX26_HUMAN	Peroxisome assembly protein 26 OS=Homo sapiens OX=9606 GN=PEX26 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	208-UNIMOD:28,211-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|P35611|ADDA_HUMAN	Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	12-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q9Y493|ZAN_HUMAN	Zonadhesin OS=Homo sapiens OX=9606 GN=ZAN PE=2 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	725-UNIMOD:21,731-UNIMOD:21,732-UNIMOD:21,734-UNIMOD:21,742-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q16560|U1SBP_HUMAN	U11/U12 small nuclear ribonucleoprotein 35 kDa protein OS=Homo sapiens OX=9606 GN=SNRNP35 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|Q9NSI8|SAMN1_HUMAN	SAM domain-containing protein SAMSN-1 OS=Homo sapiens OX=9606 GN=SAMSN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	90-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q68DK2-5|ZFY26_HUMAN	Isoform 5 of Zinc finger FYVE domain-containing protein 26 OS=Homo sapiens OX=9606 GN=ZFYVE26	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	297-UNIMOD:21,1762-UNIMOD:21	0.02	26.0	2	2	2
PRT	sp|P02749|APOH_HUMAN	Beta-2-glycoprotein 1 OS=Homo sapiens OX=9606 GN=APOH PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	234-UNIMOD:4,248-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q53GD3-4|CTL4_HUMAN	Isoform 4 of Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P20810-3|ICAL_HUMAN	Isoform 3 of Calpastatin OS=Homo sapiens OX=9606 GN=CAST	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	3	1	0
PRT	sp|Q96PE2|ARHGH_HUMAN	Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	527-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9H0F7|ARL6_HUMAN	ADP-ribosylation factor-like protein 6 OS=Homo sapiens OX=9606 GN=ARL6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|P0C0L4-2|CO4A_HUMAN	Isoform 2 of Complement C4-A OS=Homo sapiens OX=9606 GN=C4A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P14868-2|SYDC_HUMAN	Isoform 2 of Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=DARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q9NX52-3|RHBL2_HUMAN	Isoform 2 of Rhomboid-related protein 2 OS=Homo sapiens OX=9606 GN=RHBDL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	20-UNIMOD:35	0.09	26.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	2	1	0
PRT	sp|Q8IY92-2|SLX4_HUMAN	Isoform 2 of Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1003-UNIMOD:21,1012-UNIMOD:4	0.02	26.0	1	1	1
PRT	sp|P62241|RS8_HUMAN	40S ribosomal protein S8 OS=Homo sapiens OX=9606 GN=RPS8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	130-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	660-UNIMOD:21,662-UNIMOD:21	0.01	26.0	3	1	0
PRT	sp|Q53ET0|CRTC2_HUMAN	CREB-regulated transcription coactivator 2 OS=Homo sapiens OX=9606 GN=CRTC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	624-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q96QH2|PRAM_HUMAN	PML-RARA-regulated adapter molecule 1 OS=Homo sapiens OX=9606 GN=PRAM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	407-UNIMOD:21	0.02	26.0	3	1	0
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	564-UNIMOD:21	0.09	26.0	4	3	2
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	179-UNIMOD:21,656-UNIMOD:21,175-UNIMOD:21,510-UNIMOD:21,283-UNIMOD:21,288-UNIMOD:21	0.06	26.0	7	5	3
PRT	sp|O14967|CLGN_HUMAN	Calmegin OS=Homo sapiens OX=9606 GN=CLGN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	84-UNIMOD:35	0.02	26.0	1	1	1
PRT	sp|Q15393|SF3B3_HUMAN	Splicing factor 3B subunit 3 OS=Homo sapiens OX=9606 GN=SF3B3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	819-UNIMOD:35,823-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|Q9H0E3|SP130_HUMAN	Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	875-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	185-UNIMOD:21,193-UNIMOD:21	0.10	26.0	2	1	0
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	247-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	3101-UNIMOD:21,1710-UNIMOD:35	0.01	26.0	2	2	2
PRT	sp|Q9NX58|LYAR_HUMAN	Cell growth-regulating nucleolar protein OS=Homo sapiens OX=9606 GN=LYAR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	1	1	1
PRT	sp|P35555|FBN1_HUMAN	Fibrillin-1 OS=Homo sapiens OX=9606 GN=FBN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	2244-UNIMOD:35,2245-UNIMOD:4,2251-UNIMOD:4	0.00	26.0	1	1	1
PRT	sp|Q9Y6J0-2|CABIN_HUMAN	Isoform 2 of Calcineurin-binding protein cabin-1 OS=Homo sapiens OX=9606 GN=CABIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1607-UNIMOD:35,1612-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	2	1	0
PRT	sp|Q9H4L4|SENP3_HUMAN	Sentrin-specific protease 3 OS=Homo sapiens OX=9606 GN=SENP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	181-UNIMOD:21,183-UNIMOD:4,184-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q7Z7G8-3|VP13B_HUMAN	Isoform 3 of Vacuolar protein sorting-associated protein 13B OS=Homo sapiens OX=9606 GN=VPS13B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1256-UNIMOD:35,1263-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P02768-2|ALBU_HUMAN	Isoform 2 of Serum albumin OS=Homo sapiens OX=9606 GN=ALB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	192-UNIMOD:4,193-UNIMOD:4,201-UNIMOD:4	0.11	26.0	3	3	2
PRT	sp|Q7Z309-4|F122B_HUMAN	Isoform 4 of Protein FAM122B OS=Homo sapiens OX=9606 GN=FAM122B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	138-UNIMOD:21,134-UNIMOD:21	0.07	26.0	2	1	0
PRT	sp|Q9UD71-2|PPR1B_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 1B OS=Homo sapiens OX=9606 GN=PPP1R1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	36-UNIMOD:4,39-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1411-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1160-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P12036-2|NFH_HUMAN	Isoform 2 of Neurofilament heavy polypeptide OS=Homo sapiens OX=9606 GN=NEFH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	620-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9NVR2|INT10_HUMAN	Integrator complex subunit 10 OS=Homo sapiens OX=9606 GN=INTS10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	230-UNIMOD:35,231-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P63098|CANB1_HUMAN	Calcineurin subunit B type 1 OS=Homo sapiens OX=9606 GN=PPP3R1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|O75362|ZN217_HUMAN	Zinc finger protein 217 OS=Homo sapiens OX=9606 GN=ZNF217 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	648-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P18583-8|SON_HUMAN	Isoform H of Protein SON OS=Homo sapiens OX=9606 GN=SON	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	142-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q8TE67-2|ES8L3_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	205-UNIMOD:21	0.02	26.0	3	1	0
PRT	sp|Q6ZS30-1|NBEL1_HUMAN	Isoform 1 of Neurobeachin-like protein 1 OS=Homo sapiens OX=9606 GN=NBEAL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	719-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9BS26|ERP44_HUMAN	Endoplasmic reticulum resident protein 44 OS=Homo sapiens OX=9606 GN=ERP44 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	92-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|O43294-2|TGFI1_HUMAN	Isoform 2 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	169-UNIMOD:21,177-UNIMOD:21	0.07	26.0	3	1	0
PRT	sp|P01834|IGKC_HUMAN	Immunoglobulin kappa constant OS=Homo sapiens OX=9606 GN=IGKC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	87-UNIMOD:4	0.17	26.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P48681|NEST_HUMAN	Nestin OS=Homo sapiens OX=9606 GN=NES PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	673-UNIMOD:27,680-UNIMOD:21,452-UNIMOD:28,475-UNIMOD:21	0.03	26.0	2	2	2
PRT	sp|Q04323|UBXN1_HUMAN	UBX domain-containing protein 1 OS=Homo sapiens OX=9606 GN=UBXN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	202-UNIMOD:21	0.11	26.0	1	1	0
PRT	sp|P05556|ITB1_HUMAN	Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	500-UNIMOD:4,502-UNIMOD:4,512-UNIMOD:35,516-UNIMOD:4	0.03	26.0	1	1	1
PRT	sp|Q07866|KLC1_HUMAN	Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.04	26.0	2	2	2
PRT	sp|Q8WX93|PALLD_HUMAN	Palladin OS=Homo sapiens OX=9606 GN=PALLD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	736-UNIMOD:28,755-UNIMOD:21,765-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	971-UNIMOD:21	0.02	26.0	1	1	0
PRT	sp|Q9BZ29|DOCK9_HUMAN	Dedicator of cytokinesis protein 9 OS=Homo sapiens OX=9606 GN=DOCK9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	26.0	null	1273-UNIMOD:21,1275-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	167-UNIMOD:28,186-UNIMOD:21,181-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q99856|ARI3A_HUMAN	AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	117-UNIMOD:35,119-UNIMOD:21,123-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|Q6WCQ1-3|MPRIP_HUMAN	Isoform 3 of Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	292-UNIMOD:21,294-UNIMOD:21	0.02	25.0	4	1	0
PRT	sp|Q6IA17-2|SIGIR_HUMAN	Isoform 2 of Single Ig IL-1-related receptor OS=Homo sapiens OX=9606 GN=SIGIRR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	358-UNIMOD:35,364-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|O14827|RGRF2_HUMAN	Ras-specific guanine nucleotide-releasing factor 2 OS=Homo sapiens OX=9606 GN=RASGRF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q9P2Y4|ZN219_HUMAN	Zinc finger protein 219 OS=Homo sapiens OX=9606 GN=ZNF219 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	10-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P63267-2|ACTH_HUMAN	Isoform 2 of Actin, gamma-enteric smooth muscle OS=Homo sapiens OX=9606 GN=ACTG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	34-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P31946-2|1433B_HUMAN	Isoform Short of 14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|O15169-2|AXIN1_HUMAN	Isoform 2 of Axin-1 OS=Homo sapiens OX=9606 GN=AXIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	469-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q14240|IF4A2_HUMAN	Eukaryotic initiation factor 4A-II OS=Homo sapiens OX=9606 GN=EIF4A2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	307-UNIMOD:35	0.04	25.0	2	1	0
PRT	sp|Q9ULU4-4|PKCB1_HUMAN	Isoform 4 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	292-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9H939-2|PPIP2_HUMAN	Isoform 2 of Proline-serine-threonine phosphatase-interacting protein 2 OS=Homo sapiens OX=9606 GN=PSTPIP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|P27816-2|MAP4_HUMAN	Isoform 2 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	278-UNIMOD:35,280-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9UDY2-3|ZO2_HUMAN	Isoform C1 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	963-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q9NYL9|TMOD3_HUMAN	Tropomodulin-3 OS=Homo sapiens OX=9606 GN=TMOD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9UKL0|RCOR1_HUMAN	REST corepressor 1 OS=Homo sapiens OX=9606 GN=RCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	449-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	92-UNIMOD:35,93-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q14515|SPRL1_HUMAN	SPARC-like protein 1 OS=Homo sapiens OX=9606 GN=SPARCL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	59-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9Y4A5-2|TRRAP_HUMAN	Isoform 2 of Transformation/transcription domain-associated protein OS=Homo sapiens OX=9606 GN=TRRAP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1610-UNIMOD:21,1616-UNIMOD:35	0.01	25.0	1	1	1
PRT	sp|P07910-3|HNRPC_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	2	1	0
PRT	sp|Q9NZQ3-5|SPN90_HUMAN	Isoform 5 of NCK-interacting protein with SH3 domain OS=Homo sapiens OX=9606 GN=NCKIPSD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	117-UNIMOD:35,122-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q6KC79-3|NIPBL_HUMAN	Isoform 3 of Nipped-B-like protein OS=Homo sapiens OX=9606 GN=NIPBL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	304-UNIMOD:4,306-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P04003|C4BPA_HUMAN	C4b-binding protein alpha chain OS=Homo sapiens OX=9606 GN=C4BPA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	281-UNIMOD:4	0.02	25.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	623-UNIMOD:4,626-UNIMOD:21,630-UNIMOD:21,656-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|O00203-3|AP3B1_HUMAN	Isoform 2 of AP-3 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP3B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	560-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q5VZL5-2|ZMYM4_HUMAN	Isoform 2 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O15265-3|ATX7_HUMAN	Isoform 3 of Ataxin-7 OS=Homo sapiens OX=9606 GN=ATXN7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	426-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q6IAA8|LTOR1_HUMAN	Ragulator complex protein LAMTOR1 OS=Homo sapiens OX=9606 GN=LAMTOR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	26-UNIMOD:21,27-UNIMOD:21	0.08	25.0	2	1	0
PRT	sp|O15511|ARPC5_HUMAN	Actin-related protein 2/3 complex subunit 5 OS=Homo sapiens OX=9606 GN=ARPC5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.08	25.0	1	1	1
PRT	sp|P50502|F10A1_HUMAN	Hsc70-interacting protein OS=Homo sapiens OX=9606 GN=ST13 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	79-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|O14737|PDCD5_HUMAN	Programmed cell death protein 5 OS=Homo sapiens OX=9606 GN=PDCD5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	117-UNIMOD:35	0.10	25.0	1	1	1
PRT	sp|A2AJT9-3|BCLA3_HUMAN	Isoform 3 of BCLAF1 and THRAP3 family member 3 OS=Homo sapiens OX=9606 GN=BCLAF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	402-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P22059|OSBP1_HUMAN	Oxysterol-binding protein 1 OS=Homo sapiens OX=9606 GN=OSBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|P16989-2|YBOX3_HUMAN	Isoform 2 of Y-box-binding protein 3 OS=Homo sapiens OX=9606 GN=YBX3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	112-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q6ICG6-3|K0930_HUMAN	Isoform 3 of Uncharacterized protein KIAA0930 OS=Homo sapiens OX=9606 GN=KIAA0930	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	270-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q9UIF9-2|BAZ2A_HUMAN	Isoform 1 of Bromodomain adjacent to zinc finger domain protein 2A OS=Homo sapiens OX=9606 GN=BAZ2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1333-UNIMOD:35,1342-UNIMOD:4,1343-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P31323|KAP3_HUMAN	cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	116-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q9H307|PININ_HUMAN	Pinin OS=Homo sapiens OX=9606 GN=PNN PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	66-UNIMOD:21,347-UNIMOD:21	0.04	25.0	2	2	2
PRT	sp|P78537|BL1S1_HUMAN	Biogenesis of lysosome-related organelles complex 1 subunit 1 OS=Homo sapiens OX=9606 GN=BLOC1S1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	22-UNIMOD:21,29-UNIMOD:35	0.12	25.0	1	1	1
PRT	sp|Q9NSI6-3|BRWD1_HUMAN	Isoform C of Bromodomain and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=BRWD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	696-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9BRL6-2|SRSF8_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 8 OS=Homo sapiens OX=9606 GN=SRSF8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	266-UNIMOD:21,273-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|P14317|HCLS1_HUMAN	Hematopoietic lineage cell-specific protein OS=Homo sapiens OX=9606 GN=HCLS1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	275-UNIMOD:21,285-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	552-UNIMOD:21,553-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|O43439-5|MTG8R_HUMAN	Isoform 5 of Protein CBFA2T2 OS=Homo sapiens OX=9606 GN=CBFA2T2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	21-UNIMOD:35,24-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|O00429-7|DNM1L_HUMAN	Isoform 7 of Dynamin-1-like protein OS=Homo sapiens OX=9606 GN=DNM1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	410-UNIMOD:35,413-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P07814|SYEP_HUMAN	Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens OX=9606 GN=EPRS PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	954-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8TDZ2-2|MICA1_HUMAN	Isoform 2 of [F-actin]-monooxygenase MICAL1 OS=Homo sapiens OX=9606 GN=MICAL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	528-UNIMOD:35,531-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q8NFH5-2|NUP35_HUMAN	Isoform 2 of Nucleoporin NUP35 OS=Homo sapiens OX=9606 GN=NUP35	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	49-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|Q14185|DOCK1_HUMAN	Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1681-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	391-UNIMOD:21,400-UNIMOD:35	0.02	25.0	1	1	1
PRT	sp|O95049-5|ZO3_HUMAN	Isoform 6 of Tight junction protein ZO-3 OS=Homo sapiens OX=9606 GN=TJP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	453-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q8IZP0-11|ABI1_HUMAN	Isoform 11 of Abl interactor 1 OS=Homo sapiens OX=9606 GN=ABI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	119-UNIMOD:21,122-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|Q14112-2|NID2_HUMAN	Isoform 2 of Nidogen-2 OS=Homo sapiens OX=9606 GN=NID2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	307-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q2TB10|ZN800_HUMAN	Zinc finger protein 800 OS=Homo sapiens OX=9606 GN=ZNF800 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	426-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P00450|CERU_HUMAN	Ceruloplasmin OS=Homo sapiens OX=9606 GN=CP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	206-UNIMOD:28,224-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	2-UNIMOD:1,14-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q96B23|CR025_HUMAN	Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	66-UNIMOD:21	0.05	25.0	1	1	0
PRT	sp|Q9HCD6|TANC2_HUMAN	Protein TANC2 OS=Homo sapiens OX=9606 GN=TANC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	1446-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P55198|AF17_HUMAN	Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	382-UNIMOD:21,288-UNIMOD:21	0.04	25.0	2	2	2
PRT	sp|P24534|EF1B_HUMAN	Elongation factor 1-beta OS=Homo sapiens OX=9606 GN=EEF1B2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	106-UNIMOD:21	0.10	25.0	1	1	1
PRT	sp|Q6NZY4|ZCHC8_HUMAN	Zinc finger CCHC domain-containing protein 8 OS=Homo sapiens OX=9606 GN=ZCCHC8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	1	1	1
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	1423-UNIMOD:21,1432-UNIMOD:21	0.01	25.0	3	1	0
PRT	sp|Q92597|NDRG1_HUMAN	Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	367-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q8N2S1-2|LTBP4_HUMAN	Isoform 2 of Latent-transforming growth factor beta-binding protein 4 OS=Homo sapiens OX=9606 GN=LTBP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	560-UNIMOD:4,566-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|Q96TA1-2|NIBL1_HUMAN	Isoform 2 of Niban-like protein 1 OS=Homo sapiens OX=9606 GN=FAM129B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	678-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P41252|SYIC_HUMAN	Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=IARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1047-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|Q6PJG6|BRAT1_HUMAN	BRCA1-associated ATM activator 1 OS=Homo sapiens OX=9606 GN=BRAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	569-UNIMOD:35,582-UNIMOD:21,581-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|P17987|TCPA_HUMAN	T-complex protein 1 subunit alpha OS=Homo sapiens OX=9606 GN=TCP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	544-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q13200|PSMD2_HUMAN	26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	16-UNIMOD:21	0.03	24.0	5	1	0
PRT	sp|P48506|GSH1_HUMAN	Glutamate--cysteine ligase catalytic subunit OS=Homo sapiens OX=9606 GN=GCLC PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9UBB9|TFP11_HUMAN	Tuftelin-interacting protein 11 OS=Homo sapiens OX=9606 GN=TFIP11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	98-UNIMOD:21	0.05	24.0	3	2	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	9-UNIMOD:21	0.13	24.0	2	1	0
PRT	sp|Q5SNT2|TM201_HUMAN	Transmembrane protein 201 OS=Homo sapiens OX=9606 GN=TMEM201 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	441-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q92504|S39A7_HUMAN	Zinc transporter SLC39A7 OS=Homo sapiens OX=9606 GN=SLC39A7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	275-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P08670|VIME_HUMAN	Vimentin OS=Homo sapiens OX=9606 GN=VIM PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	430-UNIMOD:21,72-UNIMOD:21,14-UNIMOD:35,25-UNIMOD:21	0.09	24.0	4	3	2
PRT	sp|Q13509-2|TBB3_HUMAN	Isoform 2 of Tubulin beta-3 chain OS=Homo sapiens OX=9606 GN=TUBB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9BVG4|PBDC1_HUMAN	Protein PBDC1 OS=Homo sapiens OX=9606 GN=PBDC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P10645|CMGA_HUMAN	Chromogranin-A OS=Homo sapiens OX=9606 GN=CHGA PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	300-UNIMOD:21,309-UNIMOD:35	0.05	24.0	1	1	1
PRT	sp|Q68CZ2-2|TENS3_HUMAN	Isoform 2 of Tensin-3 OS=Homo sapiens OX=9606 GN=TNS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	420-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q71F23-3|CENPU_HUMAN	Isoform 3 of Centromere protein U OS=Homo sapiens OX=9606 GN=CENPU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	91-UNIMOD:4,98-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	567-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q9P1Y5|CAMP3_HUMAN	Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	368-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P05771-2|KPCB_HUMAN	Isoform Beta-II of Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	641-UNIMOD:21	0.02	24.0	3	1	0
PRT	sp|Q68DK7|MSL1_HUMAN	Male-specific lethal 1 homolog OS=Homo sapiens OX=9606 GN=MSL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	369-UNIMOD:4,373-UNIMOD:21,377-UNIMOD:4,362-UNIMOD:21,66-UNIMOD:21,74-UNIMOD:4	0.07	24.0	3	2	1
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	104-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q9GZR7-2|DDX24_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX24 OS=Homo sapiens OX=9606 GN=DDX24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	82-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|A1X283|SPD2B_HUMAN	SH3 and PX domain-containing protein 2B OS=Homo sapiens OX=9606 GN=SH3PXD2B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	499-UNIMOD:21,502-UNIMOD:35,516-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	205-UNIMOD:35	0.02	24.0	2	1	0
PRT	sp|P46939|UTRO_HUMAN	Utrophin OS=Homo sapiens OX=9606 GN=UTRN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	277-UNIMOD:4,295-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q92878-3|RAD50_HUMAN	Isoform 3 of DNA repair protein RAD50 OS=Homo sapiens OX=9606 GN=RAD50	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	2	2	2
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	507-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	21-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q14739|LBR_HUMAN	Lamin-B receptor OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	128-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q8NC74|RB8NL_HUMAN	RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	464-UNIMOD:21,472-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P53396-3|ACLY_HUMAN	Isoform 3 of ATP-citrate synthase OS=Homo sapiens OX=9606 GN=ACLY	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	186-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	374-UNIMOD:35,382-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q96BD0-2|SO4A1_HUMAN	Isoform 2 of Solute carrier organic anion transporter family member 4A1 OS=Homo sapiens OX=9606 GN=SLCO4A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	34-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q9Y608-2|LRRF2_HUMAN	Isoform 2 of Leucine-rich repeat flightless-interacting protein 2 OS=Homo sapiens OX=9606 GN=LRRFIP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	96-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P46695|IEX1_HUMAN	Radiation-inducible immediate-early gene IEX-1 OS=Homo sapiens OX=9606 GN=IER3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	31-UNIMOD:21	0.15	24.0	1	1	1
PRT	sp|Q92545|TM131_HUMAN	Transmembrane protein 131 OS=Homo sapiens OX=9606 GN=TMEM131 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1155-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P52701-2|MSH6_HUMAN	Isoform GTBP-alt of DNA mismatch repair protein Msh6 OS=Homo sapiens OX=9606 GN=MSH6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	252-UNIMOD:21,137-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|Q9Y6N5|SQOR_HUMAN	Sulfide:quinone oxidoreductase, mitochondrial OS=Homo sapiens OX=9606 GN=SQOR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	337-UNIMOD:4,343-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|Q9P2M7-2|CING_HUMAN	Isoform 2 of Cingulin OS=Homo sapiens OX=9606 GN=CGN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	131-UNIMOD:21,588-UNIMOD:35,593-UNIMOD:35	0.04	24.0	2	2	2
PRT	sp|Q07157-2|ZO1_HUMAN	Isoform Short of Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q14653|IRF3_HUMAN	Interferon regulatory factor 3 OS=Homo sapiens OX=9606 GN=IRF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	173-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q9Y2H2-4|SAC2_HUMAN	Isoform 4 of Phosphatidylinositide phosphatase SAC2 OS=Homo sapiens OX=9606 GN=INPP5F	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	297-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|P48668|K2C6C_HUMAN	Keratin, type II cytoskeletal 6C OS=Homo sapiens OX=9606 GN=KRT6C PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	41-UNIMOD:21,51-UNIMOD:4	0.04	24.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	227-UNIMOD:21,225-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|P46020-3|KPB1_HUMAN	Isoform 3 of Phosphorylase b kinase regulatory subunit alpha, skeletal muscle isoform OS=Homo sapiens OX=9606 GN=PHKA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	913-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	470-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9H9C1-2|SPE39_HUMAN	Isoform 2 of Spermatogenesis-defective protein 39 homolog OS=Homo sapiens OX=9606 GN=VIPAS39	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	72-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q96JC9-2|EAF1_HUMAN	Isoform 2 of ELL-associated factor 1 OS=Homo sapiens OX=9606 GN=EAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	56-UNIMOD:21	0.12	24.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	304-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	641-UNIMOD:35,645-UNIMOD:4,658-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	360-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	616-UNIMOD:21,562-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	101-UNIMOD:21,108-UNIMOD:35,104-UNIMOD:21	0.16	24.0	2	1	0
PRT	sp|O14639|ABLM1_HUMAN	Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	670-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q9UDY2|ZO2_HUMAN	Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	130-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q99808|S29A1_HUMAN	Equilibrative nucleoside transporter 1 OS=Homo sapiens OX=9606 GN=SLC29A1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	266-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|O75382-4|TRIM3_HUMAN	Isoform 4 of Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	308-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q86WR7-2|PRSR2_HUMAN	Isoform 2 of Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	179-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q6ZN55|ZN574_HUMAN	Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	152-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	171-UNIMOD:35,175-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	302-UNIMOD:35,306-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q7L4I2|RSRC2_HUMAN	Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	16-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	3	1	0
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null		0.05	23.0	3	3	3
PRT	sp|Q6NVY1|HIBCH_HUMAN	3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=HIBCH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	234-UNIMOD:21	0.09	23.0	2	2	2
PRT	sp|Q8WU90|ZC3HF_HUMAN	Zinc finger CCCH domain-containing protein 15 OS=Homo sapiens OX=9606 GN=ZC3H15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q14526-2|HIC1_HUMAN	Isoform 2 of Hypermethylated in cancer 1 protein OS=Homo sapiens OX=9606 GN=HIC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	292-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P08473|NEP_HUMAN	Neprilysin OS=Homo sapiens OX=9606 GN=MME PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	4-UNIMOD:21,8-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|Q6WKZ4-2|RFIP1_HUMAN	Isoform 4 of Rab11 family-interacting protein 1 OS=Homo sapiens OX=9606 GN=RAB11FIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	209-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9P2E9-3|RRBP1_HUMAN	Isoform 2 of Ribosome-binding protein 1 OS=Homo sapiens OX=9606 GN=RRBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	674-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P41212|ETV6_HUMAN	Transcription factor ETV6 OS=Homo sapiens OX=9606 GN=ETV6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	18-UNIMOD:21,203-UNIMOD:21,208-UNIMOD:35	0.08	23.0	2	2	2
PRT	sp|Q9HB71-3|CYBP_HUMAN	Isoform 3 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	163-UNIMOD:35	0.06	23.0	2	1	0
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	5-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	102-UNIMOD:21	0.19	23.0	2	1	0
PRT	sp|Q9GZU8|PIP30_HUMAN	PSME3-interacting protein OS=Homo sapiens OX=9606 GN=FAM192A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	44-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|Q9P0K7-4|RAI14_HUMAN	Isoform 4 of Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	638-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q14667-2|K0100_HUMAN	Isoform 2 of Protein KIAA0100 OS=Homo sapiens OX=9606 GN=KIAA0100	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2064-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	51-UNIMOD:21,64-UNIMOD:4,65-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q9HC35|EMAL4_HUMAN	Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	61-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q8ND04|SMG8_HUMAN	Protein SMG8 OS=Homo sapiens OX=9606 GN=SMG8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	656-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O60449|LY75_HUMAN	Lymphocyte antigen 75 OS=Homo sapiens OX=9606 GN=LY75 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1702-UNIMOD:21,1703-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q8N370-4|LAT4_HUMAN	Isoform 4 of Large neutral amino acids transporter small subunit 4 OS=Homo sapiens OX=9606 GN=SLC43A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	255-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P11940-2|PABP1_HUMAN	Isoform 2 of Polyadenylate-binding protein 1 OS=Homo sapiens OX=9606 GN=PABPC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	202-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q5JWR5|DOP1_HUMAN	Protein dopey-1 OS=Homo sapiens OX=9606 GN=DOP1A PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1236-UNIMOD:21,1240-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q8IY33|MILK2_HUMAN	MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	712-UNIMOD:21,653-UNIMOD:21	0.04	23.0	2	2	2
PRT	sp|Q8WUA7-3|TB22A_HUMAN	Isoform 3 of TBC1 domain family member 22A OS=Homo sapiens OX=9606 GN=TBC1D22A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	85-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	266-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q8N448|LNX2_HUMAN	Ligand of Numb protein X 2 OS=Homo sapiens OX=9606 GN=LNX2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	453-UNIMOD:21,461-UNIMOD:4,464-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q96FS4|SIPA1_HUMAN	Signal-induced proliferation-associated protein 1 OS=Homo sapiens OX=9606 GN=SIPA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	884-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	394-UNIMOD:21,582-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|Q8IYW5|RN168_HUMAN	E3 ubiquitin-protein ligase RNF168 OS=Homo sapiens OX=9606 GN=RNF168 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	134-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q9HB09-2|B2L12_HUMAN	Isoform 2 of Bcl-2-like protein 12 OS=Homo sapiens OX=9606 GN=BCL2L12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	113-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|Q07002|CDK18_HUMAN	Cyclin-dependent kinase 18 OS=Homo sapiens OX=9606 GN=CDK18 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	98-UNIMOD:21,101-UNIMOD:35,132-UNIMOD:21	0.05	23.0	2	2	2
PRT	sp|Q92934|BAD_HUMAN	Bcl2-associated agonist of cell death OS=Homo sapiens OX=9606 GN=BAD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	117-UNIMOD:35,118-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	234-UNIMOD:21,237-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q7Z5K2|WAPL_HUMAN	Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	221-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|O15033-2|AREL1_HUMAN	Isoform 2 of Apoptosis-resistant E3 ubiquitin protein ligase 1 OS=Homo sapiens OX=9606 GN=AREL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	327-UNIMOD:21,341-UNIMOD:4	0.03	23.0	1	1	1
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	372-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9BW61|DDA1_HUMAN	DET1- and DDB1-associated protein 1 OS=Homo sapiens OX=9606 GN=DDA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	33-UNIMOD:21	0.10	23.0	1	1	1
PRT	sp|Q86UZ6|ZBT46_HUMAN	Zinc finger and BTB domain-containing protein 46 OS=Homo sapiens OX=9606 GN=ZBTB46 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	176-UNIMOD:21,189-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|Q6P4Q7-2|CNNM4_HUMAN	Isoform 2 of Metal transporter CNNM4 OS=Homo sapiens OX=9606 GN=CNNM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	144-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P43243-2|MATR3_HUMAN	Isoform 2 of Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	310-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q9HB20|PKHA3_HUMAN	Pleckstrin homology domain-containing family A member 3 OS=Homo sapiens OX=9606 GN=PLEKHA3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	244-UNIMOD:21,249-UNIMOD:4,263-UNIMOD:4	0.08	23.0	1	1	1
PRT	sp|Q01831-3|XPC_HUMAN	Isoform 3 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	94-UNIMOD:21	0.11	23.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	121-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P62136-3|PP1A_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase PP1-alpha catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	276-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P63104-2|1433Z_HUMAN	Isoform 2 of 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.08	23.0	1	1	1
PRT	sp|Q9H3P2|NELFA_HUMAN	Negative elongation factor A OS=Homo sapiens OX=9606 GN=NELFA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	23.0	null	220-UNIMOD:28,225-UNIMOD:21,277-UNIMOD:21,227-UNIMOD:21	0.06	23.0	4	2	1
PRT	sp|P11274|BCR_HUMAN	Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q12789|TF3C1_HUMAN	General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	1856-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q96NB3|ZN830_HUMAN	Zinc finger protein 830 OS=Homo sapiens OX=9606 GN=ZNF830 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|Q6WCQ1|MPRIP_HUMAN	Myosin phosphatase Rho-interacting protein OS=Homo sapiens OX=9606 GN=MPRIP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	289-UNIMOD:21	0.02	23.0	1	1	0
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	553-UNIMOD:21,557-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|Q9ULH1|ASAP1_HUMAN	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ASAP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	843-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9NVH2|INT7_HUMAN	Integrator complex subunit 7 OS=Homo sapiens OX=9606 GN=INTS7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	338-UNIMOD:21	0.02	23.0	1	1	0
PRT	sp|Q96ER9|CCD51_HUMAN	Coiled-coil domain-containing protein 51 OS=Homo sapiens OX=9606 GN=CCDC51 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	288-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q8IZW8|TENS4_HUMAN	Tensin-4 OS=Homo sapiens OX=9606 GN=TNS4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	160-UNIMOD:385,160-UNIMOD:4,167-UNIMOD:4,169-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	202-UNIMOD:21,211-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q9HAV7|GRPE1_HUMAN	GrpE protein homolog 1, mitochondrial OS=Homo sapiens OX=9606 GN=GRPEL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	12-UNIMOD:21,19-UNIMOD:21,23-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q14103|HNRPD_HUMAN	Heterogeneous nuclear ribonucleoprotein D0 OS=Homo sapiens OX=9606 GN=HNRNPD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	80-UNIMOD:21	0.05	23.0	1	1	0
PRT	sp|Q86UP2|KTN1_HUMAN	Kinectin OS=Homo sapiens OX=9606 GN=KTN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	75-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q9H4L5-6|OSBL3_HUMAN	Isoform 2b of Oxysterol-binding protein-related protein 3 OS=Homo sapiens OX=9606 GN=OSBPL3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	406-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O75592-2|MYCB2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens OX=9606 GN=MYCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	2920-UNIMOD:21,2936-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	93-UNIMOD:4,106-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|O15144|ARPC2_HUMAN	Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens OX=9606 GN=ARPC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	579-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9H4A3-4|WNK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1625-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9HCG7-2|GBA2_HUMAN	Isoform 2 of Non-lysosomal glucosylceramidase OS=Homo sapiens OX=9606 GN=GBA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	45-UNIMOD:4,47-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P62280|RS11_HUMAN	40S ribosomal protein S11 OS=Homo sapiens OX=9606 GN=RPS11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|Q8WYJ6|SEPT1_HUMAN	Septin-1 OS=Homo sapiens OX=9606 GN=SEPT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	204-UNIMOD:4,206-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|O75150-3|BRE1B_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase BRE1B OS=Homo sapiens OX=9606 GN=RNF40	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q5VUB5|F1711_HUMAN	Protein FAM171A1 OS=Homo sapiens OX=9606 GN=FAM171A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	509-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|O94854-2|K0754_HUMAN	Isoform 2 of Uncharacterized protein KIAA0754 OS=Homo sapiens OX=9606 GN=KIAA0754	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	181-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1631-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q9NY33-4|DPP3_HUMAN	Isoform 4 of Dipeptidyl peptidase 3 OS=Homo sapiens OX=9606 GN=DPP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|A1L390-2|PKHG3_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	292-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q96JQ0|PCD16_HUMAN	Protocadherin-16 OS=Homo sapiens OX=9606 GN=DCHS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	3035-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8N183|NDUF2_HUMAN	NADH dehydrogenase [ubiquinone] 1 alpha subcomplex assembly factor 2 OS=Homo sapiens OX=9606 GN=NDUFAF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	134-UNIMOD:21	0.14	22.0	1	1	1
PRT	sp|O75925|PIAS1_HUMAN	E3 SUMO-protein ligase PIAS1 OS=Homo sapiens OX=9606 GN=PIAS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	503-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9UKM9-2|RALY_HUMAN	Isoform 1 of RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	119-UNIMOD:21	0.04	22.0	1	1	0
PRT	sp|O94915|FRYL_HUMAN	Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|P39023|RL3_HUMAN	60S ribosomal protein L3 OS=Homo sapiens OX=9606 GN=RPL3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	13-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|Q5SXH7-4|PKHS1_HUMAN	Isoform 4 of Pleckstrin homology domain-containing family S member 1 OS=Homo sapiens OX=9606 GN=PLEKHS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	187-UNIMOD:35,191-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9P246|STIM2_HUMAN	Stromal interaction molecule 2 OS=Homo sapiens OX=9606 GN=STIM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	697-UNIMOD:21,698-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|Q01995|TAGL_HUMAN	Transgelin OS=Homo sapiens OX=9606 GN=TAGLN PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	181-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|O15061|SYNEM_HUMAN	Synemin OS=Homo sapiens OX=9606 GN=SYNM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1181-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O43852|CALU_HUMAN	Calumenin OS=Homo sapiens OX=9606 GN=CALU PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q96T88|UHRF1_HUMAN	E3 ubiquitin-protein ligase UHRF1 OS=Homo sapiens OX=9606 GN=UHRF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	287-UNIMOD:21,289-UNIMOD:35,294-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	370-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1497-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P16403|H12_HUMAN	Histone H1.2 OS=Homo sapiens OX=9606 GN=HIST1H1C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	36-UNIMOD:21	0.07	22.0	2	1	0
PRT	sp|Q8N9B5-2|JMY_HUMAN	Isoform 2 of Junction-mediating and -regulatory protein OS=Homo sapiens OX=9606 GN=JMY	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	713-UNIMOD:21,721-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|P15336-3|ATF2_HUMAN	Isoform 3 of Cyclic AMP-dependent transcription factor ATF-2 OS=Homo sapiens OX=9606 GN=ATF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	107-UNIMOD:35,112-UNIMOD:21	0.08	22.0	1	1	1
PRT	sp|Q13416|ORC2_HUMAN	Origin recognition complex subunit 2 OS=Homo sapiens OX=9606 GN=ORC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q9NZT2-2|OGFR_HUMAN	Isoform 2 of Opioid growth factor receptor OS=Homo sapiens OX=9606 GN=OGFR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	315-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P98175-2|RBM10_HUMAN	Isoform 2 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	722-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	131-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q86WB0-2|NIPA_HUMAN	Isoform 2 of Nuclear-interacting partner of ALK OS=Homo sapiens OX=9606 GN=ZC3HC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	300-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q96AP7|ESAM_HUMAN	Endothelial cell-selective adhesion molecule OS=Homo sapiens OX=9606 GN=ESAM PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	366-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q14315-2|FLNC_HUMAN	Isoform 2 of Filamin-C OS=Homo sapiens OX=9606 GN=FLNC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	2565-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P07996-2|TSP1_HUMAN	Isoform 2 of Thrombospondin-1 OS=Homo sapiens OX=9606 GN=THBS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q99653|CHP1_HUMAN	Calcineurin B homologous protein 1 OS=Homo sapiens OX=9606 GN=CHP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|Q9H2Y7|ZN106_HUMAN	Zinc finger protein 106 OS=Homo sapiens OX=9606 GN=ZNF106 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	447-UNIMOD:35,452-UNIMOD:21,457-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q9NS91|RAD18_HUMAN	E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens OX=9606 GN=RAD18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	99-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q96S59-2|RANB9_HUMAN	Isoform 2 of Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	142-UNIMOD:21,144-UNIMOD:21,145-UNIMOD:35,151-UNIMOD:35	0.06	22.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	376-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q15366-6|PCBP2_HUMAN	Isoform 6 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	184-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P16949|STMN1_HUMAN	Stathmin OS=Homo sapiens OX=9606 GN=STMN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	25-UNIMOD:21	0.10	22.0	2	1	0
PRT	sp|Q01664|TFAP4_HUMAN	Transcription factor AP-4 OS=Homo sapiens OX=9606 GN=TFAP4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	123-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	196-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	892-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q7L2J0|MEPCE_HUMAN	7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	152-UNIMOD:21,153-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q9NPR2|SEM4B_HUMAN	Semaphorin-4B OS=Homo sapiens OX=9606 GN=SEMA4B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	813-UNIMOD:21,816-UNIMOD:4,775-UNIMOD:21	0.04	22.0	2	2	2
PRT	sp|Q8N4B1-2|SESQ1_HUMAN	Isoform 2 of Sesquipedalian-1 OS=Homo sapiens OX=9606 GN=PHETA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	56-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q5JRA6-2|TGO1_HUMAN	Isoform 2 of Transport and Golgi organization protein 1 homolog OS=Homo sapiens OX=9606 GN=MIA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1647-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q96KM6|Z512B_HUMAN	Zinc finger protein 512B OS=Homo sapiens OX=9606 GN=ZNF512B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	665-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1089-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	247-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q15170-2|TCAL1_HUMAN	Isoform 2 of Transcription elongation factor A protein-like 1 OS=Homo sapiens OX=9606 GN=TCEAL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	28-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|P78371-2|TCPB_HUMAN	Isoform 2 of T-complex protein 1 subunit beta OS=Homo sapiens OX=9606 GN=CCT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q8IZ73-2|RUSD2_HUMAN	Isoform 2 of RNA pseudouridylate synthase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPUSD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	68-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q8N554-2|ZN276_HUMAN	Isoform 2 of Zinc finger protein 276 OS=Homo sapiens OX=9606 GN=ZNF276	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	285-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	303-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q92610|ZN592_HUMAN	Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	573-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P35268|RL22_HUMAN	60S ribosomal protein L22 OS=Homo sapiens OX=9606 GN=RPL22 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.13	22.0	1	1	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q6NXT2|H3C_HUMAN	Histone H3.3C OS=Homo sapiens OX=9606 GN=H3F3C PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	45-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q9UPQ0|LIMC1_HUMAN	LIM and calponin homology domains-containing protein 1 OS=Homo sapiens OX=9606 GN=LIMCH1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	350-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9C0K0|BC11B_HUMAN	B-cell lymphoma/leukemia 11B OS=Homo sapiens OX=9606 GN=BCL11B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	678-UNIMOD:21	0.02	22.0	1	1	0
PRT	sp|P49848|TAF6_HUMAN	Transcription initiation factor TFIID subunit 6 OS=Homo sapiens OX=9606 GN=TAF6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	636-UNIMOD:21,644-UNIMOD:4	0.04	22.0	1	1	0
PRT	sp|Q8N137|CNTRB_HUMAN	Centrobin OS=Homo sapiens OX=9606 GN=CNTROB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	790-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9ULX3|NOB1_HUMAN	RNA-binding protein NOB1 OS=Homo sapiens OX=9606 GN=NOB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|P46013|KI67_HUMAN	Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	308-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9H2A9|CHST8_HUMAN	Carbohydrate sulfotransferase 8 OS=Homo sapiens OX=9606 GN=CHST8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	291-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.14	22.0	1	1	0
PRT	sp|Q8N9M1|CS047_HUMAN	Uncharacterized protein C19orf47 OS=Homo sapiens OX=9606 GN=C19orf47 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	320-UNIMOD:21,323-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|A1L4H1|SRCRL_HUMAN	Soluble scavenger receptor cysteine-rich domain-containing protein SSC5D OS=Homo sapiens OX=9606 GN=SSC5D PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	1406-UNIMOD:21,1407-UNIMOD:21	0.01	22.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	47	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6576	35.110775	3	3007.3299	3007.3290	K	S	145	174
PSM	HGGVCAPAAVATSPPGAIPK	2	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	46	5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=11361	59.377	2	1936.923	1936.9230	R	E	238	258
PSM	KTDTVVESSVSGDHSGTLR	3	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45	2-UNIMOD:21	ms_run[2]:scan=7175	38.164	2	2053.9317	2053.9317	R	R	33	52
PSM	KVEEVLEEEEEEYVVEK	4	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	45		ms_run[2]:scan=15890	84.084	2	2108.0049	2108.0049	K	V	9	26
PSM	KPEDVLDDDDAGSAPLK	5	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	44		ms_run[2]:scan=10528	55.124	2	1783.8476	1783.8476	R	S	141	158
PSM	APEPHVEEDDDDELDSK	6	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=7055	37.586	2	1938.7967	1938.7967	K	L	5	22
PSM	KEEEEEEEEYDEGSNLK	7	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42		ms_run[2]:scan=6714	35.831	2	2084.8546	2084.8546	K	K	230	247
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	8	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=5106	27.78507833333333	3	3008.3272	3007.3292	K	S	145	174
PSM	AHLTVGQAAAGGSGNLLTER	9	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	13-UNIMOD:21	ms_run[2]:scan=13089	68.403	2	2001.9633	2001.9633	R	S	317	337
PSM	AQGEPVAGHESPKIPYEK	10	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	11-UNIMOD:21	ms_run[2]:scan=8626	45.37	2	2015.9354	2015.9354	R	Q	522	540
PSM	KSAEIDSDDTGGSAAQK	11	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41		ms_run[2]:scan=1465	9.6294	2	1678.7646	1678.7646	K	Q	813	830
PSM	APEPHVEEDDDDELDSK	12	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=7264	38.604	2	1938.7967	1938.7967	K	L	5	22
PSM	GFNCESKPEAEETCFDK	13	sp|P02751-12|FINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=9045	47.646	2	2046.8299	2046.8299	R	Y	84	101
PSM	KWSLEDDDDDEDDPAEAEK	14	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=11273	58.902	3	2220.8819	2220.8819	K	E	197	216
PSM	YKLDEDEDEDDADLSK	15	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40		ms_run[2]:scan=8760	46.215	2	1898.7905	1898.7905	K	Y	167	183
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	16	sp|Q9C0B5|ZDHC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=13648	71.49451666666667	3	3072.3929	3072.3933	R	T	553	583
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	17	sp|Q9C0B5|ZDHC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=13838	72.51960166666667	3	3072.3929	3072.3933	R	T	553	583
PSM	APEPHVEEDDDDELDSK	18	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=6854	36.572	2	1938.7967	1938.7967	K	L	5	22
PSM	IYVASVHQDLSDDDIK	19	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=12614	65.885	2	1816.8843	1816.8843	R	S	168	184
PSM	KPEDVLDDDDAGSAPLK	20	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=9640	50.606	2	1783.8476	1783.8476	R	S	141	158
PSM	NRPDYVSEEEEDDEDFETAVK	21	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=14096	73.966	3	2515.0511	2515.0511	K	K	2662	2683
PSM	DLGHPVEEEDELESGDQEDEDDESEDPGK	22	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39		ms_run[1]:scan=11870	61.97501	3	3243.268006	3242.265475	K	D	929	958
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	23	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6333	33.86752333333333	3	3007.3297	3007.3290	K	S	145	174
PSM	RTSPSDGAMANYESTEVMGDGESAHDSPR	24	sp|Q14C86-2|GAPD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39	2-UNIMOD:21,18-UNIMOD:35	ms_run[1]:scan=9559	50.20621833333333	3	3150.236092	3149.233952	K	D	1042	1071
PSM	DHDDAAESLIEQTTALNK	25	sp|Q9NVK5-3|FGOP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=17038	90.935	2	1969.9229	1969.9229	R	R	21	39
PSM	KNSITEISDNEDDLLEYHR	26	sp|Q86UU1-3|PHLB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21	ms_run[2]:scan=15763	83.322	3	2370.0377	2370.0377	R	R	576	595
PSM	KTSDANETEDHLESLICK	27	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=11838	61.824	2	2168.9297	2168.9297	R	V	20	38
PSM	LKPGGVGAPSSSSPSPSPSAR	28	sp|Q92797|SYMPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	13-UNIMOD:21	ms_run[2]:scan=5929	31.79	2	2001.9521	2001.9521	K	P	1159	1180
PSM	RAELPGSSSPLLAQPR	29	sp|Q9C0H5|RHG39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	9-UNIMOD:21	ms_run[2]:scan=12178	63.682	2	1757.8825	1757.8825	K	K	278	294
PSM	SLLEGQEDHYNNLSASK	30	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=10537	55.165	2	1903.8912	1903.8912	R	V	382	399
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	31	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:28,11-UNIMOD:21	ms_run[1]:scan=6133	32.82373833333334	3	3007.3289	3007.3290	K	S	145	174
PSM	APEPHVEEDDDDELDSK	32	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=6458	34.499	2	1938.7967	1938.7967	K	L	5	22
PSM	FTDKDQQPSGSEGEDDDAEAALKK	33	sp|Q9NXG2|THUM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	11-UNIMOD:21	ms_run[2]:scan=7830	41.467	3	2660.1127	2660.1127	K	E	78	102
PSM	HLGGSGSVVPGSPCLDR	34	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	12-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=11123	58.104	2	1773.7869	1773.7869	R	H	1303	1320
PSM	KWSLEDDDDDEDDPAEAEK	35	sp|Q7L014|DDX46_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37		ms_run[2]:scan=11312	59.101	2	2220.8819	2220.8819	K	E	197	216
PSM	VVDFGSATYDDEHHSTLVSTR	36	sp|P49759|CLK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	19-UNIMOD:21	ms_run[2]:scan=12914	67.476	2	2415.038	2415.0380	K	H	323	344
PSM	YREEEMTVVEEADDDK	37	sp|Q8WYA6-4|CTBL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	6-UNIMOD:35	ms_run[2]:scan=8085	42.76	2	1972.8208	1972.8208	R	K	14	30
PSM	AGDKDDITEPAVCALR	38	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	13-UNIMOD:4	ms_run[2]:scan=11473	59.985	2	1729.8305	1729.8305	R	H	445	461
PSM	DKVVEDDEDDFPTTR	39	sp|Q9Y5P4-2|C43BP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9034	47.596	2	1779.7799	1779.7799	R	S	197	212
PSM	ERDEDDEDGDGDGDGATGK	40	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=707	6.1977	2	1951.7151	1951.7151	K	K	80	99
PSM	GDHASLENEKPGTGDVCSAPAGR	41	sp|Q14699|RFTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	5-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=6799	36.299	3	2404.0115	2404.0115	R	N	195	218
PSM	IEDVGSDEEDDSGKDK	42	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:21	ms_run[2]:scan=3255	18.558	2	1816.6888	1816.6888	K	K	250	266
PSM	IEDVGSDEEDDSGKDKK	43	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:21	ms_run[2]:scan=2258	13.612	2	1944.7837	1944.7837	K	K	250	267
PSM	IHIDPEIQDGSPTTSR	44	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:21	ms_run[2]:scan=10592	55.434	2	1844.8306	1844.8306	R	R	102	118
PSM	ISPPIKEEETKGDSVEK	45	sp|Q6PJT7-5|ZC3HE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	2-UNIMOD:21	ms_run[2]:scan=8297	43.821	2	1964.9344	1964.9344	R	N	408	425
PSM	KDASDDLDDLNFFNQK	46	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=18454	99.927	2	1883.8537	1883.8537	K	K	64	80
PSM	KDASDDLDDLNFFNQK	47	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=18800	102.27	2	1883.8537	1883.8537	K	K	64	80
PSM	KEESEESDDDMGFGLFD	48	sp|P05387|RLA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35	ms_run[2]:scan=17109	91.369	2	1964.7469	1964.7469	K	-	99	116
PSM	KVTGTEGSSSTLVDYTSTSSTGGSPVRK	49	sp|Q7Z6E9-2|RBBP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	24-UNIMOD:21	ms_run[2]:scan=9481	49.802	3	2868.339	2868.3390	R	S	1220	1248
PSM	KVVDYSQFQESDDADEDYGR	50	sp|Q9H1E3|NUCKS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=11551	60.374	3	2364.9982	2364.9982	R	D	9	29
PSM	LKDEDDEDDCFILEK	51	sp|A6NHR9-2|SMHD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:4	ms_run[2]:scan=12827	67.014	2	1882.8142	1882.8142	K	A	449	464
PSM	RTEQEEDEELLTESSK	52	sp|O60264|SMCA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=9573	50.266	2	1921.8753	1921.8753	R	A	145	161
PSM	SLSEEKEDHSDGLAGLK	53	sp|Q6P0Q8|MAST2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	1-UNIMOD:21	ms_run[2]:scan=9263	48.684	2	1893.8357	1893.8357	R	G	874	891
PSM	STAQQELDGKPASPTPVIVASHTANK	54	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	13-UNIMOD:21	ms_run[2]:scan=10633	55.631	3	2726.3276	2726.3276	R	E	818	844
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	55	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=6841	36.50207	3	3007.3299	3007.3290	K	S	145	174
PSM	DPDDDKFFQSAMSICSSLR	56	sp|Q96EY7|PTCD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	12-UNIMOD:35,15-UNIMOD:4	ms_run[2]:scan=19040	103.95	3	2233.962	2233.9620	K	D	409	428
PSM	EAFSLFDKDGDGTITTK	57	sp|P0DP25|CALM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=15892	84.095	2	1843.884	1843.8840	K	E	15	32
PSM	HAASYSSDSENQGSYSGVIPPPPGR	58	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:21	ms_run[2]:scan=11877	62.018	3	2639.1289	2639.1289	R	G	112	137
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	59	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	25-UNIMOD:21	ms_run[2]:scan=13685	71.682	3	2931.3764	2931.3764	R	D	374	402
PSM	HSLDSDEEEDDDDGGSSK	60	sp|O95400|CD2B2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1716	10.874	2	1935.709	1935.7090	K	Y	45	63
PSM	KGAGDGSDEEVDGKADGAEAK	61	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	7-UNIMOD:21	ms_run[2]:scan=1351	9.0933	2	2084.8536	2084.8536	R	P	1937	1958
PSM	KGNAEGSSDEEGKLVIDEPAK	62	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:21	ms_run[2]:scan=8971	47.291	3	2252.021	2252.0210	K	E	119	140
PSM	KQETEEELIENDYR	63	sp|Q96M89-2|CC138_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=11178	58.394	2	1794.8272	1794.8272	K	V	102	116
PSM	LASEAKPAAVAAENEEIGSHIK	64	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21	ms_run[2]:scan=13585	71.14	3	2314.1206	2314.1206	R	H	1896	1918
PSM	LGHPEALSAGTGSPQPPSFTYAQQR	65	sp|Q15942-2|ZYX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:21	ms_run[2]:scan=14186	74.449	3	2676.2333	2676.2333	K	E	139	164
PSM	LPSVEEAEVPKPLPPASK	66	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21	ms_run[2]:scan=14076	73.874	2	1967.0017	1967.0017	R	D	62	80
PSM	QRPSYDIFEDSDDSEPGGPPAPR	67	sp|Q9UMN6|KMT2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	14-UNIMOD:21	ms_run[2]:scan=15905	84.16	3	2611.0864	2611.0864	K	R	1082	1105
PSM	RGLGAGAGAGEESPATSLPR	68	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:21	ms_run[2]:scan=9560	50.21	2	1932.9055	1932.9055	R	M	78	98
PSM	RPSPPEPWDEEDGASCSTFFGSEER	69	sp|Q9P1Y6-2|PHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	3-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=18358	99.308	3	2948.1596	2948.1596	R	T	934	959
PSM	SHTSLKDELSDVSQGGSK	70	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:21	ms_run[2]:scan=10154	53.222	2	1953.8681	1953.8681	R	A	242	260
PSM	SIQEIQELDKDDESLR	71	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=14091	73.943	2	1916.9327	1916.9327	K	K	34	50
PSM	VHAYFAPVTPPTAVAGSGQR	72	sp|Q9UKC9-2|FBXL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:21	ms_run[2]:scan=14989	78.855	3	2105.0095	2105.0095	K	L	328	348
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	73	sp|P06748|NPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16572	88.09847333333333	3	3442.4013	3442.4027	K	L	104	135
PSM	ATAGDTHLGGEDFDNR	74	sp|P48741|HSP77_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6914	36.898	2	1674.7234	1674.7234	K	L	223	239
PSM	DLTHSDSESSLHMSDR	75	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	10-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=3777	21.104	2	1911.7306	1911.7306	R	Q	515	531
PSM	FEEAAFTCEYKYDGQR	76	sp|P18858-3|DNLI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:4	ms_run[2]:scan=13248	69.282	2	2012.8574	2012.8574	R	A	527	543
PSM	GKEESLDSDLYAELR	77	sp|P02775|CXCL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=16000	84.689	2	1723.8265	1723.8265	K	C	48	63
PSM	GVVDSDDLPLNVSR	78	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=14715	77.348	2	1484.7471	1484.7471	K	E	435	449
PSM	IDASKNEEDEGHSNSSPR	79	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	16-UNIMOD:21	ms_run[2]:scan=953	7.3092	2	2050.8229	2050.8229	K	H	68	86
PSM	IEDVGSDEEDDSGKDKK	80	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:21	ms_run[2]:scan=2460	14.631	2	1944.7837	1944.7837	K	K	250	267
PSM	LLDHMAPPPVADQASPR	81	sp|Q9C004|SPY4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=8802	46.412	2	1909.8757	1909.8757	R	A	111	128
PSM	RAEDGSVIDYELIDQDAR	82	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=15775	83.392	2	2063.976	2063.9760	R	D	179	197
PSM	SLGDDISSETSGDFR	83	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=13888	72.789	2	1584.6904	1584.6904	K	K	139	154
PSM	SPGPGPGPGAGAEPGATGGSSHFISSR	84	sp|Q9ULI0-2|ATD2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:21	ms_run[2]:scan=10060	52.732	3	2471.0867	2471.0867	K	T	16	43
PSM	TAKPFPGSVNQPATPFSPTR	85	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:21	ms_run[2]:scan=13957	73.199	2	2179.0463	2179.0463	R	N	193	213
PSM	VHAYFAPVTPPTAVAGSGQR	86	sp|Q9UKC9-2|FBXL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:21	ms_run[2]:scan=14963	78.702	2	2105.0095	2105.0095	K	L	328	348
PSM	VKEEQLKNSAEEEVLSSEK	87	sp|O94880|PHF14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	9-UNIMOD:21	ms_run[2]:scan=10717	56.072	3	2255.057	2255.0570	K	Q	76	95
PSM	VSYGIGDEEHDQEGR	88	sp|P27695|APEX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34		ms_run[2]:scan=6436	34.397	2	1689.7231	1689.7231	K	V	142	157
PSM	WQRPSSPPPFLPAASEEAEPAEGLR	89	sp|Q4KMQ1-2|TPRN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	5-UNIMOD:21	ms_run[2]:scan=18520	100.35	3	2798.3065	2798.3065	R	V	107	132
PSM	STAQQELDGKPASPTPVIVASHTANK	90	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	13-UNIMOD:21	ms_run[1]:scan=11578	60.51278833333333	3	2727.328792	2726.327640	R	E	847	873
PSM	QTALLDADDPVSQLHK	91	sp|Q06330|SUH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:28	ms_run[1]:scan=17219	92.04944	2	1732.8630	1732.8627	K	C	270	286
PSM	KPEEEEEEELEETAQEK	92	sp|O43818|U3IP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=10080	52.84001166666667	2	2075.895050	2074.906620	R	K	62	79
PSM	AAEDDEDDDVDTK	93	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1677	10.656	2	1436.5427	1436.5427	R	K	90	103
PSM	AKDDDDSDIPTAQR	94	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3373	19.084	2	1545.6907	1545.6907	K	K	473	487
PSM	EKPGTPPGPPPPDTNSMELGGR	95	sp|Q9UPS6-2|SET1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=8347	44.077	3	2326.0301	2326.0301	K	P	446	468
PSM	ELEGHISDLQEDLDSER	96	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=15225	80.186	2	1983.9021	1983.9021	R	A	1115	1132
PSM	GNFGGSFAGSFGGAGGHAPGVAR	97	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=15468	81.554	2	2113.912	2113.9120	R	K	589	612
PSM	GPRTPPGPPPPDDDEDDPVPLPVSGDK	98	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:21	ms_run[2]:scan=14450	75.879	3	2842.2698	2842.2698	R	E	181	208
PSM	HDSVENSDSHVEK	99	sp|Q9H9J4-2|UBP42_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=914	7.1466	2	1561.6046	1561.6046	R	K	1164	1177
PSM	HDYDDSSEEQSAEIR	100	sp|P98175-4|RBM10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5217	28.358	2	1779.7184	1779.7184	K	G	55	70
PSM	KDSNELSDSAGEEDSADLKR	101	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:21	ms_run[2]:scan=6711	35.815	3	2244.9383	2244.9383	K	A	709	729
PSM	KESKEEETSIDVAGK	102	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=4522	24.923	2	1728.7819	1728.7819	K	P	459	474
PSM	KPAPLPSPGLNSAAK	103	sp|Q9C0K0-2|BC11B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:21	ms_run[2]:scan=9196	48.367	2	1526.7858	1526.7858	R	R	601	616
PSM	KVASGVLSPPPAAPPPSSSSVPEAGGPPIK	104	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:21	ms_run[2]:scan=14615	76.806	3	2857.4627	2857.4627	K	K	69	99
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	105	sp|Q04323-2|UBXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	22-UNIMOD:21	ms_run[2]:scan=11180	58.406	3	3134.4962	3134.4962	K	R	178	209
PSM	MADEAGSEADHEGTHSTK	106	sp|P02671|FIBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	1-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=822	6.7385	2	1967.7204	1967.7204	K	R	603	621
PSM	RAAEDDEDDDVDTK	107	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=1254	8.6569	2	1592.6438	1592.6438	K	K	89	103
PSM	RNSSEASSGDFLDLK	108	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=14284	74.974	2	1704.7356	1704.7356	R	G	85	100
PSM	STAGDTHLGGEDFDNR	109	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=7245	38.518	2	1690.7183	1690.7183	K	M	221	237
PSM	STAQQELDGKPASPTPVIVASHTANK	110	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	13-UNIMOD:21	ms_run[2]:scan=10439	54.619	3	2726.3276	2726.3276	R	E	818	844
PSM	TAKPFPGSVNQPATPFSPTR	111	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:21	ms_run[2]:scan=13779	72.181	2	2179.0463	2179.0463	R	N	193	213
PSM	TITSAHTSSTSTSLESDSASPGVSDHGR	112	sp|Q5TH69|BIG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	12-UNIMOD:21	ms_run[2]:scan=7655	40.569	3	2854.2254	2854.2254	K	G	276	304
PSM	VHAAPAAPSATALPASPVAR	113	sp|Q8N5H7-3|SH2D3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	16-UNIMOD:21	ms_run[2]:scan=9946	52.149	2	1933.9775	1933.9775	R	R	71	91
PSM	VPVCQPLKEEDDDEGPVDK	114	sp|Q8N1G0|ZN687_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:4	ms_run[2]:scan=9129	48.066	2	2167.9943	2167.9943	K	S	278	297
PSM	SETAPAAPAAPAPAEKTPVK	115	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=8192	43.278715000000005	2	2024.9800	2024.9815	M	K	2	22
PSM	QRGSETDTDSEIHESASDK	116	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=4709	25.816458333333333	3	2153.8397	2153.8381	R	D	1260	1279
PSM	SEDGYHSDGDYGEHDYR	117	sp|P52756|RBM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33	7-UNIMOD:21	ms_run[1]:scan=5329	28.878736666666665	2	2081.709052	2080.707223	R	H	72	89
PSM	AAEDDEDDDVDTKK	118	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1147	8.1662	2	1564.6377	1564.6377	R	Q	90	104
PSM	APEPHVEEDDDDELDSK	119	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=7470	39.62	2	1938.7967	1938.7967	K	L	5	22
PSM	DASDDLDDLNFFNQK	120	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=20439	113.6	2	1755.7588	1755.7588	K	K	65	80
PSM	DLHQGIEAASDEEDLR	121	sp|Q9UKS6|PACN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11951	62.416	3	1796.8177	1796.8177	R	W	267	283
PSM	DPDAQPGGELMLGGTDSK	122	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:35	ms_run[2]:scan=10376	54.324	2	1802.7993	1802.7993	R	Y	236	254
PSM	EKDSPHMQDPNQADEEAMTQIIR	123	sp|P23511-2|NFYA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21,7-UNIMOD:35,18-UNIMOD:35	ms_run[2]:scan=8999	47.428	3	2794.1575	2794.1575	K	V	294	317
PSM	EKEISDDEAEEEKGEK	124	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:21	ms_run[2]:scan=2910	16.92	2	1943.7885	1943.7885	R	E	222	238
PSM	FHALSSPQSPFPSTPTSR	125	sp|O43166-3|SI1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	5-UNIMOD:21	ms_run[2]:scan=14272	74.911	2	2022.9201	2022.9201	K	R	1539	1557
PSM	FYDADDYHPEENR	126	sp|Q5T6J7|GNTK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8075	42.702	2	1669.6645	1669.6645	K	R	32	45
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	127	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	14-UNIMOD:21	ms_run[2]:scan=13203	69.032	3	2649.1708	2649.1708	K	S	61	87
PSM	IEDSEPHIPLIDDTDAEDDAPTKR	128	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21	ms_run[2]:scan=16400	87.051	3	2771.2175	2771.2175	R	N	1116	1140
PSM	IKEDILTDEDEK	129	sp|Q9NYU1|UGGG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8448	44.575	2	1446.709	1446.7090	K	T	1194	1206
PSM	IPMTPTSSFVSPPPPTASPHSNR	130	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=12621	65.922	2	2500.1458	2500.1458	K	T	373	396
PSM	KAALSASEGEEVPQDK	131	sp|O95831-6|AIFM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5251	28.498	2	1657.8159	1657.8159	K	A	25	41
PSM	KCEAEEAEPPAATQPQTSETQTSHLPESER	132	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=8856	46.676	3	3417.4668	3417.4668	K	I	732	762
PSM	KPAPLPSPGLNSAAK	133	sp|Q9C0K0-2|BC11B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:21	ms_run[2]:scan=8981	47.34	2	1526.7858	1526.7858	R	R	601	616
PSM	KPATPAEDDEDDDIDLFGSDNEEEDKEAAQLR	134	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	19-UNIMOD:21	ms_run[2]:scan=16562	88.049	3	3656.5163	3656.5163	K	E	120	152
PSM	KPSVGVPPPASPSYPR	135	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=9799	51.39	2	1714.8444	1714.8444	R	A	980	996
PSM	KPSVGVPPPASPSYPR	136	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=10403	54.447	2	1714.8444	1714.8444	R	A	980	996
PSM	KQSFDDNDSEELEDK	137	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=6527	34.86	2	1797.7541	1797.7541	K	D	105	120
PSM	KTEELEEESFPER	138	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9134	48.088	2	1621.7471	1621.7471	R	S	486	499
PSM	KTEELEEESFPER	139	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9343	49.108	2	1621.7471	1621.7471	R	S	486	499
PSM	LKDQDQDEDEEEK	140	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=891	7.0578	2	1619.6799	1619.6799	R	E	182	195
PSM	MDRTPPPPTLSPAAITVGR	141	sp|Q8NDX5-2|PHC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=14436	75.799	2	2072.0126	2072.0126	R	G	587	606
PSM	MLDAEDIVNTARPDEK	142	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:35	ms_run[2]:scan=13521	70.786	2	1831.8622	1831.8622	K	A	240	256
PSM	RDSSESQLASTESDKPTTGR	143	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=4694	25.747	3	2230.9703	2230.9703	R	V	64	84
PSM	RDSSESQLASTESDKPTTGR	144	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=4712	25.832	2	2230.9703	2230.9703	R	V	64	84
PSM	RESCGSSVLTDFEGKDVATK	145	sp|O15231-9|ZN185_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=14110	74.037	3	2264.9984	2264.9984	R	V	101	121
PSM	RPSPPEPWDEEDGASCSTFFGSEER	146	sp|Q9P1Y6-2|PHRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=18166	98.099	3	2948.1596	2948.1596	R	T	934	959
PSM	RTGSTPSIASTHSELSTYSNNSGNAAVIK	147	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21	ms_run[2]:scan=13001	67.941	3	3029.4091	3029.4091	R	Y	796	825
PSM	SKSVKEDSNLTLQEK	148	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	1-UNIMOD:21	ms_run[2]:scan=5405	29.25	2	1784.8557	1784.8557	K	K	1441	1456
PSM	SLSTSGESLYHVLGLDK	149	sp|Q9H3Z4-2|DNJC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=21595	122.1	2	1884.887	1884.8870	R	N	8	25
PSM	TAKPFPGSVNQPATPFSPTR	150	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:21	ms_run[2]:scan=13590	71.169	2	2179.0463	2179.0463	R	N	193	213
PSM	YKDDDDDQLFYTR	151	sp|O60568|PLOD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11435	59.77	2	1692.7267	1692.7267	K	L	185	198
PSM	QRDEDDEAYGKPVK	152	sp|Q53GD3|CTL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=3691	20.694205	2	1631.7412	1631.7422	K	Y	5	19
PSM	STAQQELDGKPASPTPVIVASHTANK	153	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	13-UNIMOD:21	ms_run[1]:scan=11182	58.418553333333335	3	2727.313858	2726.327640	R	E	847	873
PSM	RNSVERPAEPVAGAATPSLVEQQK	154	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	3-UNIMOD:21	ms_run[1]:scan=11513	60.19836333333333	3	2614.277772	2613.291195	R	M	1454	1478
PSM	AMVSPFHSPPSTPSSPGVR	155	sp|Q6JBY9|CPZIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	2-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=11211	58.561	2	2032.9078	2032.9078	K	S	113	132
PSM	DADDAVYELDGK	156	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=9950	52.177	2	1309.5674	1309.5674	R	E	49	61
PSM	DLKPENILCESPEKVSPVK	157	sp|Q9BUB5-3|MKNK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=15331	80.782	3	2261.1015	2261.1015	R	I	170	189
PSM	EHLLDDEEEDEEIMR	158	sp|Q9Y4E6-2|WDR7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	14-UNIMOD:35	ms_run[2]:scan=10399	54.428	2	1916.7946	1916.7946	K	Q	756	771
PSM	EHVEEISELFYDAK	159	sp|Q9Y265|RUVB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=18015	97.141	2	1707.7992	1707.7992	K	S	428	442
PSM	ERPDLEAPAPGSPFR	160	sp|Q9NQT8-2|KI13B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=12529	65.471	2	1717.7825	1717.7825	R	V	152	167
PSM	GNIQLSYSDGDDCGHGK	161	sp|P11717|MPRI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:4	ms_run[2]:scan=7510	39.834	2	1821.7588	1821.7588	K	K	560	577
PSM	HIISATSLSTSPTELGSR	162	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:21	ms_run[2]:scan=13171	68.842	2	1935.9303	1935.9303	R	N	216	234
PSM	ILDSVGIEADDDRLNK	163	sp|P05387|RLA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=12493	65.277	2	1771.8952	1771.8952	K	V	26	42
PSM	KGAGDGSDEEVDGK	164	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:21	ms_run[2]:scan=972	7.3892	2	1442.5562	1442.5562	R	A	1937	1951
PSM	KGNAEGSSDEEGKLVIDEPAK	165	sp|P51858-2|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:21	ms_run[2]:scan=8869	46.739	2	2252.021	2252.0210	K	E	119	140
PSM	KPLAAPGDGEGLGQTAQPSPPAR	166	sp|Q9Y4F5-3|C170B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	19-UNIMOD:21	ms_run[2]:scan=9738	51.09	2	2294.1056	2294.1056	R	D	741	764
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	167	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=14720	77.372	3	2742.2819	2742.2819	K	K	761	786
PSM	KQEDFMTTMDANEEK	168	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:35,9-UNIMOD:35	ms_run[2]:scan=3311	18.817	2	1847.7553	1847.7553	K	I	1210	1225
PSM	KYEEIDNAPEER	169	sp|P49411|EFTU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=4940	26.971	2	1491.6842	1491.6842	K	A	91	103
PSM	KYSEVDDSLPSGGEKPSK	170	sp|Q05D32-2|CTSL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=8017	42.406	2	2001.8932	2001.8932	R	N	26	44
PSM	LEDTAGDTGHSSLEAPRSPDTLAPVASER	171	sp|O43310|CTIF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	18-UNIMOD:21	ms_run[2]:scan=12425	64.938	3	3058.3881	3058.3881	K	L	282	311
PSM	LNHVAAGLVSPSLK	172	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:21	ms_run[2]:scan=12297	64.299	2	1484.7752	1484.7752	K	S	198	212
PSM	MLDAEDIVGTARPDEK	173	sp|P12814-2|ACTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:35	ms_run[2]:scan=12817	66.964	2	1774.8407	1774.8407	K	A	221	237
PSM	NDIHLDADDPNSADK	174	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6226	33.295	2	1638.7122	1638.7122	K	H	686	701
PSM	RASAPLPGLSAPGR	175	sp|O14558|HSPB6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=10856	56.774	2	1428.7239	1428.7239	R	L	14	28
PSM	RASHPTAESSSEQGASEADIDSDSGYCSPK	176	sp|Q93073-2|SBP2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21,27-UNIMOD:4	ms_run[2]:scan=8002	42.334	3	3205.2779	3205.2779	R	H	249	279
PSM	RGPDAVAAPPGGTER	177	sp|P08913|ADA2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21	ms_run[2]:scan=4345	24.08	2	1529.6988	1529.6988	R	R	234	249
PSM	RPSVNGEPGSVPPPR	178	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=6056	32.463	2	1624.7723	1624.7723	R	A	1255	1270
PSM	RPSVNGEPGSVPPPR	179	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=6142	32.868	2	1624.7723	1624.7723	R	A	1255	1270
PSM	RVSEVEEEKEPVPQPLPSDDTR	180	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=10927	57.131	3	2615.2116	2615.2116	R	V	446	468
PSM	RYSDKYNVPISSADIAQNQEFYK	181	sp|Q9H334-6|FOXP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=16325	86.609	3	2815.2854	2815.2854	R	N	362	385
PSM	SAKDSDDEEEVVHVDR	182	sp|P61266-2|STX1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21	ms_run[2]:scan=6484	34.625	2	1908.7738	1908.7738	R	D	10	26
PSM	SDGSLEDGDDVHR	183	sp|Q9NRX5|SERC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3131	17.993	2	1400.5804	1400.5804	R	A	361	374
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	184	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21	ms_run[2]:scan=9436	49.584	3	2686.2501	2686.2501	R	R	207	233
PSM	STAQQELDGKPASPTPVIVASHTANK	185	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21	ms_run[2]:scan=10034	52.6	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	186	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21	ms_run[2]:scan=10196	53.441	2	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	187	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21	ms_run[2]:scan=10230	53.611	3	2726.3276	2726.3276	R	E	818	844
PSM	TKGDDTDTRDDISILATGCK	188	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=12949	67.666	3	2260.9883	2260.9883	K	G	586	606
PSM	VLRPPGGGSNFSLGFDEPTEQPVR	189	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=18272	98.805	3	2635.2432	2635.2432	R	K	20	44
PSM	VRGGAPDPSPGATATPGAPAQPSSPDAR	190	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	23-UNIMOD:21	ms_run[2]:scan=7099	37.786	3	2664.2293	2664.2293	R	R	503	531
PSM	YKDDDDDQLFYTR	191	sp|O60568|PLOD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=11630	60.783	2	1692.7267	1692.7267	K	L	185	198
PSM	TAKPFPGSVNQPATPFSPTR	192	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	17-UNIMOD:21	ms_run[1]:scan=13906	72.88414333333334	3	2180.048467	2179.046320	R	N	588	608
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	193	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=5184	28.187328333333333	3	3008.3272	3007.3292	K	S	145	174
PSM	RTSPSDGAMANYESTEVMGDGESAHDSPR	194	sp|Q14C86-2|GAPD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	2-UNIMOD:21,9-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=6601	35.235859999999995	3	3167.232238	3165.228867	K	D	1042	1071
PSM	KVAEPELMGTPDGTCYPPPPVPR	195	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	8-UNIMOD:35,10-UNIMOD:21,15-UNIMOD:4	ms_run[1]:scan=13859	72.632705	3	2604.177763	2603.180113	R	Q	1875	1898
PSM	RPSVNGEPGSVPPPR	196	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	3-UNIMOD:21	ms_run[1]:scan=6339	33.900823333333335	2	1625.759908	1624.772270	R	A	1255	1270
PSM	AGDKDDITEPAVCALR	197	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:4	ms_run[2]:scan=11288	58.984	2	1729.8305	1729.8305	R	H	445	461
PSM	ALASEKSPTADAKPAPK	198	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21	ms_run[2]:scan=2891	16.833	3	1760.871	1760.8710	K	R	266	283
PSM	ASKPLPPAPAPDEYLVSPITGEK	199	sp|Q15459-2|SF3A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:21	ms_run[2]:scan=16564	88.06	3	2456.224	2456.2240	K	I	332	355
PSM	AVSPPHLDGPPSPR	200	sp|P29590-2|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=9462	49.717	2	1505.7028	1505.7028	K	S	516	530
PSM	DKYEPAAVSEQGDKK	201	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=3631	20.399	2	1743.7717	1743.7717	R	G	8	23
PSM	DLEADIIGDTSGHFQK	202	sp|P08133-2|ANXA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=18226	98.495	2	1744.8268	1744.8268	R	M	109	125
PSM	ELNSNHDGADETSEK	203	sp|Q01105-2|SET_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1059	7.7801	2	1644.6863	1644.6863	K	E	12	27
PSM	GKLEAIITPPPAK	204	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21	ms_run[2]:scan=11202	58.515	2	1413.7633	1413.7633	K	K	122	135
PSM	GKLEAIITPPPAK	205	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21	ms_run[2]:scan=11389	59.526	2	1413.7633	1413.7633	K	K	122	135
PSM	GLRDSHSSEEDEASSQTDLSQTISK	206	sp|Q5JTV8|TOIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21	ms_run[2]:scan=9686	50.839	3	2786.188	2786.1880	R	K	150	175
PSM	GNFGGSFAGSFGGAGGHAPGVAR	207	sp|P52272-2|HNRPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21	ms_run[2]:scan=14800	77.83	2	2113.912	2113.9120	R	K	589	612
PSM	GPGQGSGHLAIGSAATLGSGGMAR	208	sp|Q15027|ACAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	16-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=10775	56.359	3	2204.9998	2204.9998	R	G	374	398
PSM	GSVILDSGHLSTASSSDDLKGEEGSFR	209	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:21	ms_run[2]:scan=14794	77.796	3	2830.2658	2830.2658	R	G	88	115
PSM	HGGVCAPAAVATSPPGAIPK	210	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=11173	58.365	2	1936.923	1936.9230	R	E	238	258
PSM	IEDVGSDEEDDSGKDKK	211	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=2060	12.6	2	1944.7837	1944.7837	K	K	250	267
PSM	IKVEPVALAPSPVIPR	212	sp|Q5VWG9|TAF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=16692	88.793	2	1764.9903	1764.9903	K	L	745	761
PSM	IYHLPDAESDEDEDFK	213	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=14483	76.07	2	2001.7881	2001.7881	K	E	210	226
PSM	KDAEEEESELGYIPK	214	sp|P49750-1|YLPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11835	61.808	2	1735.8152	1735.8152	K	S	1833	1848
PSM	KDPEDTGAEKSPTTSADLK	215	sp|O75363|BCAS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=3949	21.999	2	2068.9202	2068.9202	K	S	304	323
PSM	KDVIELTDDSFDK	216	sp|Q15084-3|PDIA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=13832	72.482	2	1523.7355	1523.7355	K	N	157	170
PSM	KEETVEDEIDVR	217	sp|Q14149|MORC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=9565	50.231	2	1460.6995	1460.6995	K	N	651	663
PSM	KPATPAEDDEDDDIDLFGSDNEEEDKEAAQLR	218	sp|P29692-3|EF1D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	19-UNIMOD:21	ms_run[2]:scan=16941	90.332	3	3656.5163	3656.5163	K	E	120	152
PSM	KPSVGVPPPASPSYPR	219	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=9276	48.747	3	1714.8444	1714.8444	R	A	980	996
PSM	KPSVGVPPPASPSYPR	220	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=9995	52.404	2	1714.8444	1714.8444	R	A	980	996
PSM	KSSLGNDETDKEK	221	sp|O75128-5|COBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=892	7.0614	2	1529.661	1529.6610	R	K	233	246
PSM	KTDTVVESSVSGDHSGTLR	222	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:21	ms_run[2]:scan=6832	36.459	3	2053.9317	2053.9317	R	R	33	52
PSM	KVELSESEEDKGGK	223	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21	ms_run[2]:scan=2616	15.393	2	1613.7186	1613.7186	R	M	457	471
PSM	KVIEEQLEPAVEK	224	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=8931	47.075	2	1510.8243	1510.8243	R	I	1224	1237
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	225	sp|Q04323-2|UBXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	22-UNIMOD:21	ms_run[2]:scan=10984	57.396	3	3134.4962	3134.4962	K	R	178	209
PSM	KYMEDVTQIVVEPEPTAEEKPSPR	226	sp|O15297-2|PPM1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=13076	68.342	3	2867.33	2867.3300	R	R	19	43
PSM	LDETDDPDDYGDR	227	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6357	34.002	2	1524.5852	1524.5852	R	E	401	414
PSM	LEAEEGRNSLSPVQATQKPLVSK	228	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=10719	56.082	3	2560.2898	2560.2898	R	K	113	136
PSM	LEDELKDDAQSVETLGKPK	229	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=12478	65.206	3	2194.0406	2194.0406	K	A	2171	2190
PSM	LGGLRPESPESLTSVSR	230	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21	ms_run[2]:scan=13660	71.552	2	1863.9092	1863.9092	R	T	11	28
PSM	LLKEGEEPTVYSDEEEPKDESAR	231	sp|O00264-2|PGRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=9485	49.821	3	2729.1957	2729.1957	K	K	118	141
PSM	LPSVEEAEVPKPLPPASK	232	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=13997	73.421	3	1967.0017	1967.0017	R	D	62	80
PSM	NKTEDLEATSEHFK	233	sp|Q9BV40|VAMP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=8502	44.812	2	1727.7404	1727.7404	R	T	46	60
PSM	NLSDSEKELYIQHAK	234	sp|Q00059-2|TFAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21	ms_run[2]:scan=9274	48.734	2	1853.8561	1853.8561	K	E	159	174
PSM	PARPPSPTEQEGAVPR	235	sp|Q8N8E2-2|ZN513_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=6533	34.891	3	1767.8305	1767.8305	R	R	186	202
PSM	PLSPKPSSPGSVLAR	236	sp|Q15583-4|TGIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=10037	52.614	3	1571.8073	1571.8073	R	P	135	150
PSM	RAAEDDEDDDVDTK	237	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=984	7.4468	2	1592.6438	1592.6438	K	K	89	103
PSM	RAAEDDEDDDVDTK	238	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1478	9.6873	2	1592.6438	1592.6438	K	K	89	103
PSM	RAAEDDEDDDVDTK	239	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1685	10.696	2	1592.6438	1592.6438	K	K	89	103
PSM	RAAEDDEDDDVDTK	240	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1886	11.705	2	1592.6438	1592.6438	K	K	89	103
PSM	RAPSTSPSFEGTQETYTVAHEENVR	241	sp|Q9BUT9|MCRI2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=12232	63.968	3	2872.2665	2872.2665	R	F	75	100
PSM	RLSVEESGLGLGLGPGR	242	sp|Q2M3V2|SWAHA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=16651	88.567	2	1775.8931	1775.8931	R	S	258	275
PSM	RPASTAGLPTTLGPAMVTPGVATIR	243	sp|O43312-2|MTSS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=17254	92.262	3	2530.2979	2530.2979	K	R	284	309
PSM	RPLPVESPDTQR	244	sp|P57682|KLF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21	ms_run[2]:scan=6000	32.184	2	1473.6977	1473.6977	K	K	244	256
PSM	RVSEVEEEKEPVPQPLPSDDTR	245	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=10721	56.092	3	2615.2116	2615.2116	R	V	446	468
PSM	RVSSDEEHTVDSCISDMK	246	sp|Q70CQ2-3|UBP34_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,13-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=7323	38.904	2	2189.8606	2189.8606	R	T	3122	3140
PSM	SDDSKSSSPELVTHLK	247	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21	ms_run[2]:scan=8268	43.663	2	1808.8193	1808.8193	K	W	44	60
PSM	SDDSKSSSPELVTHLK	248	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=8508	44.847	3	1808.8193	1808.8193	K	W	44	60
PSM	SLDGAEFSRPASVSENHDAGPDGDK	249	sp|Q9H4G0-4|E41L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:21	ms_run[2]:scan=10373	54.313	3	2637.098	2637.0980	R	R	399	424
PSM	SNEEGSEEKGPEVR	250	sp|P31947-2|1433S_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1770	11.137	2	1545.6907	1545.6907	K	E	69	83
PSM	SPEKIEEVLSPEGSPSKSPSK	251	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	20-UNIMOD:21	ms_run[2]:scan=11198	58.495	3	2291.0934	2291.0934	K	K	632	653
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	252	sp|Q68EM7-7|RHG17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:21	ms_run[2]:scan=9638	50.6	3	2686.2501	2686.2501	R	R	207	233
PSM	TADGRVSPAGGTLDDKPK	253	sp|Q8WY36-2|BBX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21	ms_run[2]:scan=3859	21.517	3	1863.8728	1863.8728	R	E	808	826
PSM	TPHVQAVQGPLGSPPK	254	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:21	ms_run[2]:scan=10385	54.367	2	1691.8396	1691.8396	R	R	113	129
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	255	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:21	ms_run[2]:scan=8737	46.091	3	2919.2268	2919.2268	R	S	2860	2891
PSM	VDNDENEHQLSLR	256	sp|P06748-3|NPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=6248	33.407	2	1567.7227	1567.7227	K	T	33	46
PSM	VDSTTCLFPVEEK	257	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=15981	84.592	2	1603.6841	1603.6841	R	A	241	254
PSM	VPVCQPLKEEDDDEGPVDK	258	sp|Q8N1G0|ZN687_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:4	ms_run[2]:scan=9104	47.931	3	2167.9943	2167.9943	K	S	278	297
PSM	WDKDDFESEEEDVK	259	sp|Q7Z6E9-2|RBBP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11655	60.901	2	1769.7268	1769.7268	K	S	1287	1301
PSM	KGAGDGSDEEVDGKADGAEAK	260	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:21	ms_run[1]:scan=2150	13.078935000000001	3	2085.855645	2084.853553	R	P	1937	1958
PSM	KDEGEGAAGAGDHKDPSLGAGEAASK	261	sp|Q02952|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	17-UNIMOD:21	ms_run[1]:scan=5081	27.661676666666665	3	2504.044618	2504.081655	K	E	203	229
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	262	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,18-UNIMOD:21	ms_run[1]:scan=7029	37.482011666666665	3	3007.3285	3007.3290	K	S	145	174
PSM	QASTDAGTAGALTPQHVR	263	sp|P46937|YAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=9851	51.669918333333335	2	1842.8239	1842.8256	R	A	107	125
PSM	FVNDYDKDNDGR	264	sp|Q14257|RCN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=3687	20.670933333333334	2	1456.625818	1456.621886	R	L	235	247
PSM	VHAYFAPVTPPPSVGGSR	265	sp|Q96IG2|FXL20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	9-UNIMOD:21	ms_run[1]:scan=14191	74.47454	2	1916.930908	1917.913849	K	Q	409	427
PSM	VEEEDEEEEEEEEEEEEEEDE	266	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=7905	41.818576666666665	2	2669.951126	2669.899541	K	-	180	201
PSM	ELEKSEKEEDEDDDR	267	sp|Q8IX12|CCAR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	5-UNIMOD:21	ms_run[1]:scan=1194	8.386531666666666	2	1944.732238	1944.747356	K	K	681	696
PSM	VVSPPEPEKEEAAKEEATK	268	sp|Q8N163|CCAR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	3-UNIMOD:21	ms_run[1]:scan=7641	40.49903666666666	3	2147.004509	2147.003512	K	E	567	586
PSM	AAASVMCHIEPDDGDDFVR	269	sp|Q5JUR7|TEX30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35,7-UNIMOD:4	ms_run[2]:scan=11667	60.963	2	2119.8939	2119.8939	R	G	107	126
PSM	ADRDESSPYAAMLAAQDVAQR	270	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:35	ms_run[2]:scan=12100	63.218	3	2280.0441	2280.0441	K	C	64	85
PSM	AFGSGIDIKPGTPPIAGR	271	sp|Q9Y520-2|PRC2C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:21	ms_run[2]:scan=15193	80.007	2	1832.9186	1832.9186	K	S	2419	2437
PSM	APEPHVEEDDDDELDSK	272	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7227	38.433	3	1938.7967	1938.7967	K	L	5	22
PSM	AVSPPHLDGPPSPR	273	sp|P29590-2|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=10339	54.147	2	1505.7028	1505.7028	K	S	516	530
PSM	DADDAVYELDGK	274	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11603	60.653	2	1309.5674	1309.5674	R	E	49	61
PSM	DLDEVLQTHSVFVNVSK	275	sp|Q9Y3A5|SBDS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=19326	105.86	2	1928.9844	1928.9844	K	G	46	63
PSM	DLTHSDSESSLHMSDR	276	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=4246	23.558	2	1911.7306	1911.7306	R	Q	515	531
PSM	EAFSLFDKDGDGTITTK	277	sp|P0DP25|CALM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=16076	85.121	2	1843.884	1843.8840	K	E	15	32
PSM	ESEDKPEIEDVGSDEEEEK	278	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:21	ms_run[2]:scan=8488	44.748	2	2271.8792	2271.8792	K	K	251	270
PSM	ESEDKPEIEDVGSDEEEEKK	279	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:21	ms_run[2]:scan=7205	38.322	2	2399.9741	2399.9741	K	D	251	271
PSM	FAGGLHFSGPK	280	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:21	ms_run[2]:scan=13454	70.418	2	1196.538	1196.5380	K	V	5613	5624
PSM	FASDDEHDEHDENGATGPVK	281	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=5018	27.348	2	2248.8546	2248.8546	K	R	364	384
PSM	FHALSSPQSPFPSTPTSR	282	sp|O43166-3|SI1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:21	ms_run[2]:scan=13278	69.446	2	2022.9201	2022.9201	K	R	1539	1557
PSM	GFNCESKPEAEETCFDK	283	sp|P02751-12|FINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:4,14-UNIMOD:4	ms_run[2]:scan=9035	47.6	3	2046.8299	2046.8299	R	Y	84	101
PSM	GWLRDPSASPGDAGEQAIR	284	sp|P18206-2|VINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:21	ms_run[2]:scan=13698	71.74	3	2061.9269	2061.9269	K	Q	282	301
PSM	HGGVCAPAAVATSPPGAIPK	285	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=11303	59.058	3	1936.923	1936.9230	R	E	238	258
PSM	HYFSIVPGNVSSSPR	286	sp|Q9NVH2-4|INT7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:21	ms_run[2]:scan=14830	77.98	2	1725.7876	1725.7876	K	S	277	292
PSM	KDDDDEEIGGPK	287	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2106	12.844	2	1316.5732	1316.5732	K	E	628	640
PSM	KDDEEEDPLDQLISR	288	sp|Q9NYJ1|COA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=17531	94.062	2	1800.8378	1800.8378	K	S	17	32
PSM	KEEEEEEEENR	289	sp|Q8N128|F177A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=710	6.2157	2	1448.5903	1448.5903	K	M	144	155
PSM	KGDEVDGVDEVAK	290	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5210	28.326	2	1359.6518	1359.6518	R	K	209	222
PSM	KQSFDDNDSEELEDK	291	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6557	35.012	2	1797.7541	1797.7541	K	D	105	120
PSM	KRESESESDETPPAAPQLIK	292	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=11019	57.563	2	2371.0346	2371.0346	R	K	448	468
PSM	KTDTVVESSVSGDHSGTLR	293	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:21	ms_run[2]:scan=7355	39.056	3	2053.9317	2053.9317	R	R	33	52
PSM	LKPFFEGMSQSSSQTEIGSLNSK	294	sp|Q6VY07|PACS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=16343	86.713	3	2597.172	2597.1721	K	G	399	422
PSM	LKPGGVGAPSSSSPSPSPSAR	295	sp|Q92797|SYMPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:21	ms_run[2]:scan=5717	30.785	2	2001.9521	2001.9521	K	P	1159	1180
PSM	LPSVEEAEVPKPLPPASK	296	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=13895	72.823	2	1967.0017	1967.0017	R	D	62	80
PSM	MNDFHISDDEEKNPSK	297	sp|Q49MG5-2|MAP9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=7686	40.732	2	2000.7823	2000.7823	K	L	73	89
PSM	MPGMSPANPSLHSPVPDASHSPR	298	sp|O60244|MED14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:35,4-UNIMOD:35,13-UNIMOD:21,21-UNIMOD:21	ms_run[2]:scan=8093	42.803	3	2560.0277	2560.0277	R	A	1124	1147
PSM	NDMAVPTPPPPPVPPTK	299	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=11521	60.237	2	1849.8685	1849.8685	K	Q	486	503
PSM	PGLRPAPNSVDVDDFINTR	300	sp|P55287|CAD11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:21	ms_run[2]:scan=17783	95.624	3	2162.0157	2162.0157	R	I	706	725
PSM	PGMYPDPHSPFAVSPIPGR	301	sp|P41162|ETV3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=16002	84.696	2	2116.9442	2116.9442	R	G	237	256
PSM	RAEDGSVIDYELIDQDAR	302	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=15770	83.357	3	2063.976	2063.9760	R	D	179	197
PSM	RGPDAVAAPPGGTER	303	sp|P08913|ADA2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:21	ms_run[2]:scan=4151	23.064	2	1529.6988	1529.6988	R	R	234	249
PSM	RPLPVESPDTQR	304	sp|P57682|KLF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=6203	33.192	2	1473.6977	1473.6977	K	K	244	256
PSM	RSSSPAELDLKDDLQQTQGK	305	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=13005	67.964	3	2295.0744	2295.0744	R	C	818	838
PSM	SAKSEESLTSLHAVDGDSK	306	sp|A7KAX9-2|RHG32_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=9425	49.525	2	2039.9049	2039.9049	R	L	354	373
PSM	SAPTAPTPPPPPPPATPR	307	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=8766	46.244	2	1827.892	1827.8921	R	K	799	817
PSM	SAPTAPTPPPPPPPATPR	308	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=8964	47.254	2	1827.892	1827.8921	R	K	799	817
PSM	SHMSGSPGPGGSNTAPSTPVIGGSDKPGMEEK	309	sp|A0FGR8-5|ESYT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:35,14-UNIMOD:21,18-UNIMOD:21,29-UNIMOD:35	ms_run[2]:scan=7189	38.24	3	3244.3091	3244.3091	K	A	95	127
PSM	SKGHYEVTGSDDETGK	310	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=2433	14.497	2	1788.7204	1788.7204	K	L	5832	5848
PSM	SRDESASETSTPSEHSAAPSPQVEVR	311	sp|Q92614-3|MY18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:21	ms_run[2]:scan=7273	38.648	3	2820.2199	2820.2199	R	T	145	171
PSM	STAQQELDGKPASPTPVIVASHTANK	312	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:21	ms_run[2]:scan=9836	51.592	3	2726.3276	2726.3276	R	E	818	844
PSM	TDKVDFDSAEDTR	313	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=6641	35.451	2	1497.6583	1497.6583	K	L	661	674
PSM	THTDSSEKELEPEAAEEALENGPK	314	sp|Q9H3P7|GCP60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=14764	77.623	3	2690.1596	2690.1596	K	E	340	364
PSM	VIEHIMEDLDTNADK	315	sp|P06702|S10A9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:35	ms_run[2]:scan=8834	46.572	2	1757.8142	1757.8142	K	Q	58	73
PSM	VPPAPVPCPPPSPGPSAVPSSPK	316	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=12648	66.068	2	2298.112	2298.1120	K	S	366	389
PSM	VSISEGDDKIEYR	317	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9558	50.203	2	1509.7311	1509.7311	R	A	123	136
PSM	YAPISGGDHAEVDVPK	318	sp|P24821-6|TENA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=9706	50.937	2	1653.7999	1653.7999	K	S	927	943
PSM	CCAAADPHECYAK	319	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=6367	34.056556666666665	2	1534.5634	1534.5634	K	V	384	397
PSM	APEPHVEEDDDDELDSK	320	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7827	41.45075833333333	2	1939.799186	1938.796675	K	L	5	22
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	321	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=5482	29.64065833333333	3	3007.3298	3007.3290	K	S	145	174
PSM	QVSASELHTSGILGPETLR	322	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=19283	105.58335833333332	2	2056.9821	2056.9825	R	D	2716	2735
PSM	SETAPAETATPAPVEKSPAK	323	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7589	40.25702166666667	2	2102.9770	2102.9768	M	K	2	22
PSM	QRSPSPAPAPAPAAAAGPPTR	324	sp|Q9H7N4|SFR19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=7727	40.94688	2	2029.9736	2029.9730	R	K	496	517
PSM	AAPAQVRPPSPGNIR	325	sp|Q14244-5|MAP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=9364	49.201	2	1609.809	1609.8090	K	P	210	225
PSM	AFDQGADAIYDHINEGK	326	sp|Q9UDW1|QCR9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14777	77.696	2	1862.8435	1862.8435	R	L	35	52
PSM	AHFNAMFQPSSPTR	327	sp|Q8WUA4|TF3C2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=9039	47.62	2	1685.7021	1685.7021	R	R	883	897
PSM	AHFNAMFQPSSPTR	328	sp|Q8WUA4|TF3C2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=9256	48.655	2	1685.7021	1685.7021	R	R	883	897
PSM	AHSPGLLGPALGPPYPSGR	329	sp|Q6UXY1-2|BI2L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=16074	85.109	2	1922.9404	1922.9404	R	L	229	248
PSM	AKSPISSGSGGSHMSGTSSSSGMK	330	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,14-UNIMOD:35,23-UNIMOD:35	ms_run[2]:scan=731	6.3141	2	2322.9458	2322.9458	K	S	1221	1245
PSM	APEPHVEEDDDDELDSK	331	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6434	34.39	3	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	332	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6822	36.407	3	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	333	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7015	37.423	3	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	334	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7433	39.44	3	1938.7967	1938.7967	K	L	5	22
PSM	ATAGDTHLGGEDFDNR	335	sp|P48741|HSP77_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7125	37.914	2	1674.7234	1674.7234	K	L	223	239
PSM	AVSILPLLGHGVPR	336	sp|Q9Y2W2|WBP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=20493	113.98	2	1507.8276	1507.8276	R	L	179	193
PSM	DADDAVYELNGK	337	sp|Q13247|SRSF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10288	53.893	2	1308.5834	1308.5834	R	E	47	59
PSM	DKKSPLIESTANMDNNQSQK	338	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=3965	22.084	3	2343.0414	2343.0414	R	T	209	229
PSM	DKSPVREPIDNLTPEER	339	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=11155	58.276	3	2073.9732	2073.9732	K	D	134	151
PSM	DKSPVREPIDNLTPEER	340	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=11974	62.544	3	2073.9732	2073.9732	K	D	134	151
PSM	DKVVEDDEDDFPTTR	341	sp|Q9Y5P4-2|C43BP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9005	47.454	2	1779.7799	1779.7799	R	S	197	212
PSM	DLTHSDSESSLHMSDR	342	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21	ms_run[2]:scan=7606	40.341	2	1895.7357	1895.7357	R	Q	515	531
PSM	DPDASKPEDWDER	343	sp|P27797|CALR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7068	37.635	2	1558.6536	1558.6536	K	A	210	223
PSM	DSDDSHGSVLR	344	sp|Q8IW45-3|NNRD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2171	13.197	2	1186.5214	1186.5214	M	L	2	13
PSM	EDFDVDHFVSDCR	345	sp|Q14746-2|COG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:4	ms_run[2]:scan=14968	78.729	2	1639.6573	1639.6573	K	K	25	38
PSM	EDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIK	346	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	22-UNIMOD:4,26-UNIMOD:21	ms_run[2]:scan=15290	80.542	3	3597.7062	3597.7062	K	G	607	642
PSM	EEIQETQTPTHSR	347	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=2443	14.546	2	1554.7274	1554.7274	K	K	272	285
PSM	FEEAAFTCEYKYDGQR	348	sp|P18858-3|DNLI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:4	ms_run[2]:scan=13020	68.041	2	2012.8574	2012.8574	R	A	527	543
PSM	FEEEIKAEQEER	349	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=6479	34.598	2	1535.7104	1535.7104	R	K	207	219
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	350	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=13269	69.404	3	2762.2735	2762.2735	K	Q	609	638
PSM	GKLEAIITPPPAK	351	sp|O75367-2|H2AY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:21	ms_run[2]:scan=10986	57.404	2	1413.7633	1413.7633	K	K	122	135
PSM	GKPIFPVYPLVGSSSPTR	352	sp|A6NEL2|SWAHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:21	ms_run[2]:scan=19051	104.02	2	1981.0074	1981.0074	R	K	728	746
PSM	GLMAGGRPEGQYSEDEDTDTDEYK	353	sp|Q9NPQ8-2|RIC8A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:35	ms_run[2]:scan=8426	44.461	3	2678.0926	2678.0926	R	E	418	442
PSM	GPRTPPGPPPPDDDEDDPVPLPVSGDK	354	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=14265	74.873	3	2842.2698	2842.2698	R	E	181	208
PSM	HTPPTIGGSLPYR	355	sp|Q9NYB9-2|ABI2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:21	ms_run[2]:scan=11772	61.493	3	1474.697	1474.6970	R	R	293	306
PSM	IDNDDEPHTSK	356	sp|O43314|VIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=875	6.9859	2	1269.5473	1269.5473	K	R	927	938
PSM	IEDVGSDEEDDSGK	357	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=4053	22.534	2	1573.5669	1573.5669	K	D	250	264
PSM	KESKEEETSIDVAGK	358	sp|P53985|MOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=4526	24.939	3	1728.7819	1728.7819	K	P	459	474
PSM	KLEELTSNVSDQETSSEEEEAKDEK	359	sp|Q9BV36-3|MELPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:21	ms_run[2]:scan=9176	48.269	3	2933.255	2933.2550	R	A	320	345
PSM	KMEDSVGCLETAEEVK	360	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=9724	51.027	2	1839.823	1839.8230	K	R	1372	1388
PSM	KTDTVVESSVSGDHSGTLR	361	sp|Q9NXL2-1|ARH38_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21	ms_run[2]:scan=7145	38.004	3	2053.9317	2053.9317	R	R	33	52
PSM	KVSSAEGAAKEEPK	362	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=1658	10.571	2	1509.7076	1509.7076	R	R	5	19
PSM	KVYEDSGIPLPAESPK	363	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:21	ms_run[2]:scan=12781	66.759	2	1808.8597	1808.8597	R	K	49	65
PSM	LDSSEMDHSENEDYTMSSPLPGKK	364	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:35,9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=7834	41.489	3	2808.1143	2808.1143	R	S	1174	1198
PSM	LDTDDLDEIEK	365	sp|Q9UMR2-3|DD19B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12720	66.432	2	1304.5984	1304.5984	R	I	357	368
PSM	LKPGGVGAPSSSSPSPSPSAR	366	sp|Q92797|SYMPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:21	ms_run[2]:scan=5746	30.922	3	2001.9521	2001.9521	K	P	1159	1180
PSM	LKSEDGVEGDLGETQSR	367	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=8383	44.245	2	1898.8259	1898.8259	R	T	133	150
PSM	NIEEHASADVEK	368	sp|P61006-2|RAB8A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3766	21.053	2	1340.6208	1340.6208	R	M	105	117
PSM	PDERPSSPIPLLPPPK	369	sp|O15047|SET1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21	ms_run[2]:scan=14214	74.593	2	1818.9281	1818.9281	R	K	1147	1163
PSM	PKTPPTAPEPAAAVQAPLPR	370	sp|E7EW31|PROB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=12583	65.728	3	2088.0769	2088.0769	K	E	818	838
PSM	PQLPGSHPASSPAQGNR	371	sp|P43405-2|KSYK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=4479	24.727	2	1779.8054	1779.8054	R	Q	274	291
PSM	REEGPPPPSPDGASSDAEPEPPSGR	372	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:21	ms_run[2]:scan=7403	39.289	3	2594.0922	2594.0922	R	T	14	39
PSM	RGSFPLAAAGPSQSPAPPLPEEDR	373	sp|Q8IY26|PLPP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=15935	84.321	3	2526.1904	2526.1904	R	M	68	92
PSM	RLAAAEETAVSPR	374	sp|Q9BUH6|PAXX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=5562	30.047	2	1449.6977	1449.6977	R	K	138	151
PSM	RPAAAAAAGSASPR	375	sp|Q96S55-2|WRIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:21	ms_run[2]:scan=1348	9.0854	2	1332.63	1332.6300	K	S	142	156
PSM	RSSPPPPPSGSSSR	376	sp|Q5VUA4|ZN318_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=1090	7.9176	2	1474.6566	1474.6566	R	T	38	52
PSM	RYWEEETVPTTAGASPGPPR	377	sp|O15213|WDR46_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:21	ms_run[2]:scan=12530	65.473	3	2280.0212	2280.0212	R	N	27	47
PSM	SDGSLEDGDDVHR	378	sp|Q9NRX5|SERC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=3357	19.017	2	1400.5804	1400.5804	R	A	361	374
PSM	SEQTSSTHIESILSEHEESPK	379	sp|Q96RV3-2|PCX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	19-UNIMOD:21	ms_run[2]:scan=12642	66.039	3	2434.0537	2434.0537	K	A	402	423
PSM	SFHFDPLSSGSR	380	sp|Q9C0B5-2|ZDHC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=15933	84.313	2	1415.5871	1415.5871	K	S	362	374
PSM	SNSVEKPVSSILSR	381	sp|Q9UI08-4|EVL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=12901	67.404	3	1581.7764	1581.7764	R	T	329	343
PSM	SPEGPREEEAAGGEEESPDSSPHGEASR	382	sp|Q96NY7-2|CLIC6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=4852	26.541	3	2959.1741	2959.1741	R	G	377	405
PSM	SPPGAAASAAAKPPPLSAK	383	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=8799	46.398	2	1767.892	1767.8921	R	D	71	90
PSM	SSSPAPADIAQTVQEDLR	384	sp|Q13283|G3BP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=19761	108.84	2	1963.8888	1963.8888	K	T	230	248
PSM	STAGDTHLGGEDFDNR	385	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=7038	37.517	2	1690.7183	1690.7183	K	M	221	237
PSM	STAQQELDGKPASPTPVIVASHTANK	386	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:21	ms_run[2]:scan=9737	51.087	2	2726.3276	2726.3276	R	E	818	844
PSM	SVAPASPPPPDGPLAHR	387	sp|Q2M2I3|FA83E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=8911	46.967	2	1744.8298	1744.8298	R	L	319	336
PSM	SVAPASPPPPDGPLAHR	388	sp|Q2M2I3|FA83E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=9115	47.991	2	1744.8298	1744.8298	R	L	319	336
PSM	VDIDTPDIDIHGPEGK	389	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14277	74.941	2	1719.8315	1719.8315	K	L	4096	4112
PSM	VKETQEDKLEGGAAK	390	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=2907	16.909	3	1681.7924	1681.7924	K	R	177	192
PSM	VPPAPVPCPPPSPGPSAVPSSPK	391	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=12229	63.953	2	2298.112	2298.1120	K	S	366	389
PSM	YHGHSMSDPGVSYR	392	sp|P08559-3|ODPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21,6-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=4252	23.587	2	1767.6114	1767.6114	R	T	258	272
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	393	sp|Q9UKM9|RALY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	14-UNIMOD:21	ms_run[1]:scan=14039	73.66753833333333	3	3608.443898	3606.439113	R	-	275	307
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	394	sp|Q9UKM9|RALY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	14-UNIMOD:21	ms_run[1]:scan=13691	71.71137833333333	3	3608.442820	3606.439113	R	-	275	307
PSM	DGDDVIIIGVFK	395	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=20657	115.12608666666667	2	1289.686812	1289.686718	K	G	302	314
PSM	VNSNGKESPGSSEFFQEAVSHGK	396	sp|Q8N108|MIER1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	8-UNIMOD:21	ms_run[1]:scan=13668	71.59011333333333	3	2502.069740	2501.086012	R	F	481	504
PSM	KTDPLSLEGYVSSAPLTKPPEK	397	sp|O15068|MCF2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	2-UNIMOD:21	ms_run[1]:scan=17638	94.72836333333333	3	2438.228167	2436.218924	R	G	991	1013
PSM	KAEQGSEEEGEGEEEEEEGGESK	398	sp|Q8NE71|ABCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	6-UNIMOD:21	ms_run[1]:scan=3082	17.775	3	2561.951271	2560.945006	K	A	223	246
PSM	TAHNSEADLEESFNEHELEPSSPK	399	sp|Q8IWS0|PHF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	22-UNIMOD:21	ms_run[1]:scan=14185	74.44589	3	2777.133015	2776.150129	K	S	134	158
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	400	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	16-UNIMOD:21	ms_run[1]:scan=5603	30.244421666666668	3	3023.349098	3024.356099	K	S	145	174
PSM	AASPPRPLLSNASATPVGR	401	sp|Q9NQW6-2|ANLN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=11888	62.064	3	1940.9833	1940.9833	K	R	180	199
PSM	AHFNAMFQPSSPTR	402	sp|Q8WUA4|TF3C2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=9458	49.693	2	1685.7021	1685.7021	R	R	883	897
PSM	APEPHVEEDDDDELDSK	403	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6631	35.396	3	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	404	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6663	35.558	2	1938.7967	1938.7967	K	L	5	22
PSM	APEPHVEEDDDDELDSK	405	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7833	41.485	3	1938.7967	1938.7967	K	L	5	22
PSM	ATAGDTHLGGEDFDNR	406	sp|P48741|HSP77_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7333	38.954	2	1674.7234	1674.7234	K	L	223	239
PSM	AVSPPHLDGPPSPR	407	sp|P29590-2|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=10139	53.134	2	1505.7028	1505.7028	K	S	516	530
PSM	AVSPPHLDGPPSPR	408	sp|P29590-2|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=10535	55.156	2	1505.7028	1505.7028	K	S	516	530
PSM	DKSPVREPIDNLTPEER	409	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=10774	56.357	2	2073.9732	2073.9732	K	D	134	151
PSM	DKYEPAAVSEQGDKK	410	sp|P05023-2|AT1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=3651	20.484	3	1743.7717	1743.7717	R	G	8	23
PSM	DLDDALSCKPLADGNFK	411	sp|Q8IYB7-3|DI3L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:4	ms_run[2]:scan=15864	83.942	2	1877.8829	1877.8829	R	V	389	406
PSM	DLEEDHACIPIK	412	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:4	ms_run[2]:scan=10867	56.829	2	1438.6762	1438.6762	K	K	560	572
PSM	DQDDHIDWLLEK	413	sp|P49754-2|VPS41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17168	91.736	2	1525.7049	1525.7049	R	K	361	373
PSM	EDKPPLAPSGGTEGPEQPPPPCPSQTGSPPVGLIK	414	sp|Q8WWM7-6|ATX2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	22-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=15466	81.544	3	3597.7062	3597.7062	K	G	607	642
PSM	ELAQIAGRPTEDEDEK	415	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6940	37.032	2	1799.8537	1799.8537	K	E	113	129
PSM	FGGEHVPNSPFQVTALAGDQPSVQPPLR	416	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=19502	107.09	3	3024.4495	3024.4495	R	S	1718	1746
PSM	FSHVDSPNSECKGEDATDDQFESPK	417	sp|Q5T5P2-3|SKT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=9083	47.825	3	2905.1386	2905.1386	K	K	1229	1254
PSM	GFPEPSQATAPPPTVPTRPSPGAIQSR	418	sp|Q8NFA2-4|NOXO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	20-UNIMOD:21	ms_run[2]:scan=14533	76.342	3	2822.3753	2822.3753	R	C	311	338
PSM	GPRTPPGPPPPDDDEDDPVPLPVSGDK	419	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=14653	77.004	3	2842.2698	2842.2698	R	E	181	208
PSM	GVVDSDDLPLNVSR	420	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14910	78.412	2	1484.7471	1484.7471	K	E	435	449
PSM	HGGVCAPAAVATSPPGAIPK	421	sp|Q9Y6A5|TACC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=11490	60.072	3	1936.923	1936.9230	R	E	238	258
PSM	HIKEEPLSEEEPCTSTAIASPEK	422	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21,13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=11069	57.823	3	2741.1544	2741.1544	K	K	495	518
PSM	HISLTLPATFR	423	sp|Q9H7P6|MB12B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=18064	97.456	2	1334.6748	1334.6748	R	G	222	233
PSM	HYGITSPISLAAPK	424	sp|P51003-2|PAPOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=15235	80.239	2	1533.7592	1533.7592	K	E	19	33
PSM	IPMTPTSSFVSPPPPTASPHSNR	425	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=13200	69.016	3	2500.1458	2500.1458	K	T	373	396
PSM	KADSEEERDDVSTLGSMLPAK	426	sp|P78364|PHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=11989	62.623	3	2373.0407	2373.0407	R	A	642	663
PSM	KAEEELGELEAK	427	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8105	42.861	2	1344.6773	1344.6773	R	L	684	696
PSM	KATDGVTLTGINQTGDQSLPSKPSSVSSYEK	428	sp|Q9UNF0-2|PACN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	28-UNIMOD:21	ms_run[2]:scan=14158	74.305	3	3274.5606	3274.5606	K	T	319	350
PSM	KAVQGGGATPVVGAVQGPVPGMPPMTQAPR	429	sp|P09012|SNRPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21,22-UNIMOD:35,25-UNIMOD:35	ms_run[2]:scan=12006	62.719	3	2966.4507	2966.4507	K	I	123	153
PSM	KEDMELDDCSK	430	sp|Q93084-4|AT2A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35,9-UNIMOD:4	ms_run[2]:scan=1490	9.735	2	1384.5486	1384.5486	R	F	573	584
PSM	KESKEETPEVTK	431	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=1424	9.4398	2	1483.6807	1483.6807	R	V	559	571
PSM	KEVEGDDVPESIMLEMK	432	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=11602	60.649	3	1979.9068	1979.9068	R	A	577	594
PSM	KGAGDGSDEEVDGK	433	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=911	7.1362	2	1362.5899	1362.5899	R	A	1937	1951
PSM	KGAGDGSDEEVDGKADGAEAK	434	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=1338	9.0457	3	2084.8536	2084.8536	R	P	1937	1958
PSM	KPNIFYSGPASPAR	435	sp|Q6PL18|ATAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=10705	56.008	3	1583.7497	1583.7497	R	P	317	331
PSM	KTSDANETEDHLESLICK	436	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14317	75.148	3	2168.9297	2168.9297	R	V	20	38
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	437	sp|Q04323-2|UBXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	22-UNIMOD:21	ms_run[2]:scan=11565	60.451	3	3134.4962	3134.4962	K	R	178	209
PSM	LGEMWNNTAADDKQPYEK	438	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:35	ms_run[2]:scan=9368	49.215	3	2124.9422	2124.9422	K	K	129	147
PSM	LGGLRPESPESLTSVSR	439	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=13646	71.483	3	1863.9092	1863.9092	R	T	11	28
PSM	LGSTSSNSSCSSTECPGEAIPHPPGLPK	440	sp|Q9H3Y8-2|PPDPF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=14865	78.165	3	2933.2573	2933.2573	R	A	21	49
PSM	LIQSHPESAEDLQEK	441	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6343	33.921	2	1722.8424	1722.8424	R	C	1279	1294
PSM	LRSPPEALVQGR	442	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=9011	47.485	2	1401.713	1401.7130	R	Y	130	142
PSM	LRSPPEALVQGR	443	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=9223	48.5	2	1401.713	1401.7130	R	Y	130	142
PSM	LTSAHQENTSLSEEEERK	444	sp|Q9BRP0-2|OVOL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=4716	25.852	3	2166.943	2166.9430	K	-	126	144
PSM	NSSTETDQQPHSPDSSSSVHSIR	445	sp|Q92613|JADE3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=4251	23.583	2	2562.062	2562.0620	R	N	555	578
PSM	PDERPSSPIPLLPPPK	446	sp|O15047|SET1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=14171	74.382	3	1818.9281	1818.9281	R	K	1147	1163
PSM	PFSAPKPQTSPSPK	447	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=6365	34.049	2	1547.7385	1547.7385	K	R	298	312
PSM	PGAGQPGEFHTTPPGTPR	448	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=8827	46.535	2	1882.8363	1882.8363	R	H	2218	2236
PSM	QAQQERDELADEIANSSGK	449	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11041	57.67	3	2087.972	2087.9720	R	G	1698	1717
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	450	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:21	ms_run[2]:scan=4995	27.233	3	3024.3561	3024.3561	K	S	73	102
PSM	RAEDGSVIDYELIDQDAR	451	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=15384	81.09	3	2063.976	2063.9760	R	D	179	197
PSM	RDSSESQLASTESDKPTTGR	452	sp|Q96B23-2|CR025_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=4933	26.942	3	2230.9703	2230.9703	R	V	64	84
PSM	REEEEEEEASEK	453	sp|O60231|DHX16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=883	7.0219	2	1492.6165	1492.6165	K	G	132	144
PSM	REEGPPPPSPDGASSDAEPEPPSGR	454	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:21	ms_run[2]:scan=7192	38.258	3	2594.0922	2594.0922	R	T	14	39
PSM	REFITGDVEPTDAESEWHSENEEEEK	455	sp|Q99733|NP1L4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	19-UNIMOD:21	ms_run[2]:scan=14379	75.47	3	3171.283	3171.2830	R	L	107	133
PSM	RFSLSPSLGPQASR	456	sp|Q9NYF3|FA53C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=13689	71.7	2	1581.7665	1581.7665	R	F	230	244
PSM	RPLLTAPDHCSDDA	457	sp|Q9GZR2-2|REXO4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=8482	44.724	2	1646.676	1646.6760	R	-	237	251
PSM	RVIENADGSEEETDTR	458	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=3623	20.359	2	1899.7847	1899.7847	R	D	1946	1962
PSM	RVSSDEEHTVDSCISDMK	459	sp|Q70CQ2-3|UBP34_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=11260	58.82	3	2173.8657	2173.8657	R	T	3122	3140
PSM	SGDETPGSEVPGDK	460	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=4615	25.37	2	1453.561	1453.5610	R	A	161	175
PSM	SLLNHTPPSGR	461	sp|Q9UKI8|TLK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=6669	35.594	2	1257.5867	1257.5867	R	P	33	44
PSM	SPQPARPGSAAVPGAAFAPIPR	462	sp|Q8N3V7-2|SYNPO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=15335	80.805	3	2194.1048	2194.1048	R	S	804	826
PSM	TADGRVSPAGGTLDDKPK	463	sp|Q8WY36-2|BBX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=4457	24.627	3	1863.8728	1863.8728	R	E	808	826
PSM	TANPSKTIDLGAAAHYTGDK	464	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=11016	57.552	3	2109.9732	2109.9732	R	A	260	280
PSM	TKPTQAAGPSSPQKPPTPEETK	465	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=4196	23.299	3	2436.0975	2436.0975	K	A	437	459
PSM	TPEEMKHSQSMIEDAQLPLEQK	466	sp|Q13576-3|IQGA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35,8-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=11425	59.715	3	2680.1761	2680.1761	R	K	845	867
PSM	TPSIQPSLLPHAAPFAK	467	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=17828	95.902	3	1853.9441	1853.9441	R	S	1010	1027
PSM	TQATGLTKPTLPPSPLMAAR	468	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13925	73.005	3	2146.0857	2146.0857	R	R	411	431
PSM	VAELSSDDFHLDR	469	sp|Q92896|GSLG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=13270	69.408	2	1502.7001	1502.7001	R	H	298	311
PSM	VAKPVVEMDGDEMTR	470	sp|P48735|IDHP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=3259	18.572	2	1707.7808	1707.7808	K	I	46	61
PSM	VAVEEVDEEGKFVR	471	sp|P02545-2|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=10981	57.381	2	1604.8046	1604.8046	R	L	440	454
PSM	VGGSSVDLHR	472	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=4669	25.628	2	1105.4917	1105.4917	R	F	164	174
PSM	VHSPSGAVEECHVSELEPDK	473	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=9779	51.286	3	2284.9671	2284.9671	K	Y	2143	2163
PSM	VHSPSGAVEECHVSELEPDK	474	sp|O75369-7|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=9850	51.666	2	2284.9671	2284.9671	K	Y	2143	2163
PSM	VPPAPVPCPPPSPGPSAVPSSPK	475	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=12742	66.553	3	2298.112	2298.1120	K	S	366	389
PSM	WQRPSSPPPFLPAASEEAEPAEGLR	476	sp|Q4KMQ1-2|TPRN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=18364	99.339	3	2798.3065	2798.3065	R	V	107	132
PSM	YSKEEEMDDMDR	477	sp|Q9HD45|TM9S3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=867	6.9495	2	1578.5814	1578.5814	R	D	255	267
PSM	CRSPGMLEPLGSSR	478	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21,6-UNIMOD:35	ms_run[1]:scan=11939	62.34406	2	1624.6727	1624.6734	R	T	2130	2144
PSM	KGNAEGSSDEEGKLVIDEPAK	479	sp|P51858|HDGF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	8-UNIMOD:21	ms_run[1]:scan=8771	46.267203333333335	3	2252.014174	2252.020953	K	E	126	147
PSM	QSPLTYEDHGAPFAGHLPR	480	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=16704	88.85955333333334	2	2154.9517	2154.9519	R	G	1538	1557
PSM	QRDEDDEAYGKPVK	481	sp|Q53GD3|CTL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=3682	20.649136666666667	3	1631.7412	1631.7422	K	Y	5	19
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	482	sp|Q96TA1|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	11-UNIMOD:21	ms_run[1]:scan=18255	98.682875	3	3096.562841	3095.580500	R	A	655	686
PSM	SEDGYHSDGDYGEHDYR	483	sp|P52756|RBM5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:21	ms_run[1]:scan=5318	28.831740000000003	3	2081.710286	2080.707223	R	H	72	89
PSM	QHLGATGGPGAQLGASFLQAR	484	sp|Q9NWW5|CLN6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,16-UNIMOD:21	ms_run[1]:scan=18578	100.75113666666667	3	2098.9944	2098.9944	R	H	8	29
PSM	KTSDANETEDHLESLICK	485	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=15649	82.63724666666667	3	2169.915662	2168.929695	R	V	20	38
PSM	SASTESGFHNHTDTAEGDVIAAAR	486	sp|Q02410|APBA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:21	ms_run[1]:scan=12085	63.143105000000006	3	2524.049190	2523.066340	R	D	78	102
PSM	QEHSGSEEAQKPNLEGSVSHK	487	sp|Q7Z412|PEX26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=5583	30.143021666666666	3	2340.0010	2340.0014	K	F	208	229
PSM	AAVVTSPPPTTAPHK	488	sp|P35611|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:21	ms_run[1]:scan=5112	27.819336666666665	2	1553.761350	1552.765059	R	E	7	22
PSM	RPSVNGEPGSVPPPR	489	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:21	ms_run[1]:scan=6537	34.90989166666667	2	1625.758322	1624.772270	R	A	1255	1270
PSM	PTIPTEKSTISPEKPTTPTEK	490	sp|Q9Y493|ZAN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	2-UNIMOD:21,8-UNIMOD:21,9-UNIMOD:21,11-UNIMOD:21,19-UNIMOD:21	ms_run[1]:scan=8218	43.407565000000005	3	2683.041383	2681.036964	K	P	724	745
PSM	AGSIDGTDEDPHDR	491	sp|Q16560|U1SBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2223	13.442	2	1483.6175	1483.6175	K	A	16	30
PSM	ALASEKSPTADAKPAPK	492	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=2714	15.905	2	1760.871	1760.8710	K	R	266	283
PSM	ALSEEKDEEDGENAHPYR	493	sp|Q9NSI8|SAMN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=5965	31.991	2	2167.8695	2167.8695	K	N	88	106
PSM	APEPHVEEDDDDELDSK	494	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=7634	40.469	3	1938.7967	1938.7967	K	L	5	22
PSM	ATASGKVSPDHLDPER	495	sp|Q68DK2-5|ZFY26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=6006	32.214	2	1758.7938	1758.7938	R	A	290	306
PSM	ATFGCHDGYSLDGPEEIECTK	496	sp|P02749|APOH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=14101	73.988	3	2384.9889	2384.9889	K	L	230	251
PSM	DEDDEAYGKPVK	497	sp|Q53GD3-4|CTL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2865	16.695	2	1364.6096	1364.6096	R	Y	7	19
PSM	DKSPVREPIDNLTPEER	498	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=9174	48.262	3	2073.9732	2073.9732	K	D	134	151
PSM	DKSPVREPIDNLTPEER	499	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=10221	53.565	3	2073.9732	2073.9732	K	D	134	151
PSM	DKSPVREPIDNLTPEER	500	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=13376	69.996	3	2073.9732	2073.9732	K	D	134	151
PSM	DLDDALDKLSDSLGQR	501	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=20363	113.02	3	1759.8588	1759.8588	K	Q	448	464
PSM	DPDAQPGGELMLGGTDSK	502	sp|P07339|CATD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:35	ms_run[2]:scan=10447	54.658	3	1802.7993	1802.7993	R	Y	236	254
PSM	DSPSAGGPVGQLEPIPIPAPASPGTRPTLK	503	sp|Q96PE2|ARHGH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	22-UNIMOD:21	ms_run[2]:scan=18860	102.69	3	2986.5165	2986.5165	R	D	506	536
PSM	EELDTLLNHPDIK	504	sp|Q9H0F7|ARL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15434	81.353	2	1535.7831	1535.7831	K	H	107	120
PSM	EELVYELNPLDHR	505	sp|P0C0L4-2|CO4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17239	92.17	2	1625.8049	1625.8049	R	G	942	955
PSM	EKYDTDFYILDK	506	sp|P14868-2|SYDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16011	84.751	2	1548.7348	1548.7348	K	Y	282	294
PSM	EMKEELEEEEK	507	sp|Q9NX52-3|RHBL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35	ms_run[2]:scan=2420	14.442	2	1437.6181	1437.6181	R	M	19	30
PSM	FASDDEHDEHDENGATGPVK	508	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=4800	26.286	2	2248.8546	2248.8546	K	R	364	384
PSM	FNGTHIPGSPFK	509	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=12647	66.065	2	1380.6228	1380.6228	K	I	2398	2410
PSM	FNHDGEEEEEDDDYGSR	510	sp|Q6PJT7-5|ZC3HE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4818	26.377	3	2041.741	2041.7410	K	T	308	325
PSM	FNLTYVSHDGDDK	511	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10882	56.901	2	1509.6736	1509.6736	R	K	571	584
PSM	FSVIRPQTPPPQTPSSCLTPVSPGTSDGR	512	sp|Q8IY92-2|SLX4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=15299	80.588	3	3145.4904	3145.4904	K	R	996	1025
PSM	GAKLTPEEEEILNKK	513	sp|P62241|RS8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=11113	58.058	3	1777.8863	1777.8863	K	R	126	141
PSM	GPKPEPPGSGSPAPPR	514	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=4030	22.415	2	1606.7505	1606.7505	R	R	652	668
PSM	HGSGPNIILTGDSSPGFSK	515	sp|Q53ET0|CRTC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=14164	74.339	2	1949.8884	1949.8884	R	E	611	630
PSM	HPLSPGFGAAGTPR	516	sp|Q96QH2|PRAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=9910	51.972	2	1443.666	1443.6660	R	W	404	418
PSM	HTPPTIGGSLPYR	517	sp|Q9NYB9-2|ABI2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=12340	64.526	3	1474.697	1474.6970	R	R	293	306
PSM	IECDDKGDGSCDVR	518	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4,11-UNIMOD:4	ms_run[2]:scan=1758	11.086	2	1624.6457	1624.6457	K	Y	621	635
PSM	IPDPEAVKPDDWDEDAPAK	519	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13982	73.342	2	2106.9746	2106.9746	K	I	293	312
PSM	KAEGEPQEESPLKSK	520	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=2685	15.766	2	1735.803	1735.8030	K	S	166	181
PSM	KDDDDEEIGGPK	521	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2386	14.279	2	1316.5732	1316.5732	K	E	628	640
PSM	KDDMDEEISIYDGR	522	sp|O14967|CLGN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35	ms_run[2]:scan=9869	51.758	2	1700.7199	1700.7199	K	W	81	95
PSM	KDDPVTNLNNAFEVAEK	523	sp|O43707|ACTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16127	85.429	3	1902.9323	1902.9323	R	Y	217	234
PSM	KPAPLPSPGLNSAAK	524	sp|Q9C0K0-2|BC11B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=9400	49.38	2	1526.7858	1526.7858	R	R	601	616
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	525	sp|Q8IYB3-2|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=14515	76.239	3	2742.2819	2742.2819	K	K	761	786
PSM	KQQMAEEMVEAAGEDER	526	sp|Q15393|SF3B3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:35,8-UNIMOD:35	ms_run[2]:scan=5178	28.156	3	1981.8357	1981.8357	R	E	816	833
PSM	KSPPKEYIDEEGVR	527	sp|Q9H0E3|SP130_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=7199	38.294	3	1725.7975	1725.7975	R	Y	874	888
PSM	KSPSGPVKSPPLSPVGTTPVK	528	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=10394	54.405	3	2219.1004	2219.1004	R	L	177	198
PSM	KTSDANETEDHLESLICK	529	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=15350	80.888	3	2168.9297	2168.9297	R	V	20	38
PSM	KVEEEEDESALK	530	sp|Q14566|MCM6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3507	19.768	2	1404.662	1404.6620	R	R	733	745
PSM	KVEEEQEADEEDVSEEEAESK	531	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=6565	35.057	3	2516.9803	2516.9803	K	E	234	255
PSM	KVEEVLEEEEEEYVVEK	532	sp|P83916|CBX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15872	83.993	3	2108.0049	2108.0049	K	V	9	26
PSM	LFGHSSTSALSAILR	533	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=19983	110.4	2	1638.8131	1638.8131	R	S	3096	3111
PSM	LPEHPEGGEPEDDEAPAK	534	sp|Q9NX58|LYAR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=5322	28.845	2	1915.8436	1915.8436	K	G	289	307
PSM	LPSVEEAEVPKPLPPASK	535	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=14182	74.431	3	1967.0017	1967.0017	R	D	62	80
PSM	LQEELSENDKK	536	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2948	17.087	2	1331.6569	1331.6569	K	I	263	274
PSM	LRSPPEALVQGR	537	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=8815	46.476	2	1401.713	1401.7130	R	Y	130	142
PSM	MCKDEDECEEGK	538	sp|P35555|FBN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35,2-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=634	5.7787	2	1544.5429	1544.5429	R	H	2244	2256
PSM	MTTDVSHKASPEDGQEGLPQPK	539	sp|Q9Y6J0-2|CABIN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=6394	34.19	3	2447.0676	2447.0676	R	K	1607	1629
PSM	NDHDDDEDEEVISK	540	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=4088	22.733	2	1658.6544	1658.6544	R	T	342	356
PSM	NEEDEGHSNSSPR	541	sp|Q14103-3|HNRPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=605	5.553	2	1456.5815	1456.5815	K	H	73	86
PSM	NHLSPQQGGATPQVPSPCCR	542	sp|Q9H4L4|SENP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:21,18-UNIMOD:4,19-UNIMOD:4	ms_run[2]:scan=8597	45.267	3	2269.9722	2269.9722	K	F	166	186
PSM	NIVQSTEHLHEDNGDVEVR	543	sp|Q6PL18|ATAD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=10813	56.534	3	2269.9965	2269.9965	R	R	137	156
PSM	PLGAAPQAEHQGLPVPGSPGGQK	544	sp|Q9Y4F5-3|C170B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	18-UNIMOD:21	ms_run[2]:scan=11620	60.735	2	2272.1001	2272.1001	R	W	568	591
PSM	PTLSATPNHVEHTLSVSSDSGNSTASTK	545	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=11903	62.152	3	2904.3138	2904.3138	R	T	387	415
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	546	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=4633	25.468	3	3024.3561	3024.3561	K	S	73	102
PSM	RAAEDDEDDDVDTK	547	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2320	13.93	2	1592.6438	1592.6438	K	K	89	103
PSM	RAAEDDEDDDVDTK	548	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1107	7.9948	2	1592.6438	1592.6438	K	K	89	103
PSM	RGNLNLSPTSPETMAGPVPTSPVR	549	sp|Q7Z7G8-3|VP13B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:35,21-UNIMOD:21	ms_run[2]:scan=12859	67.199	3	2573.2309	2573.2309	K	S	1243	1267
PSM	RHPDYSVVLLLR	550	sp|P02768-2|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=16317	86.564	3	1466.8358	1466.8358	R	L	169	181
PSM	RIDFTPVSPAPSPTR	551	sp|Q7Z309-4|F122B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:21	ms_run[2]:scan=12417	64.9	2	1719.8345	1719.8345	K	G	127	142
PSM	RIDISPSTLR	552	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=12005	62.717	2	1236.6228	1236.6228	R	K	652	662
PSM	RLEISPDSSPER	553	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=7260	38.586	2	1464.661	1464.6610	R	A	147	159
PSM	RLEISPDSSPER	554	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=7781	41.226	2	1464.661	1464.6610	R	A	147	159
PSM	RPNPCAYTPPSLK	555	sp|Q9UD71-2|PPR1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=9815	51.472	2	1579.7218	1579.7218	K	A	32	45
PSM	RPSVNGEPGSVPPPR	556	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=5844	31.402	3	1624.7723	1624.7723	R	A	1255	1270
PSM	RPTPQDSPIFLPVDDTSFR	557	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=18828	102.48	2	2267.0624	2267.0624	R	W	1405	1424
PSM	RVSSDEEHTVDSCISDMK	558	sp|Q70CQ2-3|UBP34_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,13-UNIMOD:4,17-UNIMOD:35	ms_run[2]:scan=7320	38.89	3	2189.8606	2189.8606	R	T	3122	3140
PSM	SDDSKSSSPELVTHLK	559	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=8300	43.835	3	1808.8193	1808.8193	K	W	44	60
PSM	SKSVKEDSNLTLQEK	560	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=5400	29.225	3	1784.8557	1784.8557	K	K	1441	1456
PSM	SLSVPAASTAKPPPLPR	561	sp|P49815-7|TSC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=13624	71.37	2	1767.9284	1767.9284	K	S	1160	1177
PSM	SPAEAKSPVKEEAK	562	sp|P12036-2|NFH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=1050	7.7402	2	1549.7389	1549.7389	K	S	614	628
PSM	STQIENQHQGAQDTSDLMSPSKR	563	sp|Q9NVR2|INT10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	18-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=4827	26.42	3	2653.1439	2653.1439	R	S	213	236
PSM	TGVAVNKPAEFTVDAK	564	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10396	54.417	2	1645.8675	1645.8675	K	H	685	701
PSM	TIINADKDGDGR	565	sp|P63098|CANB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2645	15.541	2	1273.6262	1273.6262	K	I	136	148
PSM	TKADVTPPPDGSTTHNLEVSPK	566	sp|O75362|ZN217_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=8254	43.591	3	2370.1104	2370.1104	R	E	643	665
PSM	TKPLASVTNANTSSTQAAPVAVTTPTVSSGQATPTSPIKK	567	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	33-UNIMOD:21	ms_run[2]:scan=13064	68.281	3	3989.0358	3989.0358	K	F	287	327
PSM	TKSHDDGNIDLESDSFLK	568	sp|P18583-8|SON_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=14833	77.994	3	2099.9049	2099.9049	K	F	140	158
PSM	TLEHSLPPSPR	569	sp|Q8TE67-2|ES8L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=7838	41.503	2	1312.6177	1312.6177	R	P	197	208
PSM	TPSIQPSLLPHAAPFAK	570	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=17664	94.893	3	1853.9441	1853.9441	R	S	1010	1027
PSM	TQATGLTKPTLPPSPLMAAR	571	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13261	69.366	3	2146.0857	2146.0857	R	R	411	431
PSM	TQATGLTKPTLPPSPLMAAR	572	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13435	70.321	2	2146.0857	2146.0857	R	R	411	431
PSM	TQATGLTKPTLPPSPLMAAR	573	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13444	70.371	3	2146.0857	2146.0857	R	R	411	431
PSM	TQATGLTKPTLPPSPLMAAR	574	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=13678	71.645	3	2146.0857	2146.0857	R	R	411	431
PSM	TTTPPPSQIPDPPFSSPITPHR	575	sp|Q6ZS30-1|NBEL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=16863	89.855	3	2449.1679	2449.1679	R	T	719	741
PSM	VDCDQHSDIAQR	576	sp|Q9BS26|ERP44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:4	ms_run[2]:scan=1780	11.176	2	1442.6208	1442.6208	R	Y	90	102
PSM	VQNHLPASGPTQPPVVSSTNEGSPSPPEPTGK	577	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	17-UNIMOD:21	ms_run[2]:scan=11067	57.811	3	3272.5351	3272.5351	R	G	153	185
PSM	VQNHLPASGPTQPPVVSSTNEGSPSPPEPTGK	578	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	25-UNIMOD:21	ms_run[2]:scan=11305	59.064	3	3272.5351	3272.5351	R	G	153	185
PSM	VQNHLPASGPTQPPVVSSTNEGSPSPPEPTGK	579	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	25-UNIMOD:21	ms_run[2]:scan=11494	60.091	3	3272.5351	3272.5351	R	G	153	185
PSM	VYACEVTHQGLSSPVTK	580	sp|P01834|IGKC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:4	ms_run[2]:scan=9732	51.065	2	1874.9196	1874.9196	K	S	84	101
PSM	YVLEDGPEEDRK	581	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6629	35.384	2	1448.6783	1448.6783	R	E	89	101
PSM	ALVLIAFAQYLQQCPFEDHVK	582	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	14-UNIMOD:4	ms_run[1]:scan=25328	151.54997166666666	3	2489.277096	2489.277703	K	L	45	66
PSM	QELEEICHDLEAR	583	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,7-UNIMOD:4	ms_run[1]:scan=19455	106.77436166666666	2	1623.7192	1623.7194	K	V	911	924
PSM	ENQEPLRSPEVGDEEALRPLTK	584	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:27,8-UNIMOD:21	ms_run[1]:scan=15336	80.80887833333334	3	2568.2217	2568.2216	K	E	673	695
PSM	KYGGSVGSQPPPVAPEPGPVPSSPSQEPPTK	585	sp|Q04323|UBXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	25-UNIMOD:21	ms_run[1]:scan=11372	59.433175	3	3133.491400	3134.496162	K	R	178	209
PSM	NRPDYVSEEEEDDEDFETAVK	586	sp|P49792|RBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=14167	74.35880833333334	3	2515.051712	2515.051052	K	K	2662	2683
PSM	STAQQELDGKPASPTPVIVASHTANK	587	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	13-UNIMOD:21	ms_run[1]:scan=11803	61.65732	3	2727.328792	2726.327640	R	E	847	873
PSM	HCECSTDEVNSEDMDAYCR	588	sp|P05556|ITB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:4,4-UNIMOD:4,14-UNIMOD:35,18-UNIMOD:4	ms_run[1]:scan=5561	30.043268333333334	3	2393.831306	2392.830061	R	K	499	518
PSM	KYDDDISPSEDK	589	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=4007	22.29549666666667	2	1410.609680	1410.615070	K	D	156	168
PSM	QFIAAQNLGPASGHGTPASSPSSSSLPSPMSPTPR	590	sp|Q8WX93|PALLD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,20-UNIMOD:21,30-UNIMOD:35	ms_run[1]:scan=17659	94.86010833333334	3	3497.5903	3497.5917	K	Q	736	771
PSM	RVSEVEEEKEPVPQPLPSDDTR	591	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:21	ms_run[1]:scan=11333	59.22790833333334	3	2614.191667	2615.211607	R	V	446	468
PSM	KPSVGVPPPASPSYPR	592	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:21	ms_run[1]:scan=10191	53.414101666666674	2	1715.847104	1714.844372	R	A	969	985
PSM	KDDDDEEIGGPK	593	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=2259	13.614386666666666	2	1316.572727	1316.573205	K	E	628	640
PSM	SNSLDKHQQSSTLGNSVVR	594	sp|Q9BZ29|DOCK9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:21	ms_run[1]:scan=6725	35.885575	3	2137.0392	2135.9952	K	C	1273	1292
PSM	QHEAPSNRPLNELLTPQGPSPR	595	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,20-UNIMOD:21	ms_run[1]:scan=15647	82.62580666666666	3	2500.1880	2500.1855	R	T	167	189
PSM	EGPGEEHFEDMASDEDMKPK	596	sp|Q99856|ARI3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	11-UNIMOD:35,13-UNIMOD:21,17-UNIMOD:35	ms_run[1]:scan=5954	31.921591666666668	2	2389.878659	2388.876339	R	W	107	127
PSM	AEEQQLPPPLSPPSPSTPNHR	597	sp|Q6WCQ1-3|MPRIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:21	ms_run[2]:scan=12862	67.215	3	2358.1005	2358.1005	K	R	279	300
PSM	AGDKDDITEPAVCALR	598	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:4	ms_run[2]:scan=11645	60.852	2	1729.8305	1729.8305	R	H	445	461
PSM	AHLTVGQAAAGGSGNLLTER	599	sp|Q99959-2|PKP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=13067	68.296	3	2001.9633	2001.9633	R	S	317	337
PSM	ALDSEVDPDPEGDLGMPAQPHSPTGEAQHR	600	sp|Q6IA17-2|SIGIR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=12286	64.247	3	3248.3718	3248.3718	R	A	343	373
PSM	ALSQDDQDDIHLK	601	sp|O14827|RGRF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7748	41.056	2	1496.7107	1496.7107	R	L	970	983
PSM	AMVSPFHSPPSTPSSPGVR	602	sp|Q6JBY9|CPZIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=10571	55.335	2	2032.9078	2032.9078	K	S	113	132
PSM	APEPHVEEDDDDELDSK	603	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8037	42.516	3	1938.7967	1938.7967	K	L	5	22
PSM	APSGHLAPSPPAFDGELDLQR	604	sp|Q9P2Y4|ZN219_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=17503	93.901	3	2254.042	2254.0420	R	Y	8	29
PSM	APSVANVGSHCDLSLK	605	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=11705	61.16	2	1733.7808	1733.7808	R	I	2142	2158
PSM	AQGEPVAGHESPKIPYEK	606	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=8407	44.36	2	2015.9354	2015.9354	R	Q	522	540
PSM	AVFPSIVGRPR	607	sp|P63267-2|ACTH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=14498	76.143	2	1277.6646	1277.6646	R	H	30	41
PSM	AVTEQGHELSNEER	608	sp|P31946-2|1433B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3378	19.101	2	1597.7332	1597.7332	K	N	28	42
PSM	DAHEENPESILDEHVQR	609	sp|O15169-2|AXIN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=14130	74.141	3	2096.88	2096.8800	R	V	461	478
PSM	DFTVSALHGDMDQK	610	sp|Q14240|IF4A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35	ms_run[2]:scan=10211	53.508	2	1578.6984	1578.6984	R	E	297	311
PSM	DHGETAFAVYDK	611	sp|P24821-6|TENA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9251	48.632	2	1351.6044	1351.6044	R	F	1441	1453
PSM	DKASPEPEKDFSEK	612	sp|Q9ULU4-4|PKCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=4651	25.55	2	1685.7186	1685.7186	K	A	289	303
PSM	DKDEAEQAVSR	613	sp|Q9H939-2|PPIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1848	11.496	2	1246.579	1246.5790	R	S	150	161
PSM	DKSPVREPIDNLTPEER	614	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=10542	55.193	3	2073.9732	2073.9732	K	D	134	151
PSM	DKSPVREPIDNLTPEER	615	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=10955	57.262	3	2073.9732	2073.9732	K	D	134	151
PSM	DMESPTKLDVTLAK	616	sp|P27816-2|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=11684	61.056	2	1642.7525	1642.7525	K	D	277	291
PSM	DNSPPPAFKPEPPK	617	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=8922	47.034	2	1599.7334	1599.7334	R	A	961	975
PSM	DREDYVPYTGEK	618	sp|Q9NYL9|TMOD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7968	42.139	2	1470.6627	1470.6627	K	K	82	94
PSM	EETNGPSNQKPVKSPDNSIK	619	sp|Q9UKL0|RCOR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=3229	18.447	3	2248.0373	2248.0373	K	M	447	467
PSM	EIIDASDKEGMSPAKR	620	sp|Q13523|PRP4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=4028	22.403	2	1841.823	1841.8230	K	T	82	98
PSM	EKEISDDEAEEEK	621	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=2955	17.117	2	1629.6295	1629.6295	R	G	222	235
PSM	ELQEMDKDDESLIK	622	sp|P52566|GDIR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35	ms_run[2]:scan=8229	43.462	2	1707.7873	1707.7873	K	Y	34	48
PSM	ETAVSTEDDSHHK	623	sp|Q14515|SPRL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=807	6.6716	2	1534.5937	1534.5937	K	A	55	68
PSM	FITLLLPGGAQTAVRPGSPSTSTMR	624	sp|Q9Y4A5-2|TRRAP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	18-UNIMOD:21,24-UNIMOD:35	ms_run[2]:scan=19534	107.28	3	2653.3299	2653.3299	R	L	1593	1618
PSM	GDDQLELIKDDEK	625	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10598	55.46	2	1516.7257	1516.7257	R	E	196	209
PSM	GEFKDEEETVTTK	626	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6112	32.732	2	1511.6991	1511.6991	K	H	230	243
PSM	GPSASSVAVMTSSTSDHHLDAAAAR	627	sp|Q9NZQ3-5|SPN90_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=8211	43.372	3	2521.0904	2521.0904	R	Q	108	133
PSM	GSRPPLILQSQSLPCSSPR	628	sp|Q6KC79-3|NIPBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=14434	75.788	2	2159.0558	2159.0558	K	D	290	309
PSM	GSSVIHCDADSK	629	sp|P04003|C4BPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:4	ms_run[2]:scan=1676	10.652	2	1274.5561	1274.5561	R	W	275	287
PSM	HCAPSPDRSPELSSSR	630	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:4,5-UNIMOD:21,9-UNIMOD:21	ms_run[2]:scan=3974	22.125	2	1941.7442	1941.7442	R	D	622	638
PSM	HLGGSGSVVPGSPCLDR	631	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=11597	60.622	2	1773.7869	1773.7869	R	H	1303	1320
PSM	HPLSPGFGAAGTPR	632	sp|Q96QH2|PRAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=9711	50.964	2	1443.666	1443.6660	R	W	404	418
PSM	IEEVLSPEGSPSKSPSKK	633	sp|Q9UEY8-2|ADDG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:21	ms_run[2]:scan=6653	35.512	2	1977.966	1977.9660	K	K	636	654
PSM	IFLAQKPAPLLESPFK	634	sp|O00203-3|AP3B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=19524	107.23	2	1878.0056	1878.0056	K	D	548	564
PSM	IKEEPLDDEYDK	635	sp|Q5VZL5-2|ZMYM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7257	38.571	2	1492.6933	1492.6933	R	A	249	261
PSM	KAEEELGELEAK	636	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8094	42.807	3	1344.6773	1344.6773	R	L	684	696
PSM	KAEGEPQEESPLK	637	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=3536	19.908	2	1520.676	1520.6760	K	S	166	179
PSM	KEDLISAFGTDDQTEICK	638	sp|Q9Y3A5|SBDS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:4	ms_run[2]:scan=15594	82.315	3	2068.9623	2068.9623	K	Q	68	86
PSM	KENPSPLFSIK	639	sp|Q9P1Y6-2|PHRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=13697	71.737	2	1338.6585	1338.6585	R	K	810	821
PSM	KEVEGDDVPESIMLEMK	640	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=11442	59.807	2	1979.9068	1979.9068	R	A	577	594
PSM	KIPPVPSTTSPISTR	641	sp|O15265-3|ATX7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=10533	55.145	3	1659.8597	1659.8597	K	I	417	432
PSM	KLLLDPSSPPTK	642	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=11856	61.906	2	1374.716	1374.7160	R	A	20	32
PSM	KPNIFYSGPASPAR	643	sp|Q6PL18|ATAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=10730	56.143	2	1583.7497	1583.7497	R	P	317	331
PSM	KQDFDEDDILK	644	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11386	59.507	3	1364.646	1364.6460	K	E	50	61
PSM	KTSDANETEDHLESLICK	645	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=15375	81.035	2	2168.9297	2168.9297	R	V	20	38
PSM	KVDVDEYDENK	646	sp|O15511|ARPC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4487	24.77	2	1352.6096	1352.6096	R	F	13	24
PSM	KVEEDLKADEPSSEESDLEIDK	647	sp|P50502|F10A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:21	ms_run[2]:scan=11711	61.187	3	2584.1317	2584.1317	K	E	64	86
PSM	KVMDSDEDDDY	648	sp|O14737|PDCD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35	ms_run[2]:scan=2914	16.935	2	1346.482	1346.4820	R	-	115	126
PSM	LPDVKPSPINLR	649	sp|A2AJT9-3|BCLA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=13499	70.659	2	1427.7538	1427.7538	K	K	396	408
PSM	LTEDLEYHELLDR	650	sp|P22059|OSBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15388	81.105	2	1644.7995	1644.7995	R	A	450	463
PSM	NDTKEDVFVHQTAIK	651	sp|P16989-2|YBOX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=9863	51.731	3	1823.8455	1823.8455	R	K	110	125
PSM	NNRPAFFSPSLK	652	sp|Q6ICG6-3|K0930_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=14336	75.254	2	1456.6864	1456.6864	R	R	263	275
PSM	PAASGPLSHPTPLSAPPSSVPLK	653	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:21	ms_run[2]:scan=15308	80.637	3	2287.1613	2287.1613	K	S	607	630
PSM	PMNRPSAANPCSPVQFSSTPLAGLAPK	654	sp|Q9UIF9-2|BAZ2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,11-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=18142	97.951	3	2890.3507	2890.3507	K	R	1332	1359
PSM	PVVICDKEDTETIK	655	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4	ms_run[2]:scan=8276	43.709	2	1645.8233	1645.8233	R	N	616	630
PSM	QHLGATGGPGAQLGASFLQAR	656	sp|Q9NWW5|CLN6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:21	ms_run[2]:scan=16397	87.036	2	2116.0215	2116.0215	R	H	8	29
PSM	RAAEDDEDDDVDTK	657	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1255	8.6606	3	1592.6438	1592.6438	K	K	89	103
PSM	RAAEDDEDDDVDTK	658	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2103	12.827	2	1592.6438	1592.6438	K	K	89	103
PSM	RAEDGSVIDYELIDQDAR	659	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=15737	83.164	3	2063.976	2063.9760	R	D	179	197
PSM	RASVCAEAYNPDEEEDDAESR	660	sp|P31323|KAP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4	ms_run[2]:scan=8189	43.268	3	2411.9772	2411.9772	R	I	112	133
PSM	RGFSDSGGGPPAK	661	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=3211	18.357	2	1311.5609	1311.5609	R	Q	63	76
PSM	RGPGVPSPQPDVTMLSR	662	sp|P78537|BL1S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=10906	57.017	2	1888.8866	1888.8866	R	L	16	33
PSM	RIDFTPVSPAPSPTR	663	sp|Q7Z309-4|F122B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=12164	63.601	3	1719.8345	1719.8345	K	G	127	142
PSM	RLPSSPASPSPK	664	sp|Q9H4G0-4|E41L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=3608	20.273	2	1302.6333	1302.6333	R	G	494	506
PSM	RLPSSPASPSPK	665	sp|Q9H4G0-4|E41L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=4365	24.183	3	1302.6333	1302.6333	R	G	494	506
PSM	RLSLDIQSPPNIGLR	666	sp|Q9NSI6-3|BRWD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=18569	100.7	2	1757.9189	1757.9189	R	R	694	709
PSM	RPAAAAAAGSASPR	667	sp|Q96S55-2|WRIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:21	ms_run[2]:scan=1569	10.103	2	1332.63	1332.6300	K	S	142	156
PSM	RPPKSPEEEGQMSS	668	sp|Q9BRL6-2|SRSF8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=1012	7.5653	2	1653.6706	1653.6706	K	-	262	276
PSM	RSPEAPQPVIAMEEPAVPAPLPK	669	sp|P14317|HCLS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=15367	80.989	3	2519.2495	2519.2495	K	K	274	297
PSM	RTSMGGTQQQFVEGVR	670	sp|P35222|CTNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=8413	44.392	2	1875.8299	1875.8299	R	M	550	566
PSM	RVPAMPGSPVEVK	671	sp|O43439-5|MTG8R_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=5859	31.467	2	1461.7051	1461.7051	K	I	17	30
PSM	SDGSLEDGDDVHR	672	sp|Q9NRX5|SERC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3582	20.126	2	1400.5804	1400.5804	R	A	361	374
PSM	SHTSLKDELSDVSQGGSK	673	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=10131	53.093	3	1953.8681	1953.8681	R	A	242	260
PSM	SISSPSVSSETMDKPVDLSTRK	674	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=9860	51.716	3	2446.1298	2446.1299	K	E	2802	2824
PSM	SKPIPIMPASPQK	675	sp|O00429-7|DNM1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=6268	33.529	2	1488.7412	1488.7412	K	G	404	417
PSM	SLIGVEYKPVSATGAEDKDK	676	sp|P07814|SYEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=12019	62.784	3	2186.0508	2186.0508	K	K	944	964
PSM	SMAHSPGPVSQASPGTSSAVLFLSK	677	sp|Q8TDZ2-2|MICA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=16695	88.809	3	2538.1826	2538.1826	K	L	527	552
PSM	SPLLAGGSPPQPVVPAHK	678	sp|Q8NFH5-2|NUP35_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=11874	61.998	2	1830.9393	1830.9393	R	D	49	67
PSM	SQDKLDKDDLEK	679	sp|Q14185|DOCK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=4414	24.426	2	1512.6709	1512.6709	R	E	1681	1693
PSM	SRSGEGEVSGLMR	680	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=4851	26.537	2	1459.6127	1459.6127	R	K	389	402
PSM	SSTPLPTISSSAENTR	681	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=10262	53.763	2	1726.7775	1726.7775	R	Q	158	174
PSM	STAQQELDGKPASPTPVIVASHTANK	682	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=10459	54.721	2	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	683	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=12003	62.706	3	2726.3276	2726.3276	R	E	818	844
PSM	STAQQELDGKPASPTPVIVASHTANK	684	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=12235	63.985	3	2726.3276	2726.3276	R	E	818	844
PSM	THFELEPSPPSGLGFTR	685	sp|O95049-5|ZO3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=18215	98.417	2	1950.8877	1950.8877	R	G	446	463
PSM	TNPPTQKPPSPPMSGR	686	sp|Q8IZP0-11|ABI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=4047	22.498	2	1786.8073	1786.8073	R	G	110	126
PSM	TPSIQPSLLPHAAPFAK	687	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=17730	95.311	2	1853.9441	1853.9441	R	S	1010	1027
PSM	TPSIQPSLLPHAAPFAK	688	sp|P35658-2|NU214_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=17891	96.33	2	1853.9441	1853.9441	R	S	1010	1027
PSM	VDTKPLEESSTLDPHTK	689	sp|Q14112-2|NID2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=7926	41.923	3	1975.914	1975.9140	K	E	297	314
PSM	VKVEPADSVESSPPSITHSPQNELK	690	sp|Q2TB10|ZN800_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	19-UNIMOD:21	ms_run[2]:scan=11949	62.403	3	2754.3113	2754.3113	K	G	408	433
PSM	VNKDDEEFIESNK	691	sp|P00450|CERU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6686	35.693	2	1565.7209	1565.7209	K	M	945	958
PSM	YKLDEDEDEDDADLSK	692	sp|O95218-2|ZRAB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8753	46.177	3	1898.7905	1898.7905	K	Y	167	183
PSM	TAKPFPGSVNQPATPFSPTR	693	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	17-UNIMOD:21	ms_run[1]:scan=14079	73.88838333333334	3	2180.047786	2179.046320	R	N	588	608
PSM	QKTPPPVAPKPAVK	694	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5430	29.401875	2	1519.8159	1519.8158	K	S	753	767
PSM	QKTPPPVAPKPAVK	695	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5638	30.418615000000003	2	1519.8157	1519.8158	K	S	753	767
PSM	EATSDPSRTPEEEPLNLEGLVAHR	696	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:27,9-UNIMOD:21	ms_run[1]:scan=19048	104.00501166666668	3	2708.2444	2708.2438	K	V	852	876
PSM	QSPLTYEDHGAPFAGHLPR	697	sp|Q9Y618|NCOR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=16662	88.62232	3	2154.9553	2154.9519	R	G	1538	1557
PSM	KPNIFYSGPASPAR	698	sp|Q6PL18|ATAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:21	ms_run[1]:scan=10891	56.94562833333333	3	1583.748658	1583.749744	R	P	317	331
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	699	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=13281	69.46122833333334	3	2971.4219	2971.4211	K	H	206	232
PSM	AADVSVTHRPPLSPK	700	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,13-UNIMOD:21	ms_run[1]:scan=10506	55.006151666666675	2	1695.8334	1695.8340	M	S	2	17
PSM	FNLTYVSHDGDDK	701	sp|P26639|SYTC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=11818	61.72683666666667	2	1510.657678	1509.673587	R	K	571	584
PSM	RDSSESQLASTESDKPTTGR	702	sp|Q96B23|CR025_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21	ms_run[1]:scan=4078	22.679338333333334	3	2231.978214	2230.970314	R	V	64	84
PSM	PSQGLPVIQSPPSSPPHR	703	sp|Q9HCD6|TANC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	14-UNIMOD:21	ms_run[1]:scan=12314	64.38286833333333	3	1961.965991	1959.956776	R	D	1433	1451
PSM	YSKPTAPAPSAPPSPSAPEPPK	704	sp|P55198|AF17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	14-UNIMOD:21	ms_run[1]:scan=8720	45.989395	3	2253.082638	2253.071866	K	A	369	391
PSM	SNSLDKHQQSSTLGNSVVR	705	sp|Q9BZ29|DOCK9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21	ms_run[1]:scan=6684	35.68508	3	2137.013789	2135.996075	K	C	1273	1292
PSM	DDDDIDLFGSDDEEESEEAKR	706	sp|P24534|EF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	10-UNIMOD:21	ms_run[1]:scan=15724	83.08526666666667	3	2508.937089	2507.933713	K	L	97	118
PSM	FKDDDGDEEDENGVGDAELR	707	sp|Q6NZY4|ZCHC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=8957	47.21942166666667	3	2224.888264	2223.903994	R	E	31	51
PSM	QHEAPSNRPLNELLTPQGPSPR	708	sp|P10398|ARAF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,15-UNIMOD:21	ms_run[1]:scan=14412	75.66630500000001	3	2500.1882	2500.1855	R	T	167	189
PSM	VHAYFAPVTPPPSVGGSR	709	sp|Q96IG2|FXL20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	9-UNIMOD:21	ms_run[1]:scan=13951	73.15989833333333	3	1916.930158	1917.913849	K	Q	409	427
PSM	SSSISEEKGDSDDEKPR	710	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:21	ms_run[1]:scan=1662	10.584841666666668	2	1944.791048	1944.794975	K	K	206	223
PSM	SRSTTELDDYSTNKNGNNK	711	sp|Q8WWI1|LMO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21	ms_run[1]:scan=4708	25.812601666666666	3	2223.929826	2222.944099	K	Y	1421	1440
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	712	sp|Q92597|NDRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:21	ms_run[1]:scan=8445	44.55880666666666	2	2456.059505	2455.076510	R	S	364	389
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	713	sp|Q96TA1|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	11-UNIMOD:21	ms_run[1]:scan=17943	96.66383833333333	3	3096.564601	3095.580500	R	A	655	686
PSM	AAECLDVDECHR	714	sp|Q8N2S1-2|LTBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=5344	28.944	2	1473.5977	1473.5977	R	V	557	569
PSM	AAPEASSPPASPLQHLLPGK	715	sp|Q96TA1-2|NIBL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=17698	95.111	2	2047.014	2047.0140	K	A	673	693
PSM	AEEQQLPPPLSPPSPSTPNHR	716	sp|Q6WCQ1-3|MPRIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	16-UNIMOD:21	ms_run[2]:scan=13053	68.223	3	2358.1005	2358.1005	K	R	279	300
PSM	AFGSGIDIKPGTPPIAGR	717	sp|Q9Y520-2|PRC2C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=15186	79.969	3	1832.9186	1832.9186	K	S	2419	2437
PSM	AGDKDDITEPAVCALR	718	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:4	ms_run[2]:scan=11472	59.983	3	1729.8305	1729.8305	R	H	445	461
PSM	AHSPGLLGPALGPPYPSGR	719	sp|Q6UXY1-2|BI2L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=16115	85.358	3	1922.9404	1922.9404	R	L	229	248
PSM	ALASEKSPTADAKPAPK	720	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=2164	13.159	2	1760.871	1760.8710	K	R	266	283
PSM	APLKPYPVSPSDK	721	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=8113	42.894	2	1477.7218	1477.7218	K	V	1039	1052
PSM	APPPVAYNPIHSPSYPLAALK	722	sp|Q9UMS6-5|SYNP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=19058	104.07	2	2282.1501	2282.1501	R	S	524	545
PSM	ASAVTAMGQLSSQGLHAPTSPEHAEAR	723	sp|Q6PJG6|BRAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35,20-UNIMOD:21	ms_run[2]:scan=10591	55.431	3	2799.2647	2799.2647	R	Q	563	590
PSM	DDKHGSYEDAVHSGALND	724	sp|P17987|TCPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=7729	40.954	2	2008.78	2008.7800	K	-	539	557
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	725	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=3896	21.73	3	2540.1908	2540.1908	R	E	7	32
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	726	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=4091	22.747	3	2540.1908	2540.1908	R	E	7	32
PSM	DKNTPSPFIETFTEDDEASR	727	sp|P48506|GSH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=17130	91.503	3	2298.0288	2298.0288	K	A	210	230
PSM	DKSPVREPIDNLTPEER	728	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=11344	59.293	3	2073.9732	2073.9732	K	D	134	151
PSM	DLDDALDKLSDSLGQR	729	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=15427	81.311	3	1759.8588	1759.8588	K	Q	448	464
PSM	DLKPENILCESPEKVSPVK	730	sp|Q9BUB5-3|MKNK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=15323	80.735	3	2261.1015	2261.1015	R	I	170	189
PSM	DLTHSDSESSLHMSDR	731	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=3985	22.182	2	1911.7306	1911.7306	R	Q	515	531
PSM	DSDDERPSFGGK	732	sp|Q9UBB9|TFP11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4295	23.821	2	1308.5582	1308.5582	R	R	58	70
PSM	DTGKTPVEPEVAIHR	733	sp|P60866|RS20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=8366	44.162	3	1727.8244	1727.8244	K	I	5	20
PSM	EEGRYDEEVEVYR	734	sp|Q5SNT2|TM201_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9416	49.474	2	1671.7376	1671.7376	R	H	142	155
PSM	EKQSSEEEEKETR	735	sp|Q92504|S39A7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=619	5.6693	2	1687.6938	1687.6938	K	G	272	285
PSM	ERPDLEAPAPGSPFR	736	sp|Q9NQT8-2|KI13B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=12725	66.459	3	1717.7825	1717.7825	R	V	152	167
PSM	ERPDLEAPAPGSPFR	737	sp|Q9NQT8-2|KI13B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=12729	66.476	2	1717.7825	1717.7825	R	V	152	167
PSM	ETNLDSLPLVDTHSK	738	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=15764	83.325	2	1747.803	1747.8030	R	R	425	440
PSM	FADQHVPGSPFSVK	739	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=13086	68.393	2	1594.7181	1594.7181	K	V	2112	2126
PSM	FASDDEHDEHDENGATGPVK	740	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=4814	26.359	3	2248.8546	2248.8546	K	R	364	384
PSM	FPGQLNADLR	741	sp|Q13509-2|TBB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12704	66.35	2	1129.588	1129.5880	R	K	170	180
PSM	GADSGEEKEEGINR	742	sp|Q9BVG4|PBDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1700	10.785	2	1489.6645	1489.6645	K	E	194	208
PSM	GEQEHSQQKEEEEEMAVVPQGLFR	743	sp|P10645|CMGA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=15750	83.243	3	2909.2539	2909.2539	K	G	295	319
PSM	GHYEVTGSDDETGK	744	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=3264	18.597	2	1573.5934	1573.5934	K	L	5834	5848
PSM	GPKPEPPGSGSPAPPR	745	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=3837	21.402	2	1606.7505	1606.7505	R	R	652	668
PSM	GVGSGPHPPDTQQPSPSK	746	sp|Q68CZ2-2|TENS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=4227	23.472	2	1851.8153	1851.8153	R	A	406	424
PSM	HCGLSLSSTPPGK	747	sp|Q71F23-3|CENPU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=8200	43.317	2	1419.6218	1419.6218	K	E	90	103
PSM	HDYDDSSEEQSAEIR	748	sp|P98175-4|RBM10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5215	28.351	3	1779.7184	1779.7184	K	G	55	70
PSM	HGGPGPGGPEPELSPITEGSEAR	749	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=12568	65.657	3	2307.0169	2307.0169	R	A	554	577
PSM	HPLLSSGGPQSPLR	750	sp|Q9P1Y5|CAMP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=9812	51.457	3	1524.745	1524.7450	R	G	358	372
PSM	HPPVLTPPDQEVIR	751	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=13182	68.91	2	1676.8287	1676.8287	R	N	636	650
PSM	HSPIKEEPCGSLSETVCK	752	sp|Q68DK7|MSL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:4,13-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=8379	44.224	2	2136.9221	2136.9221	K	R	361	379
PSM	HTGPNSPDTANDGFVR	753	sp|P31943|HNRH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=6790	36.251	3	1763.7264	1763.7264	K	L	99	115
PSM	HTPPTIGGSLPYR	754	sp|Q9NYB9-2|ABI2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=11967	62.506	3	1474.697	1474.6970	R	R	293	306
PSM	IEDVGSDEEDDSGKDKK	755	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=900	7.0897	2	1944.7837	1944.7837	K	K	250	267
PSM	IPDPEAVKPDDWDEDAPAK	756	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13985	73.357	3	2106.9746	2106.9746	K	I	293	312
PSM	IYVASVHQDLSDDDIK	757	sp|Q9UHX1-4|PUF60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12590	65.767	3	1816.8843	1816.8843	R	S	168	184
PSM	KAALSASEGEEVPQDK	758	sp|O95831-6|AIFM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5228	28.411	3	1657.8159	1657.8159	K	A	25	41
PSM	KAQAVSEEEEEEEGKSSSPK	759	sp|Q9GZR7-2|DDX24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=3652	20.486	3	2256.9635	2256.9635	R	K	77	97
PSM	KASSDMSASAGYEEISDPDMEEKPSLPPR	760	sp|A1X283|SPD2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,6-UNIMOD:35,20-UNIMOD:35	ms_run[2]:scan=12268	64.159	3	3235.3574	3235.3574	R	K	497	526
PSM	KDVDEAYMNK	761	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:35	ms_run[2]:scan=1570	10.107	2	1227.5442	1227.5442	K	V	198	208
PSM	KECEEEAINIQSTAPEEEHESPR	762	sp|P46939|UTRO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=9629	50.552	3	2791.1644	2791.1644	K	A	275	298
PSM	KEEEEEEEEYDEGSNLK	763	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6693	35.728	3	2084.8546	2084.8546	K	K	230	247
PSM	KEEQLSSYEDK	764	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4011	22.312	2	1354.6252	1354.6252	R	L	479	490
PSM	KPGPSGPSESPK	765	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=1058	7.7771	2	1246.5595	1246.5595	R	A	498	510
PSM	KPLAAPGDGEGLGQTAQPSPPAR	766	sp|Q9Y4F5-3|C170B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	19-UNIMOD:21	ms_run[2]:scan=9486	49.825	3	2294.1056	2294.1056	R	D	741	764
PSM	KPLAAPGDGEGLGQTAQPSPPAR	767	sp|Q9Y4F5-3|C170B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	19-UNIMOD:21	ms_run[2]:scan=9685	50.836	3	2294.1056	2294.1056	R	D	741	764
PSM	KQSFDDNDSEELEDKDSK	768	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=5776	31.05	3	2207.8743	2207.8743	K	S	105	123
PSM	KQSLGELIGTLNAAK	769	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=18761	102.01	2	1621.844	1621.8440	R	V	19	34
PSM	KRESESESDETPPAAPQLIK	770	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=11221	58.612	3	2371.0346	2371.0346	R	K	448	468
PSM	KTSDANETEDHLESLICK	771	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=11805	61.669	3	2168.9297	2168.9297	R	V	20	38
PSM	KTSDANETEDHLESLICK	772	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=15802	83.564	3	2168.9297	2168.9297	R	V	20	38
PSM	KVSSAEGAAKEEPK	773	sp|P05114|HMGN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1713	10.865	3	1509.7076	1509.7076	R	R	5	19
PSM	LKSEDGVEGDLGETQSR	774	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=8382	44.242	3	1898.8259	1898.8259	R	T	133	150
PSM	LLDHMAPPPVADQASPR	775	sp|Q9C004|SPY4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=8739	46.103	3	1909.8757	1909.8757	R	A	111	128
PSM	LLDHMAPPPVADQASPR	776	sp|Q9C004|SPY4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=8937	47.111	3	1909.8757	1909.8757	R	A	111	128
PSM	LLDPEDISVDHPDEK	777	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13220	69.118	2	1720.8156	1720.8156	K	S	250	265
PSM	LLKPGEEPSEYTDEEDTK	778	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=9081	47.818	2	2158.9195	2158.9195	R	D	200	218
PSM	LLLERPSPIR	779	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=12548	65.563	2	1272.6955	1272.6955	R	D	650	660
PSM	LTPLILKPFGNSISR	780	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=19704	108.47	2	1734.9434	1734.9434	K	Y	117	132
PSM	MGPLGLDHMASSIER	781	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35,9-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=10549	55.225	2	1724.7263	1724.7263	R	M	418	433
PSM	NDHDDDEDEEVISK	782	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4081	22.694	3	1658.6544	1658.6544	R	T	342	356
PSM	NDMAVPTPPPPPVPPTK	783	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=10947	57.22	2	1849.8685	1849.8685	K	Q	486	503
PSM	NDMAVPTPPPPPVPPTK	784	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=11332	59.224	2	1849.8685	1849.8685	K	Q	486	503
PSM	NDMAVPTPPPPPVPPTK	785	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=11692	61.088	3	1849.8685	1849.8685	K	Q	486	503
PSM	PAGQHGSLSPAAAHTASPEPPTQSGPLTR	786	sp|Q8NC74|RB8NL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=9962	52.242	3	2979.3277	2979.3277	K	S	458	487
PSM	PIPNQPPTAAHTANFLLNASGSTSTPAPSR	787	sp|P53396-3|ACLY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	25-UNIMOD:21	ms_run[2]:scan=16903	90.087	3	3094.4873	3094.4873	R	T	162	192
PSM	PLGAAPQAEHQGLPVPGSPGGQK	788	sp|Q9Y4F5-3|C170B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	18-UNIMOD:21	ms_run[2]:scan=11701	61.142	3	2272.1001	2272.1001	R	W	568	591
PSM	PMEEDGEEKSPSKK	789	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=580	5.3762	2	1685.6855	1685.6855	R	K	373	387
PSM	RAAEDDEDDDVDTK	790	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=988	7.4674	3	1592.6438	1592.6438	K	K	89	103
PSM	RADLNQGIGEPQSPSR	791	sp|Q96C19|EFHD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=6393	34.186	3	1803.8265	1803.8265	R	R	62	78
PSM	RASPGTPLSPGSLR	792	sp|Q96BD0-2|SO4A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=9604	50.421	2	1474.7293	1474.7293	R	S	32	46
PSM	RGSGDTSSLIDPDTSLSELR	793	sp|Q9Y608-2|LRRF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=17533	94.073	3	2184.99	2184.9900	R	E	94	114
PSM	RGSGPEIFTFDPLPEPAAAPAGR	794	sp|P46695|IEX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=21215	119.3	3	2432.1526	2432.1526	R	P	29	52
PSM	RIDISPSTFR	795	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=13565	71.021	2	1270.6071	1270.6071	R	K	678	688
PSM	RIDISPSTFR	796	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=13750	72.029	2	1270.6071	1270.6071	R	K	678	688
PSM	RLPSSPASPSPK	797	sp|Q9H4G0-4|E41L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=4519	24.914	2	1302.6333	1302.6333	R	G	494	506
PSM	RLSFEASNPPFDVGR	798	sp|Q92545|TM131_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=16783	89.373	2	1770.809	1770.8090	R	P	1153	1168
PSM	RPGGEPSPEGTTGQSYNQYSQR	799	sp|P02751-12|FINC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	20-UNIMOD:21	ms_run[2]:scan=6391	34.179	3	2475.0452	2475.0452	R	Y	1957	1979
PSM	RVIENADGSEEETDTR	800	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=3630	20.396	3	1899.7847	1899.7847	R	D	1946	1962
PSM	RVISDSESDIGGSDVEFKPDTK	801	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=12770	66.705	3	2460.1057	2460.1057	R	E	249	271
PSM	RVSEVEEEKEPVPQPLPSDDTR	802	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=9630	50.556	3	2615.2116	2615.2116	R	V	446	468
PSM	RYPNVFGIGDCTNLPTSK	803	sp|Q9Y6N5|SQOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=17669	94.925	3	2117.9605	2117.9605	R	T	327	345
PSM	SAKDSDDEEEVVHVDR	804	sp|P61266-2|STX1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=6465	34.534	3	1908.7738	1908.7738	R	D	10	26
PSM	SDAEEDGGTVSQEEEDRKPK	805	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=3817	21.299	2	2284.9333	2284.9333	K	A	554	574
PSM	SHSQASLAGPGPVDPSNR	806	sp|Q9P2M7-2|CING_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=7455	39.54	2	1855.8214	1855.8214	R	S	129	147
PSM	SNHYDPEEDEEYYR	807	sp|Q07157-2|ZO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8735	46.079	3	1844.7126	1844.7126	R	K	1263	1277
PSM	SPSAEFSPAAPPGISSIHSPSLR	808	sp|Q68DK2-5|ZFY26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=17058	91.047	3	2371.1209	2371.1209	R	E	1762	1785
PSM	SPSLDNPTPFPNLGPSENPLKR	809	sp|Q14653|IRF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=18831	102.5	3	2456.1737	2456.1737	R	L	173	195
PSM	SQSLSSTDSSVHAPSEITVAHGSGLGK	810	sp|Q9Y2H2-4|SAC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=12186	63.716	3	2718.2498	2718.2498	R	G	295	322
PSM	SRGSGGLGGACGGAGFGSR	811	sp|P48668|K2C6C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=7529	39.946	3	1746.7257	1746.7257	R	S	41	60
PSM	STAQQELDGKPASPTPVIVASHTANK	812	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=11382	59.485	3	2726.3276	2726.3276	R	E	818	844
PSM	STTPPPAEPVSLPQEPPKPR	813	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=12080	63.113	3	2204.0878	2204.0878	K	V	225	245
PSM	SVRPTDSNVSPAISIHEIGAVGATK	814	sp|P46020-3|KPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=15406	81.197	3	2585.285	2585.2850	R	T	913	938
PSM	TGVAVNKPAEFTVDAK	815	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10387	54.375	3	1645.8675	1645.8675	K	H	685	701
PSM	THSAASSSQGASVNPEPLHSSLDK	816	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=8377	44.211	3	2486.1075	2486.1075	K	L	468	492
PSM	TLEESKEMDIK	817	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:35	ms_run[2]:scan=3170	18.162	2	1337.6384	1337.6384	K	R	1703	1714
PSM	TLEHSLPPSPR	818	sp|Q8TE67-2|ES8L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=6119	32.763	2	1312.6177	1312.6177	R	P	197	208
PSM	TRPGSFQSLSDALSDTPAK	819	sp|Q9H9C1-2|SPE39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=16753	89.181	3	2056.9467	2056.9467	R	S	68	87
PSM	TRSVEDDEEGHLICQSGDVLSAR	820	sp|P49759|CLK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=14627	76.866	3	2652.1487	2652.1487	R	Y	138	161
PSM	TSPADHGGSVGSESGGSAVDSVAGEHSVSGR	821	sp|Q5T4S7-3|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=8547	45.04	3	2919.2268	2919.2268	R	S	2860	2891
PSM	TSPLKDNPSPEPQLDDIKR	822	sp|Q96JC9-2|EAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=11060	57.776	2	2229.0678	2229.0678	K	E	56	75
PSM	TSQVGAASAPAKESPR	823	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=2261	13.626	2	1635.7618	1635.7618	K	K	291	307
PSM	VHAPGLNLSGVGGK	824	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=12574	65.683	2	1384.6864	1384.6864	K	M	5324	5338
PSM	VHSPSGALEECYVTEIDQDKYAVR	825	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=17354	92.917	3	2845.263	2845.2630	K	F	2360	2384
PSM	VHVQFFDDSPTR	826	sp|P52701-2|MSH6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=14427	75.751	2	1526.6555	1526.6555	R	G	129	141
PSM	VPPLQPMGPTCPTPAPVPPPEAPSPFR	827	sp|Q8IZL8|PELP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35,11-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=17750	95.425	3	2929.3908	2929.3908	R	A	635	662
PSM	EATSDPSRTPEEEPLNLEGLVAHR	828	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:21	ms_run[1]:scan=17524	94.0316	3	2727.239542	2726.254869	K	V	852	876
PSM	KPSPEPEGEVGPPK	829	sp|Q7Z5L9|I2BP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=5177	28.152171666666668	2	1526.706711	1526.701790	R	I	358	372
PSM	RTASPPPPPK	830	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:21	ms_run[1]:scan=1712	10.86242	2	1126.553445	1126.553610	R	R	613	623
PSM	KEESEESDDDMGFGLFD	831	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=18408	99.64800333333334	2	2045.715321	2044.713279	K	-	98	115
PSM	KEESEESDDDMGFGLFD	832	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=18214	98.41307166666667	2	2045.716030	2044.713279	K	-	98	115
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	833	sp|O14639|ABLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:21	ms_run[1]:scan=15921	84.24368666666668	3	2776.224166	2775.240222	R	D	662	687
PSM	SDGSLEDGDDVHR	834	sp|Q9NRX5|SERC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=3381	19.116641666666666	2	1400.579620	1400.580415	R	A	361	374
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	835	sp|Q96TA1|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:21	ms_run[1]:scan=18417	99.69966666666666	3	3096.563272	3095.580500	R	A	655	686
PSM	KDDDDEEIGGPK	836	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=2427	14.47531	2	1318.584842	1316.573205	K	E	628	640
PSM	KQSFDDNDSEELEDK	837	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=6518	34.81469666666667	2	1797.756949	1797.754082	K	D	105	120
PSM	KVQVAALQASPPLDQDDR	838	sp|Q9UDY2|ZO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:21	ms_run[1]:scan=12687	66.26616	3	2028.952352	2029.983385	R	A	121	139
PSM	SRSTTELDDYSTNKNGNNK	839	sp|Q8WWI1|LMO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	12-UNIMOD:21	ms_run[1]:scan=4746	26.00607	2	2223.928204	2222.944099	K	Y	1421	1440
PSM	FASDDEHDEHDENGATGPVK	840	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=5712	30.761654999999998	3	2249.841061	2248.854615	K	R	364	384
PSM	VSSSASSSSHHEASTQETSESSR	841	sp|P55198|AF17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	15-UNIMOD:21	ms_run[1]:scan=702	6.163265	2	2443.974002	2443.972499	K	E	274	297
PSM	ADILEDKDGK	842	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3722	20.842	2	1102.5506	1102.5506	R	S	194	204
PSM	ADRDESSPYAAMLAAQDVAQR	843	sp|P62263|RS14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=16444	87.33	3	2264.0492	2264.0492	K	C	64	85
PSM	AGKEESGVSVSNSQPTNESHSIK	844	sp|Q99808|S29A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=5033	27.415	3	2451.0915	2451.0915	R	A	261	284
PSM	AGLESGAEPGDGDSDTTKKK	845	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:21	ms_run[2]:scan=2824	16.5	3	2041.8841	2041.8841	K	K	481	501
PSM	ALASEKSPTADAKPAPK	846	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=2179	13.23	3	1760.871	1760.8710	K	R	266	283
PSM	ALDIDLDKPLADSEK	847	sp|O14617-3|AP3D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15112	79.553	2	1641.8461	1641.8461	R	L	632	647
PSM	ALRPGDLPPSPDDVK	848	sp|O75382-4|TRIM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=11308	59.08	2	1655.792	1655.7920	R	R	299	314
PSM	APSPPVEHPR	849	sp|Q86WR7-2|PRSR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3496	19.699	2	1165.5281	1165.5281	R	L	177	187
PSM	ASAVTAMGQLSSQGLHAPTSPEHAEAR	850	sp|Q6PJG6|BRAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	19-UNIMOD:21	ms_run[2]:scan=14633	76.892	3	2783.2698	2783.2698	R	Q	563	590
PSM	ATPTKAPAPVVLGSPVVLGPPVGQAR	851	sp|Q6ZN55|ZN574_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=18546	100.54	3	2558.3986	2558.3986	R	V	151	177
PSM	AVAGVMITASHNR	852	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=6163	32.971	2	1421.6486	1421.6486	K	K	166	179
PSM	DAALATALGDKK	853	sp|P20700|LMNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7857	41.583	2	1172.6401	1172.6401	K	S	146	158
PSM	DFTVSALHGDMDQK	854	sp|Q14240|IF4A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:35	ms_run[2]:scan=10420	54.522	2	1578.6984	1578.6984	R	E	297	311
PSM	DFTVSAMHGDMDQK	855	sp|P60842-2|IF4A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35,11-UNIMOD:35	ms_run[2]:scan=4785	26.206	2	1612.6498	1612.6498	R	E	296	310
PSM	DGLAPEKTSPDRDK	856	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=2340	14.039	2	1607.7192	1607.7192	R	K	9	23
PSM	DHNEEEGEETGLR	857	sp|Q32MZ4-3|LRRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3195	18.278	2	1513.6281	1513.6281	R	D	441	454
PSM	DKDDDEVFEK	858	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5000	27.257	2	1238.5303	1238.5303	K	K	658	668
PSM	DKSPVREPIDNLTPEER	859	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=10575	55.354	2	2073.9732	2073.9732	K	D	134	151
PSM	DLDDALDKLSDSLGQR	860	sp|P20810-3|ICAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=20374	113.1	2	1759.8588	1759.8588	K	Q	448	464
PSM	DLFDYSPPLHK	861	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=17061	91.063	2	1410.6221	1410.6221	K	N	505	516
PSM	DREEDEEDAYER	862	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=3755	20.999	2	1554.607	1554.6070	R	R	432	444
PSM	DSDDERPSFGGK	863	sp|Q9UBB9|TFP11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4105	22.817	2	1308.5582	1308.5582	R	R	58	70
PSM	DTGKTPVEPEVAIHR	864	sp|P60866|RS20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=7921	41.9	3	1727.8244	1727.8244	K	I	5	20
PSM	EIAIVHSDAEK	865	sp|Q9H307|PININ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=5857	31.46	2	1290.5857	1290.5857	K	E	341	352
PSM	ERDEDDEDGDGDGDGATGK	866	sp|P50579-3|MAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=712	6.223	3	1951.7151	1951.7151	K	K	80	99
PSM	EVTEEDLNNHFK	867	sp|Q6NVY1|HIBCH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8972	47.294	2	1473.6736	1473.6736	K	S	366	378
PSM	FASDDEHDEHDENGATGPVK	868	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=5032	27.411	2	2248.8546	2248.8546	K	R	364	384
PSM	FASDDEHDEHDENGATGPVK	869	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=5030	27.405	3	2248.8546	2248.8546	K	R	364	384
PSM	FSTYTSDKDENK	870	sp|Q8WU90|ZC3HF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=2694	15.81	2	1433.6311	1433.6311	R	L	355	367
PSM	GAAEEAELEDSDDEEKPVKQDDFPK	871	sp|Q9UBB9|TFP11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=10997	57.459	3	2870.2019	2870.2019	K	D	88	113
PSM	GDDQLELIKDDEK	872	sp|P07910-3|HNRPC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10689	55.927	2	1516.7257	1516.7257	R	E	196	209
PSM	GEIDAHEDSFK	873	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5835	31.363	2	1246.5466	1246.5466	K	S	408	419
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	874	sp|P49848-4|TAF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=13082	68.373	3	2762.2735	2762.2735	K	Q	609	638
PSM	GGSGSPGPEPPGRPDGPSLLYR	875	sp|Q14526-2|HIC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=13230	69.184	2	2229.0216	2229.0216	R	W	290	312
PSM	GKSESQMDITDINTPKPK	876	sp|P08473|NEP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=7184	38.214	3	2083.9497	2083.9497	M	K	2	20
PSM	HGLQLGAQSPGR	877	sp|Q8N1G0|ZN687_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=6091	32.632	2	1299.6085	1299.6085	R	G	1049	1061
PSM	HGLQLGAQSPGR	878	sp|Q8N1G0|ZN687_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=6290	33.649	2	1299.6085	1299.6085	R	G	1049	1061
PSM	HLFSSTENLAAGSWK	879	sp|Q6WKZ4-2|RFIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=16603	88.291	2	1726.7716	1726.7716	K	E	205	220
PSM	HPLSPGFGAAGTPR	880	sp|Q96QH2|PRAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=9920	52.022	3	1443.666	1443.6660	R	W	404	418
PSM	HPPAPAEPSSDLASK	881	sp|Q9P2E9-3|RRBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=5459	29.525	2	1582.7029	1582.7029	K	L	666	681
PSM	HPPVLTPPDQEVIR	882	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=13228	69.173	3	1676.8287	1676.8287	R	N	636	650
PSM	HSPIKEEPCGSLSETVCK	883	sp|Q68DK7|MSL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,9-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=8349	44.085	3	2136.9221	2136.9221	K	R	361	379
PSM	HTPPTIGGSLPYR	884	sp|Q9NYB9-2|ABI2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=12149	63.518	3	1474.697	1474.6970	R	R	293	306
PSM	IDVDAPDIDIHGPDAK	885	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14094	73.954	2	1689.821	1689.8210	K	L	3260	3276
PSM	IEDSEPHIPLIDDTDAEDDAPTKR	886	sp|P20020-6|AT2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=16230	86.045	3	2771.2175	2771.2175	R	N	1116	1140
PSM	IHIDPEIQDGSPTTSR	887	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=10845	56.706	3	1844.8306	1844.8306	R	R	102	118
PSM	IPMTPTSSFVSPPPPTASPHSNR	888	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=12356	64.605	3	2500.1458	2500.1458	K	T	373	396
PSM	IPMTPTSSFVSPPPPTASPHSNR	889	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=12756	66.633	3	2500.1458	2500.1458	K	T	373	396
PSM	ISYTPPESPVPSYASSTPLHVPVPR	890	sp|P41212|ETV6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=18927	103.16	3	2757.3415	2757.3415	R	A	15	40
PSM	IYEDGDDDMKR	891	sp|Q9HB71-3|CYBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35	ms_run[2]:scan=1358	9.125	2	1371.5613	1371.5613	K	T	155	166
PSM	KDDEEEDPLDQLISR	892	sp|Q9NYJ1|COA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17526	94.039	3	1800.8378	1800.8378	K	S	17	32
PSM	KETPPPLVPPAAR	893	sp|Q9BQA1-2|MEP50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=10052	52.696	2	1451.7538	1451.7538	R	E	3	16
PSM	KEVEGDDVPESIMLEMK	894	sp|Q1KMD3|HNRL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=11411	59.641	3	1979.9068	1979.9068	R	A	577	594
PSM	KGAGDGSDEEVDGKADGAEAK	895	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=2137	13.009	2	2084.8536	2084.8536	R	P	1937	1958
PSM	KLEKEEEEGISQESSEEEQ	896	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:21	ms_run[2]:scan=5124	27.885	3	2315.953	2315.9530	K	-	89	108
PSM	KLEKEEEEGISQESSEEEQ	897	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:21	ms_run[2]:scan=5334	28.901	3	2315.953	2315.9530	K	-	89	108
PSM	KPEDPEECPEEVYDPR	898	sp|Q9GZU8|PIP30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:4	ms_run[2]:scan=9448	49.647	3	1987.8469	1987.8469	R	S	37	53
PSM	KPEDVLDDDDAGSAPLK	899	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10520	55.075	3	1783.8476	1783.8476	R	S	141	158
PSM	KPEDVLDDDDAGSAPLK	900	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10789	56.423	3	1783.8476	1783.8476	R	S	141	158
PSM	KPSVGVPPPASPSYPR	901	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=9074	47.782	2	1714.8444	1714.8444	R	A	980	996
PSM	KPSVGVPPPASPSYPR	902	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=9296	48.844	2	1714.8444	1714.8444	R	A	980	996
PSM	KQDFDEDDILK	903	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12497	65.299	3	1364.646	1364.6460	K	E	50	61
PSM	KSAEIDSDDTGGSAAQK	904	sp|P33176|KINH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1456	9.5931	3	1678.7646	1678.7646	K	Q	813	830
PSM	KSLEDVTAEYIHK	905	sp|Q9P0K7-4|RAI14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=12415	64.893	3	1611.7546	1611.7546	R	A	637	650
PSM	KSPEHPVDDIDK	906	sp|Q14667-2|K0100_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=3517	19.82	2	1458.6392	1458.6392	R	M	2063	2075
PSM	KVSSDTLETIAPGHDCCETVK	907	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,16-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=11175	58.378	3	2426.0495	2426.0495	R	V	49	70
PSM	LAISEDHVASVKK	908	sp|Q9HC35|EMAL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=7163	38.1	2	1475.7385	1475.7385	R	S	52	65
PSM	LDHINFPVFEPSTPDPAPAK	909	sp|Q8ND04|SMG8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=19419	106.52	3	2271.0613	2271.0613	K	N	645	665
PSM	LEEEEDRGQQLQAER	910	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5130	27.916	2	1828.8551	1828.8551	R	K	931	946
PSM	LHLAGFSSVR	911	sp|O60449|LY75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=14150	74.264	2	1165.5645	1165.5645	R	Y	1696	1706
PSM	LHLAGFSSVR	912	sp|O60449|LY75_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=14341	75.275	2	1165.5645	1165.5645	R	Y	1696	1706
PSM	LKECEDASEEPEEK	913	sp|Q8N370-4|LAT4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:4	ms_run[2]:scan=2573	15.207	2	1691.7196	1691.7196	R	D	252	266
PSM	LLKPGEEPSEYTDEEDTK	914	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=9056	47.696	3	2158.9195	2158.9195	R	D	200	218
PSM	MEKEEMEEELGEK	915	sp|Q9P2M7-2|CING_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35,6-UNIMOD:35	ms_run[2]:scan=2752	16.101	2	1641.675	1641.6750	R	I	588	601
PSM	NEELKEVEEER	916	sp|Q92878-3|RAD50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6946	37.064	2	1402.6576	1402.6576	R	K	889	900
PSM	NFGEDMDDER	917	sp|P11940-2|PABP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35	ms_run[2]:scan=3333	18.914	2	1242.4459	1242.4459	K	L	197	207
PSM	NSSSPCISGTTHTLHDSSVASIETK	918	sp|Q5JWR5|DOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=11419	59.686	3	2695.1797	2695.1797	R	S	1235	1260
PSM	PDERPSSPIPLLPPPK	919	sp|O15047|SET1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=14548	76.421	3	1818.9281	1818.9281	R	K	1147	1163
PSM	PGRPLSPANVPALPGETVTSPVR	920	sp|Q8IY33|MILK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=16820	89.589	3	2391.2312	2391.2312	K	L	707	730
PSM	PRPEAEPPSPPSGDLR	921	sp|Q8WUA7-3|TB22A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=8796	46.384	2	1780.8145	1780.8145	K	L	77	93
PSM	PSQLQAHTPASQQTPPLPPYASPR	922	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:21	ms_run[2]:scan=13017	68.026	3	2648.2748	2648.2748	K	S	253	277
PSM	PSSHKDLTQCVTCQEK	923	sp|Q8N448|LNX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,10-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=5189	28.211	3	1996.8384	1996.8384	R	H	452	468
PSM	PSVPSADSETPLTQDRPGSPSGSEDKGNPAPELR	924	sp|Q96FS4|SIPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	19-UNIMOD:21	ms_run[2]:scan=12690	66.282	3	3554.6162	3554.6162	K	A	866	900
PSM	RAAEDDEDDDVDTK	925	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1811	11.309	3	1592.6438	1592.6438	K	K	89	103
PSM	RAEDGSVIDYELIDQDAR	926	sp|P07355|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=15110	79.542	3	2063.976	2063.9760	R	D	179	197
PSM	RALSSDSILSPAPDAR	927	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=12150	63.522	2	1734.8302	1734.8302	R	A	391	407
PSM	RASEEEENKASEEYIQR	928	sp|Q8IYW5|RN168_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=6241	33.366	3	2146.9168	2146.9168	R	L	132	149
PSM	RASPGLSMPSSSPPIKK	929	sp|P57682|KLF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,7-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=6618	35.329	2	1914.8676	1914.8676	R	Y	90	107
PSM	RGEAAGSPVPTPPR	930	sp|Q9HB09-2|B2L12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=4719	25.863	2	1470.698	1470.6980	R	P	107	121
PSM	RLSLPMDIR	931	sp|Q07002|CDK18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=13011	67.995	2	1195.5784	1195.5784	K	L	96	105
PSM	RLTVSSLQESGLK	932	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12691	66.286	2	1496.76	1496.7600	R	V	2326	2339
PSM	RMSDEFVDSFK	933	sp|Q92934|BAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=12791	66.811	2	1455.5741	1455.5741	R	K	116	127
PSM	RNSSEASSGDFLDLK	934	sp|Q9UK76|JUPI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=14289	75.005	3	1704.7356	1704.7356	R	G	85	100
PSM	RPAAAAAAGSASPR	935	sp|Q96S55-2|WRIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=1119	8.0547	2	1332.63	1332.6300	K	S	142	156
PSM	RPASPSSPEHLPATPAESPAQR	936	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=8641	45.44	3	2442.073	2442.0730	K	F	231	253
PSM	RPESPSEISPIK	937	sp|Q7Z5K2|WAPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=8829	46.546	2	1418.6807	1418.6807	K	G	218	230
PSM	RPLPVESPDTQR	938	sp|P57682|KLF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=6013	32.25	3	1473.6977	1473.6977	K	K	244	256
PSM	RPSTAVDEEDEDSPSECHTPEK	939	sp|O15033-2|AREL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=5015	27.333	3	2594.0116	2594.0116	R	V	325	347
PSM	RPSTYGIPR	940	sp|P78347-2|GTF2I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=7016	37.426	2	1125.5332	1125.5332	R	L	369	378
PSM	RPSVNGEPGSVPPPR	941	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=5853	31.439	2	1624.7723	1624.7723	R	A	1255	1270
PSM	RPSVYLPTR	942	sp|Q9BW61|DDA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9547	50.156	2	1167.5802	1167.5802	R	E	31	40
PSM	RSTQGVTLTDLQEAEK	943	sp|O14974-5|MYPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12663	66.147	2	1854.8724	1854.8724	R	T	607	623
PSM	RTSPANSSGDSAIASCHDGGSSYGK	944	sp|Q86UZ6|ZBT46_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=4590	25.241	3	2548.0286	2548.0286	R	E	174	199
PSM	RYPNVFGIGDCTNLPTSK	945	sp|Q9Y6N5|SQOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:4,17-UNIMOD:21	ms_run[2]:scan=17505	93.912	3	2117.9605	2117.9605	R	T	327	345
PSM	SDDSKSSSPELVTHLK	946	sp|Q07960|RHG01_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=8477	44.703	2	1808.8193	1808.8193	K	W	44	60
PSM	SKGHYEVTGSDDETGK	947	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=2419	14.438	3	1788.7204	1788.7204	K	L	5832	5848
PSM	SLLNHTPPSGR	948	sp|Q9UKI8|TLK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=6475	34.579	2	1257.5867	1257.5867	R	P	33	44
PSM	SPAHPTPLSR	949	sp|Q6P4Q7-2|CNNM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=2639	15.505	2	1141.5281	1141.5281	R	S	139	149
PSM	SPALKSPLQSVVVR	950	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=13494	70.633	2	1559.8436	1559.8436	R	R	248	262
PSM	SPSKENIASVLENYHTESK	951	sp|Q6NVY1|HIBCH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=15716	83.043	3	2212.0049	2212.0049	K	I	234	253
PSM	STAGDTHLGGEDFDNR	952	sp|P11142-2|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=7458	39.556	2	1690.7183	1690.7183	K	M	221	237
PSM	STAQQELDGKPASPTPVIVASHTANK	953	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=8594	45.254	3	2726.3276	2726.3276	R	E	818	844
PSM	STTPPPAEPVSLPQEPPKPR	954	sp|Q9UN86-2|G3BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=11527	60.258	2	2204.0878	2204.0878	K	V	225	245
PSM	SYSPDGKESPSDKK	955	sp|P43243-2|MATR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=1106	7.9912	2	1603.6767	1603.6767	R	S	308	322
PSM	TADGRVSPAGGTLDDKPK	956	sp|Q8WY36-2|BBX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=4464	24.662	2	1863.8728	1863.8728	R	E	808	826
PSM	TAKPFPGSVNQPATPFSPTR	957	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:21	ms_run[2]:scan=13536	70.868	3	2179.0463	2179.0463	R	N	193	213
PSM	TLEHSLPPSPR	958	sp|Q8TE67-2|ES8L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=7176	38.167	2	1312.6177	1312.6177	R	P	197	208
PSM	TQATGLTKPTLPPSPLMAAR	959	sp|P85298-4|RHG08_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:21,17-UNIMOD:35	ms_run[2]:scan=14107	74.022	3	2146.0857	2146.0857	R	R	411	431
PSM	TYSDTDSCSDIPLEDPDRPVHCSK	960	sp|Q9HB20|PKHA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,8-UNIMOD:4,22-UNIMOD:4	ms_run[2]:scan=11555	60.393	3	2873.1521	2873.1521	R	N	242	266
PSM	VIKDEALSDGDDLR	961	sp|Q01831-3|XPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=9534	50.095	2	1624.7345	1624.7345	K	D	87	101
PSM	VKETQEDKLEGGAAK	962	sp|O43491-2|E41L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=2904	16.892	2	1681.7924	1681.7924	K	R	177	192
PSM	VTKNEEPSEEEIDAPKPK	963	sp|Q9NR30|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=5804	31.186	3	2118.9722	2118.9722	K	K	114	132
PSM	YGGSVGSQPPPVAPEPGPVPSSPSQEPPTKR	964	sp|Q04323-2|UBXN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	24-UNIMOD:21	ms_run[2]:scan=11458	59.904	3	3162.5023	3162.5023	K	E	179	210
PSM	YGQFSGLNPGGRPITPPR	965	sp|P62136-3|PP1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:21	ms_run[2]:scan=14566	76.516	2	1992.9571	1992.9571	K	N	262	280
PSM	YLAEVAAGDDKK	966	sp|P63104-2|1433Z_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=4955	27.04	3	1278.6456	1278.6456	R	G	53	65
PSM	YSKEEEMDDMDR	967	sp|Q9HD45|TM9S3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=869	6.9641	3	1578.5814	1578.5814	R	D	255	267
PSM	GHYEVTGSDDETGK	968	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:21	ms_run[1]:scan=3248	18.526948333333333	2	1573.593108	1573.593362	K	L	5834	5848
PSM	TAKPFPGSVNQPATPFSPTR	969	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	17-UNIMOD:21	ms_run[1]:scan=14282	74.96692333333333	3	2179.038376	2179.046320	R	N	588	608
PSM	QKTPPPVAPKPAVK	970	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5989	32.126268333333336	3	1519.8150	1519.8158	K	S	753	767
PSM	QKTPPPVAPKPAVK	971	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5789	31.119251666666667	3	1519.8150	1519.8158	K	S	753	767
PSM	FEDEDSDDVPR	972	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=6521	34.83038333333333	2	1322.526591	1322.526254	K	K	698	709
PSM	QEASTGQSPEDHASLAPPLSPDHSSLEAK	973	sp|P48681|NEST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,24-UNIMOD:21	ms_run[1]:scan=13738	71.96558833333333	3	3048.3334	3048.3344	R	D	452	481
PSM	LRSSVPGVR	974	sp|P08670|VIME_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=5042	27.452321666666666	2	1049.538258	1049.538294	R	L	70	79
PSM	QAPFRSPTAPSVFSPTGNR	975	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,6-UNIMOD:21	ms_run[1]:scan=17062	91.06625166666667	2	2078.9565	2078.9570	K	T	220	239
PSM	STAQQELDGKPASPTPVIVASHTANK	976	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:21	ms_run[1]:scan=11076	57.85876333333333	3	2727.313858	2726.327640	R	E	847	873
PSM	ASASRPQPAPADGAD	977	sp|P11274|BCR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23		ms_run[1]:scan=1801	11.265368333333333	2	1409.6537	1409.6530	R	P	92	107
PSM	GLLAQGLRPESPPPAGPLLNGAPAGESPQPK	978	sp|Q96TA1|NIBL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:21	ms_run[1]:scan=18096	97.67140166666667	3	3096.564071	3095.580500	R	A	655	686
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	979	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:21	ms_run[1]:scan=4402	24.36925666666667	3	2541.175851	2540.190812	R	E	7	32
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	980	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:21	ms_run[1]:scan=4517	24.902035	3	2541.176083	2540.190812	R	E	7	32
PSM	PLEGSSSEDSPPEGQAPPSHSPR	981	sp|Q12789|TF3C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	21-UNIMOD:21	ms_run[1]:scan=5775	31.046168333333334	3	2424.019028	2424.023078	R	G	1836	1859
PSM	KAPDADDQDVK	982	sp|Q96NB3|ZN830_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=943	7.267893333333333	3	1200.561335	1200.562246	R	R	104	115
PSM	AEEQQLPPPLSPPSPSTPNHR	983	sp|Q6WCQ1|MPRIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:21	ms_run[1]:scan=12088	63.15811333333333	3	2358.100121	2358.100540	K	R	279	300
PSM	SPGHMVILDQTK	984	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	1-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=6287	33.633109999999995	2	1421.653981	1420.642167	K	G	553	565
PSM	TLSDPPSPLPHGPPNK	985	sp|Q9ULH1|ASAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:21	ms_run[1]:scan=10205	53.48153333333334	2	1733.818387	1732.818552	R	G	837	853
PSM	HYFSIVPGNVSSSPR	986	sp|Q9NVH2|INT7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:21	ms_run[1]:scan=14876	78.22768	2	1725.784960	1725.787586	K	S	326	341
PSM	GLVHAAGPGQDSGSQAGSPPTR	987	sp|Q96ER9|CCD51_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	18-UNIMOD:21	ms_run[1]:scan=5907	31.691326666666665	3	2126.959712	2125.954210	R	D	271	293
PSM	CHDGPQHCSSPSVTPPFGSLR	988	sp|Q8IZW8|TENS4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4,8-UNIMOD:4,10-UNIMOD:21	ms_run[1]:scan=14622	76.84330166666668	3	2384.9656	2384.9662	R	S	160	181
PSM	RGSIGENQVEVMVEEK	989	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=10321	54.06197333333333	3	1900.873275	1898.844509	K	T	200	216
PSM	RSPSPAPPPR	990	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:21	ms_run[1]:scan=1469	9.648719999999999	2	1140.543762	1140.544108	R	R	559	569
PSM	RSLPALALSLRPSPR	991	sp|Q9HAV7|GRPE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	2-UNIMOD:21,9-UNIMOD:21,13-UNIMOD:21	ms_run[1]:scan=14093	73.95052666666668	3	1871.842925	1872.877751	R	L	11	26
PSM	IDASKNEEDEGHSNSSPR	992	sp|Q14103|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:21	ms_run[1]:scan=1249	8.63365	2	2051.805615	2050.822921	K	H	68	86
PSM	KEIQNGNLHESDSESVPR	993	sp|Q86UP2|KTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:21	ms_run[1]:scan=6370	34.07244333333333	3	2118.921090	2117.937892	K	D	65	83
PSM	SRSTTELDDYSTNKNGNNK	994	sp|Q8WWI1|LMO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=4982	27.164170000000002	3	2224.914846	2222.944099	K	Y	1421	1440
PSM	STAQQELDGKPASPTPVIVASHTANK	995	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:21	ms_run[1]:scan=13320	69.68026666666667	3	2725.319816	2726.327640	R	E	847	873
PSM	EAATLEVERPLPMEVEKNSTPSEPGSGR	996	sp|P51858|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:35,19-UNIMOD:21	ms_run[1]:scan=12394	64.78475	3	3106.414902	3105.432576	K	G	181	209
PSM	AASPPRPLLSNASATPVGR	997	sp|Q9NQW6-2|ANLN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=11839	61.827	3	1940.9833	1940.9833	K	R	180	199
PSM	AEEQQLPPPLSPPSPSTPNHR	998	sp|Q6WCQ1-3|MPRIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:21	ms_run[2]:scan=12675	66.208	3	2358.1005	2358.1005	K	R	279	300
PSM	AEEQQLPPPLSPPSPSTPNHR	999	sp|Q6WCQ1-3|MPRIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:21	ms_run[2]:scan=13242	69.251	3	2358.1005	2358.1005	K	R	279	300
PSM	AGDKDDITEPAVCALR	1000	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:4	ms_run[2]:scan=11286	58.977	3	1729.8305	1729.8305	R	H	445	461
PSM	AGDKDDITEPAVCALR	1001	sp|P14923|PLAK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:4	ms_run[2]:scan=11672	60.995	3	1729.8305	1729.8305	R	H	445	461
PSM	AGDLLEDSPK	1002	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=7940	41.992	2	1123.4798	1123.4798	R	R	151	161
PSM	ALEKEEEEEK	1003	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1151	8.1868	2	1232.5772	1232.5772	R	Q	560	570
PSM	ALLDFEDKDGDK	1004	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12130	63.404	2	1364.646	1364.6460	K	V	125	137
PSM	ALVHQLSNESR	1005	sp|Q9H4L5-6|OSBL3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=6371	34.076	2	1332.6187	1332.6187	R	L	400	411
PSM	AMVSPFHSPPSTPSSPGVR	1006	sp|Q6JBY9|CPZIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=11210	58.559	3	2032.9078	2032.9078	K	S	113	132
PSM	APEPHVEEDDDDELDSK	1007	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8018	42.409	3	1938.7967	1938.7967	K	L	5	22
PSM	APSPHVVQENLHSEVVEVCTSSTLK	1008	sp|O75592-2|MYCB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=16945	90.354	3	2826.3259	2826.3259	R	T	2918	2943
PSM	AQGEPVAGHESPKIPYEK	1009	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=8752	46.175	3	2015.9354	2015.9354	R	Q	522	540
PSM	AQGEPVAGHESPKIPYEK	1010	sp|O94979-7|SC31A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=8806	46.431	2	2015.9354	2015.9354	R	Q	522	540
PSM	CCAAADPHECYAK	1011	sp|P02768-2|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,2-UNIMOD:4,10-UNIMOD:4	ms_run[2]:scan=2659	15.605	2	1551.5905	1551.5905	K	V	192	205
PSM	CVPAPGAGASGGTSPSATQPNPAVFIFEHK	1012	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=19782	109	3	3031.3899	3031.3899	R	A	93	123
PSM	DDDDVVIGK	1013	sp|O15144|ARPC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5681	30.618	2	974.45566	974.4557	K	V	171	180
PSM	DEDDADYKPK	1014	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1578	10.14	2	1194.5041	1194.5041	R	K	141	151
PSM	DKAPVQPQQSPAAAPGGTDEKPSGK	1015	sp|Q13200|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=3680	20.637	3	2540.1908	2540.1908	R	E	7	32
PSM	DKDDDEVFEK	1016	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4792	26.242	2	1238.5303	1238.5303	K	K	658	668
PSM	DKDDDEVFEK	1017	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5423	29.365	2	1238.5303	1238.5303	K	K	658	668
PSM	DKSPVREPIDNLTPEER	1018	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10750	56.243	3	2073.9732	2073.9732	K	D	134	151
PSM	DKSPVREPIDNLTPEER	1019	sp|Q14498-2|RBM39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12993	67.898	3	2073.9732	2073.9732	K	D	134	151
PSM	DLDEEGSEKELHENVLDK	1020	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=10758	56.284	3	2177.9366	2177.9366	K	E	573	591
PSM	DLTHSDSESSLHMSDR	1021	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=3802	21.229	3	1911.7306	1911.7306	R	Q	515	531
PSM	DLTHSDSESSLHMSDR	1022	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=7416	39.344	2	1895.7357	1895.7357	R	Q	515	531
PSM	DNSPPPAFKPEPPK	1023	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8725	46.022	2	1599.7334	1599.7334	R	A	961	975
PSM	DVDDGSGSPHSPHQLSSK	1024	sp|Q9H4A3-4|WNK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=3120	17.946	3	1928.7902	1928.7902	R	S	1615	1633
PSM	DVQVTDCKSPEDSRPPK	1025	sp|Q9HCG7-2|GBA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=4859	26.57	3	2036.8874	2036.8874	K	E	39	56
PSM	EAIEGTYIDKK	1026	sp|P62280|RS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6211	33.226	2	1265.6503	1265.6503	K	C	49	60
PSM	EDALDDSVSSSSVHASPLASSPVRK	1027	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	21-UNIMOD:21	ms_run[2]:scan=11983	62.594	3	2620.2018	2620.2018	R	N	2231	2256
PSM	EDLDDAFKDDR	1028	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10406	54.463	2	1337.5735	1337.5735	K	F	283	294
PSM	EEEGTGVVHQAPYFGAEDYR	1029	sp|P41252|SYIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13507	70.703	3	2252.9974	2252.9974	K	V	315	335
PSM	EEEIHIYQFPECDSDEDEDFKR	1030	sp|Q8WYJ6|SEPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=16703	88.856	3	2909.1375	2909.1375	K	Q	193	215
PSM	EEKDELGEQVLGLK	1031	sp|O75150-3|BRE1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14554	76.454	2	1585.8199	1585.8199	R	S	805	819
PSM	EFLEDYDDDRDDPK	1032	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10825	56.597	2	1770.7221	1770.7221	K	Y	498	512
PSM	EGPASTGSKLTIQEHLYPAPSSPEK	1033	sp|Q5VUB5|F1711_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=13625	71.373	3	2703.2793	2703.2793	R	E	504	529
PSM	EKTESELKFEEDER	1034	sp|O94854-2|K0754_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=7386	39.205	2	1847.7826	1847.7826	R	W	177	191
PSM	ELEAENYHDIK	1035	sp|Q01082|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7093	37.761	2	1359.6307	1359.6307	R	R	487	498
PSM	ERTEEPMETEPK	1036	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35	ms_run[2]:scan=1486	9.7163	2	1490.6559	1490.6559	K	G	1625	1637
PSM	EVDGEGKPYYEVR	1037	sp|Q9NY33-4|DPP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7435	39.446	2	1539.7205	1539.7205	K	L	173	186
PSM	FEEEIKAEQEER	1038	sp|Q96C19|EFHD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6476	34.583	3	1535.7104	1535.7104	R	K	207	219
PSM	FNSLPRPDPEPVPPVGSK	1039	sp|A1L390-2|PKHG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13477	70.546	2	2011.9768	2011.9768	R	R	290	308
PSM	GGSLDPSHSSGRGSAEAAEDDEIR	1040	sp|Q96JQ0|PCD16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:21	ms_run[2]:scan=7121	37.894	3	2479.0249	2479.0249	R	M	3022	3046
PSM	GHASAPYFGKEEPSVAPSSTGK	1041	sp|Q8N183|NDUF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=10058	52.721	3	2283.0209	2283.0209	K	T	131	153
PSM	GHYEVTGSDDETGK	1042	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2549	15.073	2	1493.627	1493.6270	K	L	5834	5848
PSM	GILSLPHQASPVSR	1043	sp|O75925|PIAS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=13417	70.226	2	1540.7763	1540.7763	K	T	494	508
PSM	GKEESLDSDLYAELR	1044	sp|P02775|CXCL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15987	84.625	3	1723.8265	1723.8265	K	C	48	63
PSM	GKPIFPVYPLVGSSSPTR	1045	sp|A6NEL2|SWAHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=19036	103.93	3	1981.0074	1981.0074	R	K	728	746
PSM	GPKPEPPGSGSPAPPR	1046	sp|Q9UKJ3-2|GPTC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=4064	22.601	3	1606.7505	1606.7505	R	R	652	668
PSM	GRLSPVPVPR	1047	sp|Q9UKM9-2|RALY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=9768	51.234	2	1156.6118	1156.6118	R	A	116	126
PSM	HDEDEDDSLK	1048	sp|O94915|FRYL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1404	9.3487	2	1201.4735	1201.4735	R	D	1330	1340
PSM	HGSLGFLPR	1049	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13146	68.712	2	1062.5012	1062.5012	R	K	11	20
PSM	HGSLGFLPR	1050	sp|P39023|RL3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13328	69.728	2	1062.5012	1062.5012	R	K	11	20
PSM	HLMEQSSPGFR	1051	sp|Q5SXH7-4|PKHS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=4646	25.528	2	1383.5643	1383.5643	K	Q	185	196
PSM	HPPVLTPPDQEVIR	1052	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=13040	68.162	3	1676.8287	1676.8287	R	N	636	650
PSM	HTSCSSAGNDSKPVQEAPSVAR	1053	sp|Q9P246|STIM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=4541	25.013	3	2364.0166	2364.0166	R	I	695	717
PSM	HVIGLQMGSNR	1054	sp|Q01995|TAGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=9336	49.072	2	1290.5904	1290.5904	K	G	173	184
PSM	HVTLGPGQSPLSR	1055	sp|O15061|SYNEM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=8525	44.931	2	1427.6922	1427.6922	R	E	1173	1186
PSM	IDASKNEEDEGHSNSSPR	1056	sp|Q14103-3|HNRPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21	ms_run[2]:scan=950	7.2987	3	2050.8229	2050.8229	K	H	68	86
PSM	IDGDKDGFVTVDELK	1057	sp|O43852|CALU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13983	73.346	2	1649.8148	1649.8148	K	D	80	95
PSM	IEDVGSDEEDDSGKDKK	1058	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=1863	11.587	2	1944.7837	1944.7837	K	K	250	267
PSM	IERPGEGSPMVDNPMR	1059	sp|Q96T88|UHRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21,10-UNIMOD:35,15-UNIMOD:35	ms_run[2]:scan=5595	30.203	3	1895.7907	1895.7907	K	R	280	296
PSM	IRLDETDDPDDYGDR	1060	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9526	50.059	3	1793.7704	1793.7704	K	E	399	414
PSM	IRPLEVPTTAGPASASTPTDGAK	1061	sp|Q9ULL5-2|PRR12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=12353	64.59	3	2316.1363	2316.1363	R	K	355	378
PSM	ISESVLRDSPPPHEDYEDEVFVR	1062	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=16410	87.114	3	2794.2487	2794.2487	R	D	1489	1512
PSM	IYEDGDDDMKR	1063	sp|Q9HB71-3|CYBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3461	19.514	2	1355.5663	1355.5663	K	T	155	166
PSM	KAEGEPQEESPLKSK	1064	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=2738	16.037	3	1735.803	1735.8030	K	S	166	181
PSM	KASGPPVSELITK	1065	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=11765	61.453	3	1405.7218	1405.7218	R	A	34	47
PSM	KDASDDLDDLNFFNQK	1066	sp|P20042|IF2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=18796	102.25	3	1883.8537	1883.8537	K	K	64	80
PSM	KDDTDDEIAK	1067	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1328	9.0022	2	1148.5197	1148.5197	K	Y	90	100
PSM	KETPPPLVPPAAR	1068	sp|Q9BQA1-2|MEP50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=9654	50.685	2	1451.7538	1451.7538	R	E	3	16
PSM	KGAASPVLQEDHCDSLPSVLQVEEK	1069	sp|Q8N9B5-2|JMY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=16578	88.131	3	2815.3099	2815.3099	R	T	709	734
PSM	KGDEVDGVDEVAK	1070	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5220	28.377	3	1359.6518	1359.6518	R	K	209	222
PSM	KMEDSVGCLETAEEVK	1071	sp|P35579|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=9689	50.853	3	1839.823	1839.8230	K	R	1372	1388
PSM	KMPLDLSPLATPIIR	1072	sp|P15336-3|ATF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=19793	109.07	2	1759.9307	1759.9307	K	S	106	121
PSM	KPEDVLDDDDAGSAPLK	1073	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9615	50.482	3	1783.8476	1783.8476	R	S	141	158
PSM	KPEYDLEEDDQEVLK	1074	sp|Q13416|ORC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12309	64.36	3	1848.8629	1848.8629	K	D	52	67
PSM	KPSVGVPPPASPSYPR	1075	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10072	52.796	3	1714.8444	1714.8444	R	A	980	996
PSM	KPSVGVPPPASPSYPR	1076	sp|Q9P206-3|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10270	53.806	3	1714.8444	1714.8444	R	A	980	996
PSM	KRESESESDETPPAAPQLIK	1077	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=11024	57.586	3	2371.0346	2371.0346	R	K	448	468
PSM	KSPSGPVKSPPLSPVGTTPVK	1078	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=10180	53.356	3	2219.1004	2219.1004	R	L	177	198
PSM	KTLDAEVVEKPAK	1079	sp|Q9H3P2|NELFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=5699	30.698	3	1506.7695	1506.7695	R	E	276	289
PSM	KTSDANETEDHLESLICK	1080	sp|Q09161|NCBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=15555	82.077	3	2168.9297	2168.9297	R	V	20	38
PSM	KVEEEGSPGDPDHEASTQGR	1081	sp|Q9NZT2-2|OGFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=2439	14.524	3	2203.9019	2203.9019	R	T	309	329
PSM	LASDDRPSPPR	1082	sp|P98175-2|RBM10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=3776	21.101	2	1289.5765	1289.5765	K	G	715	726
PSM	LGSTGSQPNSEAESVPENVPKPPLLPPK	1083	sp|Q8IZ21-3|PHAR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=16476	87.526	3	2948.4532	2948.4532	R	R	129	157
PSM	LKEPGPPLASSQGGSPAPSPAGCGGK	1084	sp|Q68DK7|MSL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21,23-UNIMOD:4	ms_run[2]:scan=9290	48.818	3	2483.1516	2483.1516	K	G	52	78
PSM	LKPGGVGAPSSSSPSPSPSAR	1085	sp|Q92797|SYMPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21	ms_run[2]:scan=6121	32.77	3	2001.9521	2001.9521	K	P	1159	1180
PSM	LPLVPESPRR	1086	sp|Q86WB0-2|NIPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=10098	52.933	2	1242.6486	1242.6486	R	M	294	304
PSM	LPSVEEAEVPKPLPPASK	1087	sp|O00515|LAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13819	72.411	3	1967.0017	1967.0017	R	D	62	80
PSM	LPTTDGAHPQPISPIPGGVSSSGLSR	1088	sp|Q96AP7|ESAM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	20-UNIMOD:21	ms_run[2]:scan=15149	79.777	3	2607.2694	2607.2694	R	M	347	373
PSM	LSGGHSLHETSTVLVETVTK	1089	sp|Q14315-2|FLNC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=15517	81.855	3	2174.062	2174.0620	R	S	2564	2584
PSM	LVPNPDQKDSDGDGR	1090	sp|P07996-2|TSP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3257	18.565	2	1611.7489	1611.7489	R	G	827	842
PSM	LYDLDKDEK	1091	sp|Q99653|CHP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5747	30.925	2	1137.5554	1137.5554	R	I	121	130
PSM	MDRTPPPPTLSPAAITVGR	1092	sp|Q8NDX5-2|PHC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=14175	74.398	3	2072.0126	2072.0126	R	G	587	606
PSM	MDRTPPPPTLSPAAITVGR	1093	sp|Q8NDX5-2|PHC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=14364	75.401	3	2072.0126	2072.0126	R	G	587	606
PSM	MFGGPGTASRPSSSR	1094	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=3926	21.881	2	1589.6658	1589.6658	R	S	14	29
PSM	MPSLKSPLLPCPATK	1095	sp|Q9H2Y7|ZN106_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,6-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=13186	68.93	2	1734.845	1734.8450	K	S	447	462
PSM	NHLLQFALESPAK	1096	sp|Q9NS91|RAD18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=16642	88.514	2	1546.7545	1546.7545	R	S	90	103
PSM	PFSSPSMSPSHGMNIHNLASGK	1097	sp|Q96S59-2|RANB9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,6-UNIMOD:21,7-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=9143	48.128	3	2473.9797	2473.9797	R	G	139	161
PSM	PGPQALPKPASPK	1098	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=5895	31.638	2	1366.701	1366.7010	K	K	2654	2667
PSM	PGTPSDHQSQEASQFER	1099	sp|Q6Y7W6-4|GGYF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=6054	32.451	3	1979.8011	1979.8011	R	K	374	391
PSM	PKPSSSPVIFAGGQDR	1100	sp|Q15366-6|PCBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=9235	48.556	2	1721.8138	1721.8138	R	Y	180	196
PSM	PLRSPLDNMIR	1101	sp|P41212|ETV6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=8959	47.232	3	1406.6741	1406.6741	R	R	200	211
PSM	QAPFRSPTAPSVFSPTGNR	1102	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=14407	75.64	3	2095.9841	2095.9841	K	T	220	239
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1103	sp|P54727-2|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	22-UNIMOD:21	ms_run[2]:scan=5246	28.483	3	3024.3561	3024.3561	K	S	73	102
PSM	QRSPSPAPAPAPAAAAGPPTR	1104	sp|Q9H7N4|SFR19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=6107	32.714	3	2047	2047.0000	R	K	496	517
PSM	QRSPSPAPAPAPAAAAGPPTR	1105	sp|Q9H7N4|SFR19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=6146	32.888	2	2047	2047.0000	R	K	496	517
PSM	RAAEDDEDDDVDTK	1106	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2028	12.429	3	1592.6438	1592.6438	K	K	89	103
PSM	RASGQAFELILSPR	1107	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=17560	94.237	3	1623.8134	1623.8134	K	S	14	28
PSM	RASGQAFELILSPR	1108	sp|P16949|STMN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=17588	94.417	2	1623.8134	1623.8134	K	S	14	28
PSM	RASLSDIGFGK	1109	sp|Q07002|CDK18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12555	65.59	2	1229.5806	1229.5806	R	L	130	141
PSM	RFIQELSGSSPK	1110	sp|Q01664|TFAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=9729	51.054	2	1427.681	1427.6810	K	R	115	127
PSM	RGSIGENQIK	1111	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=3451	19.463	2	1180.5602	1180.5602	K	D	194	204
PSM	RGSPTTGFIEQK	1112	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=7296	38.767	2	1399.6497	1399.6497	R	G	890	902
PSM	RLSPSASPPR	1113	sp|Q8IYB3-2|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=3781	21.123	3	1146.5547	1146.5547	R	R	386	396
PSM	RNALFPEVFSPTPDENSDQNSR	1114	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=18710	101.65	3	2599.134	2599.1340	R	S	566	588
PSM	RNSCNVGGGGGGFK	1115	sp|Q7L2J0|MEPCE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=3128	17.975	2	1445.5871	1445.5871	R	H	150	164
PSM	RPLPVESPDTQR	1116	sp|P57682|KLF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=6221	33.273	3	1473.6977	1473.6977	K	K	244	256
PSM	RPLSIQDSFVEVSPVCPR	1117	sp|Q9NPR2|SEM4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21,16-UNIMOD:4	ms_run[2]:scan=17373	93.052	3	2165.034	2165.0340	K	P	801	819
PSM	RPSALPPK	1118	sp|Q8N4B1-2|SESQ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2994	17.309	2	944.48447	944.4845	R	E	54	62
PSM	RPSPQPSPR	1119	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=993	7.4904	2	1100.5128	1100.5128	R	D	2700	2709
PSM	RPSVNGEPGSVPPPR	1120	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=6138	32.847	3	1624.7723	1624.7723	R	A	1255	1270
PSM	RSSPPPPPSGSSSR	1121	sp|Q5VUA4|ZN318_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1316	8.9447	2	1474.6566	1474.6566	R	T	38	52
PSM	RTSPSSLPGR	1122	sp|Q5SNT2|TM201_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2808	16.403	2	1136.5339	1136.5339	R	L	439	449
PSM	RVSEVEEEKEPVPQPLPSDDTR	1123	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10795	56.449	2	2615.2116	2615.2116	R	V	446	468
PSM	SDGSLEDGDDVHR	1124	sp|Q9NRX5|SERC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3124	17.961	3	1400.5804	1400.5804	R	A	361	374
PSM	SEFGSVDGPLPHPR	1125	sp|Q5JRA6-2|TGO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=13367	69.947	2	1573.6926	1573.6926	R	W	1643	1657
PSM	SEHTAPPPEEPTDKSPEAEDPLGVER	1126	sp|Q96KM6|Z512B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21	ms_run[2]:scan=10862	56.799	3	2893.2655	2893.2655	R	T	651	677
PSM	SIQEIQELDKDDESLR	1127	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14090	73.941	3	1916.9327	1916.9327	K	K	34	50
PSM	SIQEIQELDKDDESLR	1128	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14191	74.475	2	1916.9327	1916.9327	K	K	34	50
PSM	SRSTTELDDYSTNK	1129	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=6074	32.543	2	1695.6989	1695.6989	K	N	1087	1101
PSM	SRTASGSSVTSLDGTR	1130	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=5839	31.377	2	1660.7418	1660.7418	R	S	245	261
PSM	TAKPFPGSVNQPATPFSPTR	1131	sp|Q9UMS6-5|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=13724	71.879	3	2179.0463	2179.0463	R	N	193	213
PSM	TDEERPPVEHSPEK	1132	sp|Q15170-2|TCAL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=2370	14.189	2	1728.7356	1728.7356	K	Q	18	32
PSM	THTTALAGRSPSPASGR	1133	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2928	17.002	2	1825.7873	1825.7873	K	R	286	303
PSM	THTTALAGRSPSPASGR	1134	sp|Q9UQ35|SRRM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2940	17.054	3	1825.7873	1825.7873	K	R	286	303
PSM	TPRPASPGPSLPAR	1135	sp|Q8IY33|MILK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=6380	34.124	2	1482.7344	1482.7344	R	S	644	658
PSM	TRSPSPTLGESLAPHK	1136	sp|Q86UU1-3|PHLB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=9468	49.742	3	1836.8172	1836.8172	R	G	516	532
PSM	VAEIEHAEK	1137	sp|P78371-2|TCPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1647	10.52	2	1024.5189	1024.5189	K	E	217	226
PSM	VELSPGPPKPAGR	1138	sp|Q8IZ73-2|RUSD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=6584	35.149	2	1383.6912	1383.6912	K	E	65	78
PSM	VFDEFKPLVEEPQNLIK	1139	sp|P02768-2|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=20508	114.08	3	2044.0881	2044.0881	K	Q	205	222
PSM	VKDEFSDLSEGDVLSEDENDKK	1140	sp|Q8N554-2|ZN276_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=14755	77.573	3	2577.1007	2577.1007	R	Q	277	299
PSM	VKEEPPSPPQSPR	1141	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=5389	29.166	2	1526.713	1526.7130	R	V	297	310
PSM	VLHSSNPVPLYAPNLSPPADSR	1142	sp|Q92610|ZN592_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=16233	86.064	3	2410.1682	2410.1682	K	I	558	580
PSM	VPPAPVPCPPPSPGPSAVPSSPK	1143	sp|O95817|BAG3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4,16-UNIMOD:21	ms_run[2]:scan=12937	67.602	3	2298.112	2298.1120	K	S	366	389
PSM	YFQINQDEEEEEDED	1144	sp|P35268|RL22_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12863	67.217	2	1930.7228	1930.7228	R	-	114	129
PSM	YKPESEELTAER	1145	sp|P07237|PDIA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=5904	31.68	2	1450.694	1450.6940	K	I	327	339
PSM	YRPGTVALR	1146	sp|Q6NXT2|H3C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=7035	37.508	2	1111.5539	1111.5539	R	E	41	50
PSM	YSPSQNSPIHHIPSR	1147	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=8144	43.037	2	1878.7815	1878.7815	R	R	282	297
PSM	YSPSQNSPIHHIPSR	1148	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=8341	44.045	2	1878.7815	1878.7815	R	R	282	297
PSM	QKTPPPVAPKPAVK	1149	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5851	31.431795	2	1519.8157	1519.8158	K	S	753	767
PSM	QAPFRSPTAPSVFSPTGNR	1150	sp|Q9H3P2|NELFA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,8-UNIMOD:21	ms_run[1]:scan=17056	91.03590166666667	3	2078.9584	2078.9570	K	T	220	239
PSM	KASGPPVSELITK	1151	sp|P16403|H12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=11795	61.61129833333333	2	1405.722389	1405.721798	R	A	34	47
PSM	QQQLEEEAAKPPEPEKPVSPPPVEQK	1152	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,19-UNIMOD:21	ms_run[1]:scan=13071	68.3151	3	2971.4219	2971.4211	K	H	206	232
PSM	AMVSPFHSPPSTPSSPGVR	1153	sp|Q6JBY9|CPZIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:35,14-UNIMOD:21	ms_run[1]:scan=10776	56.36328833333333	3	2033.914286	2032.907778	K	S	113	132
PSM	AMVSPFHSPPSTPSSPGVR	1154	sp|Q6JBY9|CPZIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=10899	56.9827	3	2032.908468	2032.907778	K	S	113	132
PSM	KDVDEAYMNK	1155	sp|P05787|K2C8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:35	ms_run[1]:scan=1604	10.270246666666665	3	1227.543143	1227.544154	K	V	198	208
PSM	KDDESNLVEEK	1156	sp|Q07866|KLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=3488	19.659556666666667	2	1304.605570	1304.609590	K	S	58	69
PSM	PLNGLGPPSTPLDHR	1157	sp|Q9NPR2|SEM4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:21	ms_run[1]:scan=12012	62.750151666666675	3	1650.775914	1649.792671	R	G	766	781
PSM	GRLSPVPVPR	1158	sp|Q9UKM9|RALY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:21	ms_run[1]:scan=14881	78.25056	2	1156.611650	1156.611794	R	A	132	142
PSM	TRDDGDEEGLLTHSEEELEHSQDTDADDGALQ	1159	sp|Q9UKM9|RALY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	14-UNIMOD:21	ms_run[1]:scan=14267	74.88413333333334	3	3608.443126	3606.439113	R	-	275	307
PSM	FYDADDYHPEENR	1160	sp|Q5T6J7|GNTK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=8464	44.64477166666667	3	1670.649985	1669.664479	K	R	32	45
PSM	KDTDDIESPK	1161	sp|Q9UPQ0|LIMC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1855	11.53807	2	1146.532159	1146.540448	R	R	162	172
PSM	RVSEVEEEKEPVPQPLPSDDTR	1162	sp|O43290|SNUT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=11399	59.575381666666665	3	2616.195257	2615.211607	R	V	446	468
PSM	FSDEEDGRDSDEEGAEGHR	1163	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:21	ms_run[1]:scan=3085	17.79334	3	2216.796205	2215.792743	K	D	341	360
PSM	KPAPLPSPGLNSAAK	1164	sp|Q9C0K0|BC11B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:21	ms_run[1]:scan=9412	49.45118	2	1526.785902	1526.785795	R	R	672	687
PSM	GGPTSHPSPVPPPASSPSPLSGSALCGGK	1165	sp|P49848|TAF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	18-UNIMOD:21,26-UNIMOD:4	ms_run[1]:scan=12870	67.25133833333334	3	2761.271957	2762.273496	K	Q	619	648
PSM	RPSVNGEPGSVPPPR	1166	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=6332	33.864628333333336	3	1625.758148	1624.772270	R	A	1255	1270
PSM	RPSVNGEPGSVPPPR	1167	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=6531	34.87913333333333	3	1625.755935	1624.772270	R	A	1255	1270
PSM	VPEPPSSHSQGSGPSSGSPER	1168	sp|Q8N137|CNTRB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	18-UNIMOD:21	ms_run[1]:scan=3924	21.869229999999998	2	2142.905187	2141.901506	R	G	773	794
PSM	KLLLDPSSPPTK	1169	sp|Q6IAA8|LTOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:21	ms_run[1]:scan=11847	61.86539666666667	2	1374.716331	1374.715984	R	A	20	32
PSM	KDDSDDDGGGWITPSNIK	1170	sp|Q9ULX3|NOB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=12751	66.605845	2	1919.856801	1918.854465	R	Q	198	216
PSM	SGGSGHAVAEPASPEQELDQNKGK	1171	sp|P46013|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:21	ms_run[1]:scan=7443	39.483045000000004	3	2472.092576	2472.091826	K	G	296	320
PSM	RNSVERPAEPVAGAATPSLVEQQK	1172	sp|Q9BTC0|DIDO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=11220	58.608583333333335	3	2614.286244	2613.291195	R	M	1454	1478
PSM	GRLSPVPVPR	1173	sp|Q9UKM9|RALY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:21	ms_run[1]:scan=10761	56.29841999999999	2	1157.595073	1156.611794	R	A	132	142
PSM	APEPHVEEDDDDELDSK	1174	sp|P52566|GDIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=9776	51.27044166666667	3	1938.758189	1938.796675	K	L	5	22
PSM	YRANASREALR	1175	sp|Q9H2A9|CHST8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:21	ms_run[1]:scan=4013	22.323903333333334	2	1385.653506	1385.656512	R	T	291	302
PSM	MFGGPGTASRPSSSR	1176	sp|P08670|VIME_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:35,12-UNIMOD:21	ms_run[1]:scan=4120	22.89004333333333	2	1588.661386	1589.665756	R	S	14	29
PSM	RAAEDDEDDDVDTK	1177	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1122	8.065508333333334	2	1592.642499	1592.643804	K	K	90	104
PSM	AKATSSATTAAAPTLR	1178	sp|Q8N9M1|CS047_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=13040	68.16173166666667	3	1676.747024	1676.753582	K	R	315	331
PSM	AHFNAMFQPSSPTR	1179	sp|Q8WUA4|TF3C2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:35,11-UNIMOD:21	ms_run[1]:scan=9727	51.042334999999994	2	1686.686251	1685.702142	R	R	883	897
PSM	SSTATSMDPLSTEDFKPPR	1180	sp|A1L4H1|SRCRL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=10252	53.71320166666667	2	2224.877244	2225.895297	R	S	1396	1415
PSM	GDHASLENEKPGTGDVCSAPAGR	1181	sp|Q14699|RFTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=6363	34.03669	3	2404.997633	2404.011467	R	N	195	218
PSM	STAQQELDGKPASPTPVIVASHTANK	1182	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	15-UNIMOD:21	ms_run[1]:scan=8859	46.69099	3	2726.327379	2726.327640	R	E	847	873
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1183	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	16-UNIMOD:21	ms_run[1]:scan=6430	34.36798833333334	3	3023.340247	3024.356099	K	S	145	174
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	1184	sp|P54727|RD23B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	16-UNIMOD:21	ms_run[1]:scan=5504	29.748406666666664	3	3023.348912	3024.356099	K	S	145	174