MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_NT_JPST000210
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\121102_CRC_T_Fr16.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\121102_CRC_T_Fr16.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42.0	null	719-UNIMOD:21	0.02	42.0	3	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	41.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	41.0	28	1	0
PRT	sp|Q86VM9-2|ZCH18_HUMAN	Isoform 2 of Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null		0.03	39.0	1	1	1
PRT	sp|Q9Y6J9|TAF6L_HUMAN	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens OX=9606 GN=TAF6L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	39.0	null	485-UNIMOD:35,501-UNIMOD:21	0.03	39.0	3	1	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	39.0	null	2718-UNIMOD:21,2716-UNIMOD:28	0.02	39.0	3	2	1
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	332-UNIMOD:21,328-UNIMOD:21	0.05	39.0	3	1	0
PRT	sp|Q96ST2|IWS1_HUMAN	Protein IWS1 homolog OS=Homo sapiens OX=9606 GN=IWS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	237-UNIMOD:21,198-UNIMOD:21,235-UNIMOD:21	0.06	38.0	7	2	0
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	155-UNIMOD:21,165-UNIMOD:21	0.07	38.0	3	1	0
PRT	sp|Q13905-2|RPGF1_HUMAN	Isoform Short of Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	296-UNIMOD:21,183-UNIMOD:21	0.04	38.0	3	2	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.15	36.0	5	3	1
PRT	sp|Q9BUJ2-3|HNRL1_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	604-UNIMOD:21	0.04	36.0	2	1	0
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	23-UNIMOD:21,21-UNIMOD:21	0.02	36.0	2	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21	0.09	36.0	7	2	1
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.07	36.0	2	1	0
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	21-UNIMOD:21	0.12	36.0	3	2	1
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	36.0	null	373-UNIMOD:21	0.02	36.0	5	1	0
PRT	sp|Q9Y5P4-2|C43BP_HUMAN	Isoform 2 of Collagen type IV alpha-3-binding protein OS=Homo sapiens OX=9606 GN=COL4A3BP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	132-UNIMOD:21,133-UNIMOD:35	0.04	36.0	1	1	1
PRT	sp|Q96NW4|ANR27_HUMAN	Ankyrin repeat domain-containing protein 27 OS=Homo sapiens OX=9606 GN=ANKRD27 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	1023-UNIMOD:21,962-UNIMOD:21	0.05	36.0	3	2	1
PRT	sp|Q9UKV3|ACINU_HUMAN	Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.01	36.0	1	1	1
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.21	36.0	2	2	2
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	246-UNIMOD:35	0.05	35.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	112-UNIMOD:21	0.07	35.0	1	1	1
PRT	sp|P55198|AF17_HUMAN	Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	382-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	214-UNIMOD:21	0.03	35.0	6	2	0
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	344-UNIMOD:21,240-UNIMOD:21,242-UNIMOD:21	0.06	35.0	6	2	0
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	35.0	null	362-UNIMOD:21,604-UNIMOD:21	0.05	35.0	7	2	0
PRT	sp|Q0ZGT2|NEXN_HUMAN	Nexilin OS=Homo sapiens OX=9606 GN=NEXN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	564-UNIMOD:21,566-UNIMOD:35	0.04	35.0	1	1	1
PRT	sp|Q7KZ85|SPT6H_HUMAN	Transcription elongation factor SPT6 OS=Homo sapiens OX=9606 GN=SUPT6H PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	124-UNIMOD:35,125-UNIMOD:21	0.01	35.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	109-UNIMOD:21,108-UNIMOD:21	0.02	34.0	7	1	0
PRT	sp|P49023-4|PAXI_HUMAN	Isoform 4 of Paxillin OS=Homo sapiens OX=9606 GN=PXN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	366-UNIMOD:21,368-UNIMOD:4,371-UNIMOD:4	0.04	34.0	2	1	0
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	266-UNIMOD:21	0.05	34.0	3	1	0
PRT	sp|Q92766-5|RREB1_HUMAN	Isoform 5 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1415-UNIMOD:21,1420-UNIMOD:35,175-UNIMOD:21	0.02	34.0	3	2	1
PRT	sp|Q6PI98|IN80C_HUMAN	INO80 complex subunit C OS=Homo sapiens OX=9606 GN=INO80C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	26-UNIMOD:21	0.10	34.0	1	1	1
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	2048-UNIMOD:21,1999-UNIMOD:21	0.02	34.0	6	2	1
PRT	sp|Q96T58|MINT_HUMAN	Msx2-interacting protein OS=Homo sapiens OX=9606 GN=SPEN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	1222-UNIMOD:21,1268-UNIMOD:21	0.01	34.0	6	2	1
PRT	sp|Q86UX7-2|URP2_HUMAN	Isoform 2 of Fermitin family homolog 3 OS=Homo sapiens OX=9606 GN=FERMT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	478-UNIMOD:21	0.05	34.0	1	1	1
PRT	sp|P46937-5|YAP1_HUMAN	Isoform 5 of Transcriptional coactivator YAP1 OS=Homo sapiens OX=9606 GN=YAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	127-UNIMOD:21	0.08	33.0	1	1	1
PRT	sp|P40692-2|MLH1_HUMAN	Isoform 2 of DNA mismatch repair protein Mlh1 OS=Homo sapiens OX=9606 GN=MLH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	236-UNIMOD:21,240-UNIMOD:35	0.03	33.0	4	1	0
PRT	sp|Q9Y2J4-3|AMOL2_HUMAN	Isoform 3 of Angiomotin-like protein 2 OS=Homo sapiens OX=9606 GN=AMOTL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	600-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	247-UNIMOD:21	0.08	33.0	1	1	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	43-UNIMOD:21	0.05	33.0	6	1	0
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	224-UNIMOD:21,222-UNIMOD:21	0.06	33.0	2	1	0
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	805-UNIMOD:21	0.01	33.0	2	1	0
PRT	sp|O95793-2|STAU1_HUMAN	Isoform Short of Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	197-UNIMOD:21,196-UNIMOD:21	0.05	33.0	2	1	0
PRT	sp|Q8N122|RPTOR_HUMAN	Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33.0	null	877-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|Q14677|EPN4_HUMAN	Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33.0	null	299-UNIMOD:21	0.05	33.0	1	1	0
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	417-UNIMOD:21,416-UNIMOD:21	0.06	32.0	3	1	0
PRT	sp|Q6PJ61|FBX46_HUMAN	F-box only protein 46 OS=Homo sapiens OX=9606 GN=FBXO46 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	338-UNIMOD:21	0.05	32.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.05	32.0	1	1	1
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	163-UNIMOD:21	0.03	32.0	2	1	0
PRT	sp|Q00688|FKBP3_HUMAN	Peptidyl-prolyl cis-trans isomerase FKBP3 OS=Homo sapiens OX=9606 GN=FKBP3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	34-UNIMOD:21	0.07	32.0	2	1	0
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	154-UNIMOD:21	0.06	32.0	3	2	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	436-UNIMOD:21	0.04	32.0	2	1	0
PRT	sp|Q92619|HMHA1_HUMAN	Rho GTPase-activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	951-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	596-UNIMOD:21,599-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q9BZ95-3|NSD3_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	456-UNIMOD:21	0.02	32.0	1	1	0
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	702-UNIMOD:21,704-UNIMOD:21	0.02	32.0	2	1	0
PRT	sp|P55201-4|BRPF1_HUMAN	Isoform 4 of Peregrin OS=Homo sapiens OX=9606 GN=BRPF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	462-UNIMOD:21	0.02	32.0	1	1	1
PRT	sp|Q7Z5Q1-7|CPEB2_HUMAN	Isoform 6 of Cytoplasmic polyadenylation element-binding protein 2 OS=Homo sapiens OX=9606 GN=CPEB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	67-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	928-UNIMOD:21,444-UNIMOD:21,320-UNIMOD:21	0.06	32.0	5	3	2
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	32.0	null	218-UNIMOD:21	0.06	32.0	2	2	2
PRT	sp|Q9BQ67|GRWD1_HUMAN	Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	10-UNIMOD:21,11-UNIMOD:4,17-UNIMOD:35	0.07	32.0	1	1	1
PRT	sp|Q00013|EM55_HUMAN	55 kDa erythrocyte membrane protein OS=Homo sapiens OX=9606 GN=MPP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	47-UNIMOD:35,57-UNIMOD:21	0.07	32.0	2	1	0
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	597-UNIMOD:35,608-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1943-UNIMOD:21	0.02	31.0	3	3	3
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	695-UNIMOD:21,688-UNIMOD:21	0.03	31.0	4	1	0
PRT	sp|P33316-2|DUT_HUMAN	Isoform 2 of Deoxyuridine 5'-triphosphate nucleotidohydrolase, mitochondrial OS=Homo sapiens OX=9606 GN=DUT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.10	31.0	2	1	0
PRT	sp|Q9NV58-2|RN19A_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF19A OS=Homo sapiens OX=9606 GN=RNF19A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	518-UNIMOD:21,522-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|O14497-3|ARI1A_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1505-UNIMOD:21	0.01	31.0	1	1	1
PRT	sp|Q8IXQ4-4|GPAM1_HUMAN	Isoform 4 of GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.14	31.0	4	1	0
PRT	sp|Q9ULC5-3|ACSL5_HUMAN	Isoform 2 of Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens OX=9606 GN=ACSL5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	28-UNIMOD:21	0.02	31.0	3	1	0
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	251-UNIMOD:21,257-UNIMOD:4,261-UNIMOD:21	0.06	31.0	3	1	0
PRT	sp|Q96QC0|PP1RA_HUMAN	Serine/threonine-protein phosphatase 1 regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PPP1R10 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	313-UNIMOD:21,315-UNIMOD:21	0.02	31.0	3	1	0
PRT	sp|P53814-2|SMTN_HUMAN	Isoform A of Smoothelin OS=Homo sapiens OX=9606 GN=SMTN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	67-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	510-UNIMOD:21,255-UNIMOD:21,266-UNIMOD:21,429-UNIMOD:21,283-UNIMOD:21,656-UNIMOD:21	0.09	31.0	7	5	4
PRT	sp|Q6N043-3|Z280D_HUMAN	Isoform 3 of Zinc finger protein 280D OS=Homo sapiens OX=9606 GN=ZNF280D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	104-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	2144-UNIMOD:21,2152-UNIMOD:4,2150-UNIMOD:21	0.01	31.0	5	1	0
PRT	sp|Q06787-2|FMR1_HUMAN	Isoform 1 of Synaptic functional regulator FMR1 OS=Homo sapiens OX=9606 GN=FMR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	479-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q9BZL6-2|KPCD2_HUMAN	Isoform 2 of Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	41-UNIMOD:21,40-UNIMOD:21,43-UNIMOD:21,88-UNIMOD:21	0.05	31.0	5	2	1
PRT	sp|P16157-10|ANK1_HUMAN	Isoform Er9 of Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1666-UNIMOD:21	0.01	31.0	1	1	0
PRT	sp|Q9H8G2|CAAP1_HUMAN	Caspase activity and apoptosis inhibitor 1 OS=Homo sapiens OX=9606 GN=CAAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	89-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	247-UNIMOD:21	0.05	31.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	11-UNIMOD:21,26-UNIMOD:35,13-UNIMOD:21,402-UNIMOD:21	0.08	31.0	3	2	1
PRT	sp|Q14814-6|MEF2D_HUMAN	Isoform MEF2D00 of Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	205-UNIMOD:21	0.05	31.0	2	1	0
PRT	sp|O60216|RAD21_HUMAN	Double-strand-break repair protein rad21 homolog OS=Homo sapiens OX=9606 GN=RAD21 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null		0.04	31.0	1	1	1
PRT	sp|Q8N1G0|ZN687_HUMAN	Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	31.0	null	223-UNIMOD:28,226-UNIMOD:4,242-UNIMOD:21,1057-UNIMOD:21	0.03	31.0	2	2	2
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null		0.12	31.0	2	2	2
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	626-UNIMOD:21,544-UNIMOD:21	0.05	30.0	9	2	0
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	104-UNIMOD:4,125-UNIMOD:21	0.12	30.0	11	1	0
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.06	30.0	2	1	0
PRT	sp|Q9Y6D5|BIG2_HUMAN	Brefeldin A-inhibited guanine nucleotide-exchange protein 2 OS=Homo sapiens OX=9606 GN=ARFGEF2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1511-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9Y4C1|KDM3A_HUMAN	Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	445-UNIMOD:21,264-UNIMOD:21	0.02	30.0	4	2	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	255-UNIMOD:21,226-UNIMOD:21	0.06	30.0	6	5	4
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	114-UNIMOD:21	0.04	30.0	2	1	0
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1384-UNIMOD:21,1419-UNIMOD:21	0.02	30.0	3	2	0
PRT	sp|Q16594|TAF9_HUMAN	Transcription initiation factor TFIID subunit 9 OS=Homo sapiens OX=9606 GN=TAF9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.07	30.0	1	1	1
PRT	sp|O14647-2|CHD2_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1365-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	211-UNIMOD:21	0.09	30.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	297-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	893-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|Q9Y6C2|EMIL1_HUMAN	EMILIN-1 OS=Homo sapiens OX=9606 GN=EMILIN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	1	1	1
PRT	sp|Q9BQI5-4|SGIP1_HUMAN	Isoform 4 of SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	294-UNIMOD:21	0.03	30.0	3	1	0
PRT	sp|Q8TF61|FBX41_HUMAN	F-box only protein 41 OS=Homo sapiens OX=9606 GN=FBXO41 PE=2 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	478-UNIMOD:21	0.02	30.0	2	1	0
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	21-UNIMOD:21	0.07	30.0	2	1	0
PRT	sp|Q13185|CBX3_HUMAN	Chromobox protein homolog 3 OS=Homo sapiens OX=9606 GN=CBX3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	93-UNIMOD:21	0.08	30.0	2	1	0
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	735-UNIMOD:21,741-UNIMOD:35,673-UNIMOD:21	0.03	30.0	4	2	0
PRT	sp|P35658-2|NU214_HUMAN	Isoform 2 of Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	1033-UNIMOD:21,1038-UNIMOD:35	0.01	30.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	832-UNIMOD:21,830-UNIMOD:21	0.03	30.0	6	2	0
PRT	sp|Q9P0L0|VAPA_HUMAN	Vesicle-associated membrane protein-associated protein A OS=Homo sapiens OX=9606 GN=VAPA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	214-UNIMOD:21	0.07	30.0	3	1	0
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	50-UNIMOD:21,43-UNIMOD:21	0.23	30.0	4	2	0
PRT	sp|Q96IG2-2|FXL20_HUMAN	Isoform 2 of F-box/LRR-repeat protein 20 OS=Homo sapiens OX=9606 GN=FBXL20	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	385-UNIMOD:21	0.05	30.0	3	1	0
PRT	sp|Q0JRZ9|FCHO2_HUMAN	F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	496-UNIMOD:21	0.04	30.0	1	1	1
PRT	sp|Q13427|PPIG_HUMAN	Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	745-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|P05023-4|AT1A1_HUMAN	Isoform 4 of Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens OX=9606 GN=ATP1A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	2	1	0
PRT	sp|Q7L9B9|EEPD1_HUMAN	Endonuclease/exonuclease/phosphatase family domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EEPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	134-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q5H9R7-6|PP6R3_HUMAN	Isoform 6 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	3	1	0
PRT	sp|Q92613|JADE3_HUMAN	Protein Jade-3 OS=Homo sapiens OX=9606 GN=JADE3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	8-UNIMOD:21,26-UNIMOD:35	0.03	29.0	1	1	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	85-UNIMOD:21	0.17	29.0	1	1	1
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	316-UNIMOD:21,327-UNIMOD:4,328-UNIMOD:21	0.05	29.0	3	2	1
PRT	sp|Q96D21|RHES_HUMAN	GTP-binding protein Rhes OS=Homo sapiens OX=9606 GN=RASD2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	205-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|Q9NR30|DDX21_HUMAN	Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	89-UNIMOD:21	0.02	29.0	3	1	0
PRT	sp|Q13459-2|MYO9B_HUMAN	Isoform Short of Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	1405-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	166-UNIMOD:21	0.04	29.0	6	1	0
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	458-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q96JM2|ZN462_HUMAN	Zinc finger protein 462 OS=Homo sapiens OX=9606 GN=ZNF462 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	350-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q7LFL8|CXXC5_HUMAN	CXXC-type zinc finger protein 5 OS=Homo sapiens OX=9606 GN=CXXC5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	83-UNIMOD:21,96-UNIMOD:35,97-UNIMOD:35	0.09	29.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	243-UNIMOD:21,246-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|P08559-4|ODPA_HUMAN	Isoform 4 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	331-UNIMOD:21,332-UNIMOD:35,338-UNIMOD:21	0.04	29.0	6	1	0
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null		0.13	29.0	2	1	0
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	1852-UNIMOD:21,1848-UNIMOD:21,1855-UNIMOD:21	0.01	29.0	4	1	0
PRT	sp|P32241|VIPR1_HUMAN	Vasoactive intestinal polypeptide receptor 1 OS=Homo sapiens OX=9606 GN=VIPR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	425-UNIMOD:21,430-UNIMOD:4,436-UNIMOD:35	0.05	29.0	1	1	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	29.0	null	181-UNIMOD:21	0.04	29.0	2	1	0
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|P61224-4|RAP1B_HUMAN	Isoform 4 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	69-UNIMOD:35	0.10	28.0	1	1	1
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	50-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|O15226|NKRF_HUMAN	NF-kappa-B-repressing factor OS=Homo sapiens OX=9606 GN=NKRF PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	65-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|A8CG34-2|P121C_HUMAN	Isoform 2 of Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	116-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	2527-UNIMOD:21,2526-UNIMOD:21	0.00	28.0	3	1	0
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	623-UNIMOD:4,626-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q5T1V6-2|DDX59_HUMAN	Isoform 2 of Probable ATP-dependent RNA helicase DDX59 OS=Homo sapiens OX=9606 GN=DDX59	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	60-UNIMOD:4,76-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1861-UNIMOD:4,1863-UNIMOD:21,975-UNIMOD:21,936-UNIMOD:35,938-UNIMOD:21	0.02	28.0	3	3	3
PRT	sp|P05386-2|RLA1_HUMAN	Isoform 2 of 60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	83-UNIMOD:35	0.20	28.0	2	1	0
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	290-UNIMOD:21,758-UNIMOD:21	0.04	28.0	3	2	1
PRT	sp|Q9NWH9|SLTM_HUMAN	SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	97-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	79-UNIMOD:21,76-UNIMOD:21	0.06	28.0	6	1	0
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	987-UNIMOD:21,992-UNIMOD:35	0.02	28.0	1	1	1
PRT	sp|P23396|RS3_HUMAN	40S ribosomal protein S3 OS=Homo sapiens OX=9606 GN=RPS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	209-UNIMOD:21	0.06	28.0	3	1	0
PRT	sp|Q6ICG6-3|K0930_HUMAN	Isoform 3 of Uncharacterized protein KIAA0930 OS=Homo sapiens OX=9606 GN=KIAA0930	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	290-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q9H832-2|UBE2Z_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 Z OS=Homo sapiens OX=9606 GN=UBE2Z	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	227-UNIMOD:35,229-UNIMOD:21	0.11	28.0	1	1	1
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	242-UNIMOD:21,77-UNIMOD:21	0.04	28.0	5	2	0
PRT	sp|Q05519-2|SRS11_HUMAN	Isoform 2 of Serine/arginine-rich splicing factor 11 OS=Homo sapiens OX=9606 GN=SRSF11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	207-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	511-UNIMOD:21,515-UNIMOD:21	0.03	28.0	4	1	0
PRT	sp|Q8WVQ1-2|CANT1_HUMAN	Isoform 2 of Soluble calcium-activated nucleotidase 1 OS=Homo sapiens OX=9606 GN=CANT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	14-UNIMOD:21,15-UNIMOD:35	0.08	28.0	1	1	1
PRT	sp|Q2TB10|ZN800_HUMAN	Zinc finger protein 800 OS=Homo sapiens OX=9606 GN=ZNF800 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	317-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q9P227-2|RHG23_HUMAN	Isoform 2 of Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	677-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|Q5SYE7-2|NHSL1_HUMAN	Isoform 2 of NHS-like protein 1 OS=Homo sapiens OX=9606 GN=NHSL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	209-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|Q96SU4-5|OSBL9_HUMAN	Isoform 5 of Oxysterol-binding protein-related protein 9 OS=Homo sapiens OX=9606 GN=OSBPL9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	146-UNIMOD:21,151-UNIMOD:21	0.04	28.0	2	1	0
PRT	sp|Q96EP0-3|RNF31_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase RNF31 OS=Homo sapiens OX=9606 GN=RNF31	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	315-UNIMOD:21,322-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1097-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|Q5UIP0-2|RIF1_HUMAN	Isoform 2 of Telomere-associated protein RIF1 OS=Homo sapiens OX=9606 GN=RIF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1422-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|Q9UBC3-5|DNM3B_HUMAN	Isoform 5 of DNA (cytosine-5)-methyltransferase 3B OS=Homo sapiens OX=9606 GN=DNMT3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	363-UNIMOD:21,373-UNIMOD:4	0.02	28.0	1	1	1
PRT	sp|Q96JP5-2|ZFP91_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	85-UNIMOD:21	0.04	28.0	1	1	1
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1244-UNIMOD:21,1247-UNIMOD:35,1255-UNIMOD:4	0.02	28.0	4	1	0
PRT	sp|Q9H6L5-2|RETR1_HUMAN	Isoform 2 of Reticulophagy regulator 1 OS=Homo sapiens OX=9606 GN=RETREG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	140-UNIMOD:21,148-UNIMOD:4	0.05	28.0	2	1	0
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	419-UNIMOD:35,425-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1043-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|Q9H7S9|ZN703_HUMAN	Zinc finger protein 703 OS=Homo sapiens OX=9606 GN=ZNF703 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	199-UNIMOD:4,217-UNIMOD:21,214-UNIMOD:21,216-UNIMOD:21,215-UNIMOD:21	0.05	28.0	10	1	0
PRT	sp|Q9BYB0-3|SHAN3_HUMAN	Isoform 2 of SH3 and multiple ankyrin repeat domains protein 3 OS=Homo sapiens OX=9606 GN=SHANK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	364-UNIMOD:21,1517-UNIMOD:21	0.02	27.0	2	2	2
PRT	sp|Q8TCZ2-6|C99L2_HUMAN	Isoform 6 of CD99 antigen-like protein 2 OS=Homo sapiens OX=9606 GN=CD99L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.13	27.0	1	1	1
PRT	sp|Q96B97-2|SH3K1_HUMAN	Isoform 2 of SH3 domain-containing kinase-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3KBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	42-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.09	27.0	1	1	1
PRT	sp|P46379-5|BAG6_HUMAN	Isoform 5 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	113-UNIMOD:21,949-UNIMOD:35,958-UNIMOD:21	0.06	27.0	4	2	1
PRT	sp|Q9Y217|MTMR6_HUMAN	Myotubularin-related protein 6 OS=Homo sapiens OX=9606 GN=MTMR6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	561-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	286-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q7Z401|MYCPP_HUMAN	C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1019-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	489-UNIMOD:21	0.01	27.0	5	1	0
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	337-UNIMOD:21,338-UNIMOD:21,347-UNIMOD:21	0.06	27.0	12	2	1
PRT	sp|P01106|MYC_HUMAN	Myc proto-oncogene protein OS=Homo sapiens OX=9606 GN=MYC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	58-UNIMOD:21,62-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q9NX55-3|HYPK_HUMAN	Isoform 3 of Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	38-UNIMOD:21	0.14	27.0	2	1	0
PRT	sp|Q9HBM6|TAF9B_HUMAN	Transcription initiation factor TFIID subunit 9B OS=Homo sapiens OX=9606 GN=TAF9B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	251-UNIMOD:35	0.05	27.0	1	1	1
PRT	sp|P55327-2|TPD52_HUMAN	Isoform 2 of Tumor protein D52 OS=Homo sapiens OX=9606 GN=TPD52	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	131-UNIMOD:21	0.07	27.0	1	1	1
PRT	sp|Q6ZU35|K1211_HUMAN	Uncharacterized protein KIAA1211 OS=Homo sapiens OX=9606 GN=KIAA1211 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1042-UNIMOD:21,1017-UNIMOD:21	0.03	27.0	3	2	1
PRT	sp|Q9NZC9|SMAL1_HUMAN	SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens OX=9606 GN=SMARCAL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	104-UNIMOD:35,108-UNIMOD:4,112-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|O14639-4|ABLM1_HUMAN	Isoform 4 of Actin-binding LIM protein 1 OS=Homo sapiens OX=9606 GN=ABLIM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	292-UNIMOD:21,210-UNIMOD:21	0.10	27.0	2	2	2
PRT	sp|Q86VP3-4|PACS2_HUMAN	Isoform 4 of Phosphofurin acidic cluster sorting protein 2 OS=Homo sapiens OX=9606 GN=PACS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	254-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|A6NDB9|PALM3_HUMAN	Paralemmin-3 OS=Homo sapiens OX=9606 GN=PALM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	124-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q86V15-2|CASZ1_HUMAN	Isoform 2 of Zinc finger protein castor homolog 1 OS=Homo sapiens OX=9606 GN=CASZ1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	57-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q9H3S7|PTN23_HUMAN	Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens OX=9606 GN=PTPN23 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1122-UNIMOD:21,1133-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	237-UNIMOD:21	0.01	27.0	3	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=HIST1H4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	81-UNIMOD:21,85-UNIMOD:35	0.15	27.0	4	1	0
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	243-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P22455-3|FGFR4_HUMAN	Isoform 3 of Fibroblast growth factor receptor 4 OS=Homo sapiens OX=9606 GN=FGFR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	363-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q96E09|F122A_HUMAN	Protein FAM122A OS=Homo sapiens OX=9606 GN=FAM122A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	37-UNIMOD:21	0.09	27.0	1	1	1
PRT	sp|Q9NX40-3|OCAD1_HUMAN	Isoform 3 of OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	123-UNIMOD:21,122-UNIMOD:21	0.06	27.0	6	1	0
PRT	sp|O75581|LRP6_HUMAN	Low-density lipoprotein receptor-related protein 6 OS=Homo sapiens OX=9606 GN=LRP6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1500-UNIMOD:35,1508-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	505-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	232-UNIMOD:21	0.10	27.0	1	1	1
PRT	sp|Q5VWN6-2|F208B_HUMAN	Isoform 2 of Protein FAM208B OS=Homo sapiens OX=9606 GN=FAM208B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1232-UNIMOD:21,1230-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q69YN4-4|VIR_HUMAN	Isoform 4 of Protein virilizer homolog OS=Homo sapiens OX=9606 GN=VIRMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	184-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q8IZQ1-2|WDFY3_HUMAN	Isoform 2 of WD repeat and FYVE domain-containing protein 3 OS=Homo sapiens OX=9606 GN=WDFY3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	970-UNIMOD:21,977-UNIMOD:35	0.00	27.0	1	1	1
PRT	sp|Q86U06-4|RBM23_HUMAN	Isoform 4 of Probable RNA-binding protein 23 OS=Homo sapiens OX=9606 GN=RBM23	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	112-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	230-UNIMOD:385,230-UNIMOD:4,234-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	27.0	null	780-UNIMOD:21,778-UNIMOD:21	0.04	27.0	3	1	0
PRT	sp|P62879-2|GBB2_HUMAN	Isoform 2 of Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-2 OS=Homo sapiens OX=9606 GN=GNB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q9BRD0|BUD13_HUMAN	BUD13 homolog OS=Homo sapiens OX=9606 GN=BUD13 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	271-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|O75122-3|CLAP2_HUMAN	Isoform 3 of CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1234-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	171-UNIMOD:35,173-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q01082-3|SPTB2_HUMAN	Isoform 2 of Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTBN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	2089-UNIMOD:21	0.01	26.0	2	2	2
PRT	sp|O14656-2|TOR1A_HUMAN	Isoform 2 of Torsin-1A OS=Homo sapiens OX=9606 GN=TOR1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	224-UNIMOD:21,230-UNIMOD:35	0.03	26.0	6	1	0
PRT	sp|P29536-2|LMOD1_HUMAN	Isoform 2 of Leiomodin-1 OS=Homo sapiens OX=9606 GN=LMOD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	492-UNIMOD:21,107-UNIMOD:21	0.05	26.0	2	2	2
PRT	sp|Q96K83|ZN521_HUMAN	Zinc finger protein 521 OS=Homo sapiens OX=9606 GN=ZNF521 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	268-UNIMOD:4,272-UNIMOD:4,273-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	824-UNIMOD:21	0.03	26.0	2	2	2
PRT	sp|Q9ULL5-2|PRR12_HUMAN	Isoform 2 of Proline-rich protein 12 OS=Homo sapiens OX=9606 GN=PRR12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	487-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1688-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9C0I1-3|MTMRC_HUMAN	Isoform 3 of Myotubularin-related protein 12 OS=Homo sapiens OX=9606 GN=MTMR12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	606-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q8TDN6|BRX1_HUMAN	Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	261-UNIMOD:21,264-UNIMOD:35	0.07	26.0	1	1	1
PRT	sp|Q5VZL5-3|ZMYM4_HUMAN	Isoform 3 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	857-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	1269-UNIMOD:21,1267-UNIMOD:21	0.02	26.0	4	1	0
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	527-UNIMOD:21	0.01	26.0	3	1	0
PRT	sp|Q92733|PRCC_HUMAN	Proline-rich protein PRCC OS=Homo sapiens OX=9606 GN=PRCC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	209-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|O60271-5|JIP4_HUMAN	Isoform 5 of C-Jun-amino-terminal kinase-interacting protein 4 OS=Homo sapiens OX=9606 GN=SPAG9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	183-UNIMOD:21,185-UNIMOD:21,254-UNIMOD:21	0.04	26.0	3	2	1
PRT	sp|Q9NTI5-5|PDS5B_HUMAN	Isoform 5 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	53-UNIMOD:21,27-UNIMOD:21	0.30	26.0	3	2	1
PRT	sp|Q8N1F7-2|NUP93_HUMAN	Isoform 2 of Nuclear pore complex protein Nup93 OS=Homo sapiens OX=9606 GN=NUP93	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	643-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q8N3V7-2|SYNPO_HUMAN	Isoform 2 of Synaptopodin OS=Homo sapiens OX=9606 GN=SYNPO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	802-UNIMOD:35,804-UNIMOD:21,812-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	522-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q96S59-2|RANB9_HUMAN	Isoform 2 of Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	145-UNIMOD:35,146-UNIMOD:21,151-UNIMOD:35	0.06	26.0	1	1	0
PRT	sp|Q05209-2|PTN12_HUMAN	Isoform 2 of Tyrosine-protein phosphatase non-receptor type 12 OS=Homo sapiens OX=9606 GN=PTPN12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	265-UNIMOD:35,267-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|P13674|P4HA1_HUMAN	Prolyl 4-hydroxylase subunit alpha-1 OS=Homo sapiens OX=9606 GN=P4HA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	364-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	139-UNIMOD:21,41-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	196-UNIMOD:21	0.05	26.0	4	3	2
PRT	sp|Q9UHD1-2|CHRD1_HUMAN	Isoform 2 of Cysteine and histidine-rich domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CHORDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	180-UNIMOD:21,192-UNIMOD:4	0.06	26.0	1	1	1
PRT	sp|Q2TAZ0|ATG2A_HUMAN	Autophagy-related protein 2 homolog A OS=Homo sapiens OX=9606 GN=ATG2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	403-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	981-UNIMOD:35,998-UNIMOD:21,523-UNIMOD:21	0.03	26.0	3	2	1
PRT	sp|Q6DT37|MRCKG_HUMAN	Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1492-UNIMOD:21,1493-UNIMOD:35,1505-UNIMOD:35	0.01	26.0	1	1	1
PRT	sp|Q14135-5|VGLL4_HUMAN	Isoform 5 of Transcription cofactor vestigial-like protein 4 OS=Homo sapiens OX=9606 GN=VGLL4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	116-UNIMOD:21,121-UNIMOD:4	0.09	26.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	715-UNIMOD:21,718-UNIMOD:21,769-UNIMOD:21,402-UNIMOD:21,406-UNIMOD:21,614-UNIMOD:21,616-UNIMOD:21	0.07	26.0	7	4	3
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	641-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9HC62|SENP2_HUMAN	Sentrin-specific protease 2 OS=Homo sapiens OX=9606 GN=SENP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	32-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q9UHB7-2|AFF4_HUMAN	Isoform 2 of AF4/FMR2 family member 4 OS=Homo sapiens OX=9606 GN=AFF4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	178-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	294-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q2M2I3|FA83E_HUMAN	Protein FAM83E OS=Homo sapiens OX=9606 GN=FAM83E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	324-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q6Y7W6-4|GGYF2_HUMAN	Isoform 3 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	587-UNIMOD:21,596-UNIMOD:35	0.02	26.0	5	1	0
PRT	sp|Q9NR12-2|PDLI7_HUMAN	Isoform 2 of PDZ and LIM domain protein 7 OS=Homo sapiens OX=9606 GN=PDLIM7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	96-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|P35606|COPB2_HUMAN	Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	861-UNIMOD:21,859-UNIMOD:21	0.03	26.0	3	1	0
PRT	sp|Q86X27|RGPS2_HUMAN	Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens OX=9606 GN=RALGPS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	341-UNIMOD:385,341-UNIMOD:4,343-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|O15085|ARHGB_HUMAN	Rho guanine nucleotide exchange factor 11 OS=Homo sapiens OX=9606 GN=ARHGEF11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	556-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|O43823|AKAP8_HUMAN	A-kinase anchor protein 8 OS=Homo sapiens OX=9606 GN=AKAP8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q03112|MECOM_HUMAN	MDS1 and EVI1 complex locus protein OS=Homo sapiens OX=9606 GN=MECOM PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	550-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	591-UNIMOD:4,58-UNIMOD:4,511-UNIMOD:4	0.20	25.0	12	8	7
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	91-UNIMOD:21,108-UNIMOD:35	0.04	25.0	5	1	0
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q9BUH8|BEGIN_HUMAN	Brain-enriched guanylate kinase-associated protein OS=Homo sapiens OX=9606 GN=BEGAIN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	246-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|O95487-2|SC24B_HUMAN	Isoform 2 of Protein transport protein Sec24B OS=Homo sapiens OX=9606 GN=SEC24B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1189-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|O00204-2|ST2B1_HUMAN	Isoform 2 of Sulfotransferase family cytosolic 2B member 1 OS=Homo sapiens OX=9606 GN=SULT2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	332-UNIMOD:21	0.07	25.0	2	1	0
PRT	sp|Q641Q2-2|WAC2A_HUMAN	Isoform 2 of WASH complex subunit 2A OS=Homo sapiens OX=9606 GN=WASHC2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	331-UNIMOD:21,909-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	263-UNIMOD:21,231-UNIMOD:21	0.05	25.0	4	3	2
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.02	25.0	1	1	1
PRT	sp|Q14689-3|DIP2A_HUMAN	Isoform 3 of Disco-interacting protein 2 homolog A OS=Homo sapiens OX=9606 GN=DIP2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	94-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9P107-2|GMIP_HUMAN	Isoform 2 of GEM-interacting protein OS=Homo sapiens OX=9606 GN=GMIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	859-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	363-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|O95049-5|ZO3_HUMAN	Isoform 6 of Tight junction protein ZO-3 OS=Homo sapiens OX=9606 GN=TJP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	283-UNIMOD:21,828-UNIMOD:21	0.04	25.0	3	2	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q15149-7|PLEC_HUMAN	Isoform 7 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.00	25.0	1	1	1
PRT	sp|P05771-2|KPCB_HUMAN	Isoform Beta-II of Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	641-UNIMOD:21	0.02	25.0	5	1	0
PRT	sp|P11274-2|BCR_HUMAN	Isoform 2 of Breakpoint cluster region protein OS=Homo sapiens OX=9606 GN=BCR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	459-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P78536|ADA17_HUMAN	Disintegrin and metalloproteinase domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ADAM17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	735-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q14004-2|CDK13_HUMAN	Isoform 2 of Cyclin-dependent kinase 13 OS=Homo sapiens OX=9606 GN=CDK13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	525-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|O14683|P5I11_HUMAN	Tumor protein p53-inducible protein 11 OS=Homo sapiens OX=9606 GN=TP53I11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	14-UNIMOD:21	0.06	25.0	2	1	0
PRT	sp|P67936|TPM4_HUMAN	Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q76I76|SSH2_HUMAN	Protein phosphatase Slingshot homolog 2 OS=Homo sapiens OX=9606 GN=SSH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	784-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	641-UNIMOD:21,514-UNIMOD:21	0.04	25.0	2	2	2
PRT	sp|P17096-2|HMGA1_HUMAN	Isoform HMG-Y of High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	42-UNIMOD:21	0.16	25.0	3	1	0
PRT	sp|Q9H0E3-2|SP130_HUMAN	Isoform 2 of Histone deacetylase complex subunit SAP130 OS=Homo sapiens OX=9606 GN=SAP130	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	415-UNIMOD:35,416-UNIMOD:35,420-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|P42696-2|RBM34_HUMAN	Isoform 2 of RNA-binding protein 34 OS=Homo sapiens OX=9606 GN=RBM34	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	14-UNIMOD:21	0.07	25.0	2	1	0
PRT	sp|Q9BYG3|MK67I_HUMAN	MKI67 FHA domain-interacting nucleolar phosphoprotein OS=Homo sapiens OX=9606 GN=NIFK PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|P05091|ALDH2_HUMAN	Aldehyde dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ALDH2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	66-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|P04035-2|HMDH_HUMAN	Isoform 2 of 3-hydroxy-3-methylglutaryl-coenzyme A reductase OS=Homo sapiens OX=9606 GN=HMGCR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	409-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P10155-3|RO60_HUMAN	Isoform 3 of 60 kDa SS-A/Ro ribonucleoprotein OS=Homo sapiens OX=9606 GN=TROVE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	192-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q15643|TRIPB_HUMAN	Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1886-UNIMOD:35,1891-UNIMOD:21	0.01	25.0	4	1	0
PRT	sp|Q92565-2|RPGF5_HUMAN	Isoform 2 of Rap guanine nucleotide exchange factor 5 OS=Homo sapiens OX=9606 GN=RAPGEF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	207-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	41-UNIMOD:21	0.15	25.0	1	1	1
PRT	sp|Q12888|TP53B_HUMAN	TP53-binding protein 1 OS=Homo sapiens OX=9606 GN=TP53BP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1634-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8ND56-3|LS14A_HUMAN	Isoform 3 of Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	178-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	162-UNIMOD:21,669-UNIMOD:21	0.03	25.0	4	2	1
PRT	sp|Q8WW12-3|PCNP_HUMAN	Isoform 3 of PEST proteolytic signal-containing nuclear protein OS=Homo sapiens OX=9606 GN=PCNP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.22	25.0	1	1	1
PRT	sp|Q12767|TMM94_HUMAN	Transmembrane protein 94 OS=Homo sapiens OX=9606 GN=TMEM94 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	513-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	844-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q68EM7-2|RHG17_HUMAN	Isoform 2 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	596-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q8WX93-2|PALLD_HUMAN	Isoform 2 of Palladin OS=Homo sapiens OX=9606 GN=PALLD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	897-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9BXK5-4|B2L13_HUMAN	Isoform 3 of Bcl-2-like protein 13 OS=Homo sapiens OX=9606 GN=BCL2L13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	282-UNIMOD:21,287-UNIMOD:35,290-UNIMOD:35	0.06	25.0	1	1	1
PRT	sp|Q8IWB9|TEX2_HUMAN	Testis-expressed protein 2 OS=Homo sapiens OX=9606 GN=TEX2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	732-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	446-UNIMOD:21,266-UNIMOD:21	0.06	25.0	2	2	2
PRT	sp|P48651-3|PTSS1_HUMAN	Isoform 3 of Phosphatidylserine synthase 1 OS=Homo sapiens OX=9606 GN=PTDSS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	214-UNIMOD:21,216-UNIMOD:4	0.07	25.0	1	1	1
PRT	sp|Q14676|MDC1_HUMAN	Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	1086-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9P275|UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	25.0	null	713-UNIMOD:21,722-UNIMOD:35	0.02	25.0	2	1	0
PRT	sp|Q8TAD8|SNIP1_HUMAN	Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	31-UNIMOD:28,35-UNIMOD:21	0.04	25.0	3	1	0
PRT	sp|P48634|PRC2A_HUMAN	Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	342-UNIMOD:21,350-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	553-UNIMOD:28,554-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q03989|ARI5A_HUMAN	AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	300-UNIMOD:21	0.04	25.0	1	1	0
PRT	sp|Q9NRY4|RHG35_HUMAN	Rho GTPase-activating protein 35 OS=Homo sapiens OX=9606 GN=ARHGAP35 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	1150-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q96S59|RANB9_HUMAN	Ran-binding protein 9 OS=Homo sapiens OX=9606 GN=RANBP9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	486-UNIMOD:35,487-UNIMOD:21	0.03	25.0	1	1	0
PRT	sp|P81605|DCD_HUMAN	Dermcidin OS=Homo sapiens OX=9606 GN=DCD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.20	24.0	2	2	2
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	361-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P60866|RS20_HUMAN	40S ribosomal protein S20 OS=Homo sapiens OX=9606 GN=RPS20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	9-UNIMOD:21	0.13	24.0	1	1	1
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	245-UNIMOD:4	0.08	24.0	2	2	2
PRT	sp|P52735-3|VAV2_HUMAN	Isoform 3 of Guanine nucleotide exchange factor VAV2 OS=Homo sapiens OX=9606 GN=VAV2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P49407-2|ARRB1_HUMAN	Isoform 1B of Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	391-UNIMOD:35,402-UNIMOD:21,404-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|Q9UKJ3-2|GPTC8_HUMAN	Isoform 2 of G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	662-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	117-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	403-UNIMOD:21,480-UNIMOD:4,481-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q14586|ZN267_HUMAN	Zinc finger protein 267 OS=Homo sapiens OX=9606 GN=ZNF267 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	105-UNIMOD:21,106-UNIMOD:4	0.02	24.0	2	1	0
PRT	sp|Q13477-4|MADCA_HUMAN	Isoform 4 of Mucosal addressin cell adhesion molecule 1 OS=Homo sapiens OX=9606 GN=MADCAM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	176-UNIMOD:21	0.08	24.0	1	1	1
PRT	sp|O94832|MYO1D_HUMAN	Unconventional myosin-Id OS=Homo sapiens OX=9606 GN=MYO1D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	970-UNIMOD:4,971-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9P0K7-3|RAI14_HUMAN	Isoform 3 of Ankycorbin OS=Homo sapiens OX=9606 GN=RAI14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	281-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q8NB78-2|KDM1B_HUMAN	Isoform 2 of Lysine-specific histone demethylase 1B OS=Homo sapiens OX=9606 GN=KDM1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	13-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	76-UNIMOD:21,80-UNIMOD:4,864-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|Q7L4I2|RSRC2_HUMAN	Arginine/serine-rich coiled-coil protein 2 OS=Homo sapiens OX=9606 GN=RSRC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	32-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q13435|SF3B2_HUMAN	Splicing factor 3B subunit 2 OS=Homo sapiens OX=9606 GN=SF3B2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1487-UNIMOD:21,1498-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q99996-5|AKAP9_HUMAN	Isoform 5 of A-kinase anchor protein 9 OS=Homo sapiens OX=9606 GN=AKAP9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	2677-UNIMOD:21	0.00	24.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P50851-2|LRBA_HUMAN	Isoform 2 of Lipopolysaccharide-responsive and beige-like anchor protein OS=Homo sapiens OX=9606 GN=LRBA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1261-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	517-UNIMOD:21,456-UNIMOD:21	0.03	24.0	2	2	2
PRT	sp|P28715|ERCC5_HUMAN	DNA repair protein complementing XP-G cells OS=Homo sapiens OX=9606 GN=ERCC5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	341-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|O14672-2|ADA10_HUMAN	Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ADAM10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	418-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P29323-2|EPHB2_HUMAN	Isoform 2 of Ephrin type-B receptor 2 OS=Homo sapiens OX=9606 GN=EPHB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	589-UNIMOD:35,590-UNIMOD:21,593-UNIMOD:35,585-UNIMOD:21,584-UNIMOD:21	0.02	24.0	5	1	0
PRT	sp|Q7Z3K3-5|POGZ_HUMAN	Isoform 5 of Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1272-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q15468|STIL_HUMAN	SCL-interrupting locus protein OS=Homo sapiens OX=9606 GN=STIL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	388-UNIMOD:35,395-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9C0G0-3|ZN407_HUMAN	Isoform 3 of Zinc finger protein 407 OS=Homo sapiens OX=9606 GN=ZNF407	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	941-UNIMOD:35,952-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9NXV2|KCTD5_HUMAN	BTB/POZ domain-containing protein KCTD5 OS=Homo sapiens OX=9606 GN=KCTD5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	28-UNIMOD:4,29-UNIMOD:21	0.08	24.0	1	1	1
PRT	sp|Q9NRM7|LATS2_HUMAN	Serine/threonine-protein kinase LATS2 OS=Homo sapiens OX=9606 GN=LATS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	380-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O00255-3|MEN1_HUMAN	Isoform 3 of Menin OS=Homo sapiens OX=9606 GN=MEN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	452-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q9NZJ0|DTL_HUMAN	Denticleless protein homolog OS=Homo sapiens OX=9606 GN=DTL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	487-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q7LDG7|GRP2_HUMAN	RAS guanyl-releasing protein 2 OS=Homo sapiens OX=9606 GN=RASGRP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	116-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|P35711-4|SOX5_HUMAN	Isoform 4 of Transcription factor SOX-5 OS=Homo sapiens OX=9606 GN=SOX5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	125-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q92547|TOPB1_HUMAN	DNA topoisomerase 2-binding protein 1 OS=Homo sapiens OX=9606 GN=TOPBP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	860-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P06737-2|PYGL_HUMAN	Isoform 2 of Glycogen phosphorylase, liver form OS=Homo sapiens OX=9606 GN=PYGL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	395-UNIMOD:35,396-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q8IWJ2|GCC2_HUMAN	GRIP and coiled-coil domain-containing protein 2 OS=Homo sapiens OX=9606 GN=GCC2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1500-UNIMOD:21,1507-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q5VUA4|ZN318_HUMAN	Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1968-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q14739|LBR_HUMAN	Lamin-B receptor OS=Homo sapiens OX=9606 GN=LBR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	99-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q13017-2|RHG05_HUMAN	Isoform 2 of Rho GTPase-activating protein 5 OS=Homo sapiens OX=9606 GN=ARHGAP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1173-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9BX66-3|SRBS1_HUMAN	Isoform 3 of Sorbin and SH3 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SORBS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	281-UNIMOD:21,804-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q9ULD2|MTUS1_HUMAN	Microtubule-associated tumor suppressor 1 OS=Homo sapiens OX=9606 GN=MTUS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	761-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9HB58-2|SP110_HUMAN	Isoform 2 of Sp110 nuclear body protein OS=Homo sapiens OX=9606 GN=SP110	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	177-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q9NWK9-2|BCD1_HUMAN	Isoform 2 of Box C/D snoRNA protein 1 OS=Homo sapiens OX=9606 GN=ZNHIT6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	25-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q14802|FXYD3_HUMAN	FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	87-UNIMOD:21,84-UNIMOD:21	0.23	24.0	2	1	0
PRT	sp|Q2KJY2-2|KI26B_HUMAN	Isoform 2 of Kinesin-like protein KIF26B OS=Homo sapiens OX=9606 GN=KIF26B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	623-UNIMOD:21,621-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q8NDX5-2|PHC3_HUMAN	Isoform 2 of Polyhomeotic-like protein 3 OS=Homo sapiens OX=9606 GN=PHC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	634-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q15648|MED1_HUMAN	Mediator of RNA polymerase II transcription subunit 1 OS=Homo sapiens OX=9606 GN=MED1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1032-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q9H8M2|BRD9_HUMAN	Bromodomain-containing protein 9 OS=Homo sapiens OX=9606 GN=BRD9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	56-UNIMOD:21,566-UNIMOD:21	0.07	24.0	2	2	2
PRT	sp|Q8IZL8|PELP1_HUMAN	Proline-, glutamic acid- and leucine-rich protein 1 OS=Homo sapiens OX=9606 GN=PELP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	641-UNIMOD:35,645-UNIMOD:4,647-UNIMOD:21	0.02	24.0	3	1	0
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q8IXQ4|GPAM1_HUMAN	GPALPP motifs-containing protein 1 OS=Homo sapiens OX=9606 GN=GPALPP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	102-UNIMOD:28,105-UNIMOD:21	0.06	24.0	3	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=HIST1H1E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null	2-UNIMOD:1,18-UNIMOD:21,36-UNIMOD:21	0.16	24.0	2	2	2
PRT	sp|Q9UDY2|ZO2_HUMAN	Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	220-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|O60885|BRD4_HUMAN	Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	296-UNIMOD:21	0.02	24.0	1	1	0
PRT	sp|Q7Z3C6|ATG9A_HUMAN	Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	828-UNIMOD:21	0.03	24.0	1	1	0
PRT	sp|P16157|ANK1_HUMAN	Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1671-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q6UB99|ANR11_HUMAN	Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	2374-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9UNZ2|NSF1C_HUMAN	NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	114-UNIMOD:21	0.04	24.0	1	1	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	104-UNIMOD:21,108-UNIMOD:35	0.16	24.0	1	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=HIST1H1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	2-UNIMOD:1,18-UNIMOD:21	0.09	24.0	1	1	1
PRT	sp|Q9BY89|K1671_HUMAN	Uncharacterized protein KIAA1671 OS=Homo sapiens OX=9606 GN=KIAA1671 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1179-UNIMOD:21,244-UNIMOD:21	0.02	24.0	3	2	1
PRT	sp|P78317|RNF4_HUMAN	E3 ubiquitin-protein ligase RNF4 OS=Homo sapiens OX=9606 GN=RNF4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	91-UNIMOD:4,95-UNIMOD:21	0.12	24.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	158-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|Q9HCR9|PDE11_HUMAN	Dual 3',5'-cyclic-AMP and -GMP phosphodiesterase 11A OS=Homo sapiens OX=9606 GN=PDE11A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	136-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9H2V7-3|SPNS1_HUMAN	Isoform 3 of Protein spinster homolog 1 OS=Homo sapiens OX=9606 GN=SPNS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	431-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9BRZ2|TRI56_HUMAN	E3 ubiquitin-protein ligase TRIM56 OS=Homo sapiens OX=9606 GN=TRIM56 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	442-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q13131|AAPK1_HUMAN	5'-AMP-activated protein kinase catalytic subunit alpha-1 OS=Homo sapiens OX=9606 GN=PRKAA1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	388-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P51798-2|CLCN7_HUMAN	Isoform 2 of H(+)/Cl(-) exchange transporter 7 OS=Homo sapiens OX=9606 GN=CLCN7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	930-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1377-UNIMOD:21	0.01	23.0	7	1	0
PRT	sp|Q96JN0-3|LCOR_HUMAN	Isoform 3 of Ligand-dependent corepressor OS=Homo sapiens OX=9606 GN=LCOR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1048-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q15751|HERC1_HUMAN	Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens OX=9606 GN=HERC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2422-UNIMOD:21,2440-UNIMOD:35	0.00	23.0	1	1	1
PRT	sp|Q92610|ZN592_HUMAN	Zinc finger protein 592 OS=Homo sapiens OX=9606 GN=ZNF592 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	686-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P19367-4|HXK1_HUMAN	Isoform 4 of Hexokinase-1 OS=Homo sapiens OX=9606 GN=HK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q7Z3C6-2|ATG9A_HUMAN	Isoform 2 of Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	767-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|P53367-2|ARFP1_HUMAN	Isoform A of Arfaptin-1 OS=Homo sapiens OX=9606 GN=ARFIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	39-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P41227-2|NAA10_HUMAN	Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	167-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|O14745-2|NHRF1_HUMAN	Isoform 2 of Na(+)/H(+) exchange regulatory cofactor NHE-RF1 OS=Homo sapiens OX=9606 GN=SLC9A3R1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	6-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q9Y271|CLTR1_HUMAN	Cysteinyl leukotriene receptor 1 OS=Homo sapiens OX=9606 GN=CYSLTR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	313-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|O94964-3|SOGA1_HUMAN	Isoform 3 of Protein SOGA1 OS=Homo sapiens OX=9606 GN=SOGA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	449-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	94-UNIMOD:21,96-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	121-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q5HYK7-2|SH319_HUMAN	Isoform 2 of SH3 domain-containing protein 19 OS=Homo sapiens OX=9606 GN=SH3D19	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	148-UNIMOD:21,268-UNIMOD:4,275-UNIMOD:21	0.07	23.0	2	2	2
PRT	sp|P32121-5|ARRB2_HUMAN	Isoform 5 of Beta-arrestin-2 OS=Homo sapiens OX=9606 GN=ARRB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	384-UNIMOD:35,394-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|O15417|TNC18_HUMAN	Trinucleotide repeat-containing gene 18 protein OS=Homo sapiens OX=9606 GN=TNRC18 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2184-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q01970-2|PLCB3_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.01	23.0	1	1	1
PRT	sp|Q02086-2|SP2_HUMAN	Isoform 2 of Transcription factor Sp2 OS=Homo sapiens OX=9606 GN=SP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	71-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q8IZD2-6|KMT2E_HUMAN	Isoform 6 of Inactive histone-lysine N-methyltransferase 2E OS=Homo sapiens OX=9606 GN=KMT2E	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1354-UNIMOD:35,1359-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q07617|SPAG1_HUMAN	Sperm-associated antigen 1 OS=Homo sapiens OX=9606 GN=SPAG1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	423-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q9UIF8-4|BAZ2B_HUMAN	Isoform 4 of Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1087-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9UPX8-4|SHAN2_HUMAN	Isoform 4 of SH3 and multiple ankyrin repeat domains protein 2 OS=Homo sapiens OX=9606 GN=SHANK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	365-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q6UX71-2|PXDC2_HUMAN	Isoform 2 of Plexin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PLXDC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	457-UNIMOD:21	0.04	23.0	2	1	0
PRT	sp|P09493-2|TPM1_HUMAN	Isoform 2 of Tropomyosin alpha-1 chain OS=Homo sapiens OX=9606 GN=TPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.09	23.0	3	2	1
PRT	sp|Q14738-3|2A5D_HUMAN	Isoform Delta-3 of Serine/threonine-protein phosphatase 2A 56 kDa regulatory subunit delta isoform OS=Homo sapiens OX=9606 GN=PPP2R5D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	467-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q15061|WDR43_HUMAN	WD repeat-containing protein 43 OS=Homo sapiens OX=9606 GN=WDR43 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	431-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	234-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	18-UNIMOD:21	0.01	23.0	3	1	0
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	374-UNIMOD:35,382-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1054-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P04920-2|B3A2_HUMAN	Isoform B1 of Anion exchange protein 2 OS=Homo sapiens OX=9606 GN=SLC4A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	99-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q6PIF6-2|MYO7B_HUMAN	Isoform 2 of Unconventional myosin-VIIb OS=Homo sapiens OX=9606 GN=MYO7B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	904-UNIMOD:21,914-UNIMOD:35	0.01	23.0	2	1	0
PRT	sp|Q13206|DDX10_HUMAN	Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens OX=9606 GN=DDX10 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	831-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P00736|C1R_HUMAN	Complement C1r subcomponent OS=Homo sapiens OX=9606 GN=C1R PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	541-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q8N4C8-5|MINK1_HUMAN	Isoform 5 of Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	706-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|P46821|MAP1B_HUMAN	Microtubule-associated protein 1B OS=Homo sapiens OX=9606 GN=MAP1B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2271-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9NQG7-2|HPS4_HUMAN	Isoform 2 of Hermansky-Pudlak syndrome 4 protein OS=Homo sapiens OX=9606 GN=HPS4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	287-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9NZN8-4|CNOT2_HUMAN	Isoform 4 of CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	119-UNIMOD:35,126-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	328-UNIMOD:21	0.02	23.0	5	1	0
PRT	sp|Q7Z3G6|PRIC2_HUMAN	Prickle-like protein 2 OS=Homo sapiens OX=9606 GN=PRICKLE2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	695-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9NZM1-5|MYOF_HUMAN	Isoform 5 of Myoferlin OS=Homo sapiens OX=9606 GN=MYOF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	729-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9UGV2-2|NDRG3_HUMAN	Isoform 2 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	315-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	296-UNIMOD:21,292-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|P28290-2|ITPI2_HUMAN	Isoform 2 of Protein ITPRID2 OS=Homo sapiens OX=9606 GN=ITPRID2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	288-UNIMOD:21,295-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	4766-UNIMOD:21,2388-UNIMOD:35,2397-UNIMOD:21,5839-UNIMOD:21,490-UNIMOD:21,493-UNIMOD:35	0.01	23.0	6	4	2
PRT	sp|Q3KR37-3|GRM1B_HUMAN	Isoform 3 of GRAM domain-containing protein 1B OS=Homo sapiens OX=9606 GN=GRAMD1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	271-UNIMOD:35,278-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1433-UNIMOD:21	0.01	23.0	2	2	2
PRT	sp|P14921-4|ETS1_HUMAN	Isoform Ets-1 p27 of Protein C-ets-1 OS=Homo sapiens OX=9606 GN=ETS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	66-UNIMOD:21	0.10	23.0	1	1	0
PRT	sp|Q13033-2|STRN3_HUMAN	Isoform Alpha of Striatin-3 OS=Homo sapiens OX=9606 GN=STRN3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	605-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P51532|SMCA4_HUMAN	Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	1452-UNIMOD:21	0.01	23.0	1	1	0
PRT	sp|Q5VWN6|F208B_HUMAN	Protein FAM208B OS=Homo sapiens OX=9606 GN=FAM208B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	23.0	null	2037-UNIMOD:21	0.01	23.0	2	2	1
PRT	sp|P53365|ARFP2_HUMAN	Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	72-UNIMOD:21	0.05	23.0	1	1	0
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	257-UNIMOD:28,258-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	1260-UNIMOD:28,1263-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|O00499|BIN1_HUMAN	Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	331-UNIMOD:21	0.04	23.0	1	1	0
PRT	sp|Q9UPU7|TBD2B_HUMAN	TBC1 domain family member 2B OS=Homo sapiens OX=9606 GN=TBC1D2B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	316-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P49450|CENPA_HUMAN	Histone H3-like centromeric protein A OS=Homo sapiens OX=9606 GN=CENPA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	17-UNIMOD:21,19-UNIMOD:21	0.11	23.0	1	1	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	12-UNIMOD:21,613-UNIMOD:21	0.06	22.0	2	2	2
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	642-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q00839-2|HNRPU_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens OX=9606 GN=HNRNPU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	252-UNIMOD:21,270-UNIMOD:4,276-UNIMOD:4	0.05	22.0	2	2	2
PRT	sp|Q14153-2|FA53B_HUMAN	Isoform 2 of Protein FAM53B OS=Homo sapiens OX=9606 GN=FAM53B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	178-UNIMOD:21,181-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|Q96G74-2|OTUD5_HUMAN	Isoform 2 of OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	40-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9UPN3-4|MACF1_HUMAN	Isoform 5 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1862-UNIMOD:21	0.01	22.0	2	2	2
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.05	22.0	1	1	1
PRT	sp|O43490-2|PROM1_HUMAN	Isoform 2 of Prominin-1 OS=Homo sapiens OX=9606 GN=PROM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	850-UNIMOD:35,851-UNIMOD:21,854-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	937-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8NDT2-2|RB15B_HUMAN	Isoform 2 of Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	205-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	2	1	0
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	510-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q92738|US6NL_HUMAN	USP6 N-terminal-like protein OS=Homo sapiens OX=9606 GN=USP6NL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	642-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	84-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q8NG27-3|PJA1_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase Praja-1 OS=Homo sapiens OX=9606 GN=PJA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	58-UNIMOD:35,71-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P28066-2|PSA5_HUMAN	Isoform 2 of Proteasome subunit alpha type-5 OS=Homo sapiens OX=9606 GN=PSMA5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	98-UNIMOD:35,107-UNIMOD:4	0.11	22.0	1	1	1
PRT	sp|Q6GYQ0-3|RGPA1_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-1 OS=Homo sapiens OX=9606 GN=RALGAPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	711-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q96S15-2|WDR24_HUMAN	Isoform 2 of GATOR complex protein WDR24 OS=Homo sapiens OX=9606 GN=WDR24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	581-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	198-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|O00148-3|DX39A_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	197-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|Q03989-5|ARI5A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	229-UNIMOD:21	0.04	22.0	1	1	0
PRT	sp|P33527-8|MRP1_HUMAN	Isoform 8 of Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	815-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P06753-4|TPM3_HUMAN	Isoform 4 of Tropomyosin alpha-3 chain OS=Homo sapiens OX=9606 GN=TPM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q9H4G0-4|E41L1_HUMAN	Isoform 4 of Band 4.1-like protein 1 OS=Homo sapiens OX=9606 GN=EPB41L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	467-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	204-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q9Y508-2|RN114_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RNF114 OS=Homo sapiens OX=9606 GN=RNF114	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	105-UNIMOD:21,110-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|Q96II8-3|LRCH3_HUMAN	Isoform 3 of Leucine-rich repeat and calponin homology domain-containing protein 3 OS=Homo sapiens OX=9606 GN=LRCH3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	419-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P62070-2|RRAS2_HUMAN	Isoform 2 of Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	106-UNIMOD:4,109-UNIMOD:21	0.13	22.0	2	1	0
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	993-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q13523|PRP4B_HUMAN	Serine/threonine-protein kinase PRP4 homolog OS=Homo sapiens OX=9606 GN=PRPF4B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	277-UNIMOD:21	0.01	22.0	3	1	0
PRT	sp|O60566-2|BUB1B_HUMAN	Isoform 2 of Mitotic checkpoint serine/threonine-protein kinase BUB1 beta OS=Homo sapiens OX=9606 GN=BUB1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	494-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q6UXY8-2|TMC5_HUMAN	Isoform 2 of Transmembrane channel-like protein 5 OS=Homo sapiens OX=9606 GN=TMC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	192-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q96IY1|NSL1_HUMAN	Kinetochore-associated protein NSL1 homolog OS=Homo sapiens OX=9606 GN=NSL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	241-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|Q9UPN4-3|CP131_HUMAN	Isoform 3 of Centrosomal protein of 131 kDa OS=Homo sapiens OX=9606 GN=CEP131	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	116-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q96CW6|S7A6O_HUMAN	Probable RNA polymerase II nuclear localization protein SLC7A6OS OS=Homo sapiens OX=9606 GN=SLC7A6OS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	16-UNIMOD:21,27-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	304-UNIMOD:21,944-UNIMOD:35	0.02	22.0	2	2	2
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	180-UNIMOD:21,185-UNIMOD:21	0.10	22.0	2	1	0
PRT	sp|Q6ZUM4-2|RHG27_HUMAN	Isoform 2 of Rho GTPase-activating protein 27 OS=Homo sapiens OX=9606 GN=ARHGAP27	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	94-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	37-UNIMOD:21	0.06	22.0	2	1	0
PRT	sp|Q9C0A6-2|SETD5_HUMAN	Isoform 2 of SET domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SETD5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	744-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	291-UNIMOD:21,293-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9UD71-2|PPR1B_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 1B OS=Homo sapiens OX=9606 GN=PPP1R1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	10-UNIMOD:21	0.10	22.0	1	1	1
PRT	sp|Q13425|SNTB2_HUMAN	Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	391-UNIMOD:4,393-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q6R327|RICTR_HUMAN	Rapamycin-insensitive companion of mTOR OS=Homo sapiens OX=9606 GN=RICTOR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1341-UNIMOD:35,1346-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q13094|LCP2_HUMAN	Lymphocyte cytosolic protein 2 OS=Homo sapiens OX=9606 GN=LCP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	207-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|Q9ULD5|ZN777_HUMAN	Zinc finger protein 777 OS=Homo sapiens OX=9606 GN=ZNF777 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	625-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q0JRZ9-3|FCHO2_HUMAN	Isoform 3 of F-BAR domain only protein 2 OS=Homo sapiens OX=9606 GN=FCHO2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	419-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q12802-4|AKP13_HUMAN	Isoform 3 of A-kinase anchor protein 13 OS=Homo sapiens OX=9606 GN=AKAP13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	2447-UNIMOD:21,2456-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q96B23-2|CR025_HUMAN	Isoform 2 of Uncharacterized protein C18orf25 OS=Homo sapiens OX=9606 GN=C18orf25	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	66-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q16799-2|RTN1_HUMAN	Isoform RTN1-B of Reticulon-1 OS=Homo sapiens OX=9606 GN=RTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	67-UNIMOD:21,70-UNIMOD:35	0.05	22.0	1	1	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P23588-2|IF4B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9BWT3|PAPOG_HUMAN	Poly(A) polymerase gamma OS=Homo sapiens OX=9606 GN=PAPOLG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	684-UNIMOD:21,693-UNIMOD:35	0.03	22.0	1	1	1
PRT	sp|Q15696|U2AFM_HUMAN	U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein 2 OS=Homo sapiens OX=9606 GN=ZRSR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	384-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q16825|PTN21_HUMAN	Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	637-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	215-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	448-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q96GP6-2|SREC2_HUMAN	Isoform 2 of Scavenger receptor class F member 2 OS=Homo sapiens OX=9606 GN=SCARF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	713-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8NAP3|ZBT38_HUMAN	Zinc finger and BTB domain-containing protein 38 OS=Homo sapiens OX=9606 GN=ZBTB38 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	307-UNIMOD:21,309-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q8N7R7-3|CCYL1_HUMAN	Isoform 3 of Cyclin-Y-like protein 1 OS=Homo sapiens OX=9606 GN=CCNYL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	42-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q15139|KPCD1_HUMAN	Serine/threonine-protein kinase D1 OS=Homo sapiens OX=9606 GN=PRKD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	247-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q96RL1-2|UIMC1_HUMAN	Isoform 2 of BRCA1-A complex subunit RAP80 OS=Homo sapiens OX=9606 GN=UIMC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	139-UNIMOD:21,140-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|Q9UHF7|TRPS1_HUMAN	Zinc finger transcription factor Trps1 OS=Homo sapiens OX=9606 GN=TRPS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	830-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|P31942-6|HNRH3_HUMAN	Isoform 6 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|O00499-6|BIN1_HUMAN	Isoform II2 of Myc box-dependent-interacting protein 1 OS=Homo sapiens OX=9606 GN=BIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	300-UNIMOD:21	0.05	22.0	1	1	0
PRT	sp|Q9ULH0-5|KDIS_HUMAN	Isoform 5 of Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	327-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|P40763-3|STAT3_HUMAN	Isoform 3 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	687-UNIMOD:4,705-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q6UN15|FIP1_HUMAN	Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	488-UNIMOD:27,494-UNIMOD:21	0.03	22.0	1	1	0
PRT	sp|P46379|BAG6_HUMAN	Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	113-UNIMOD:21	0.03	22.0	1	1	0
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	2151-UNIMOD:21	0.01	22.0	1	1	0
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	100-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|Q13574|DGKZ_HUMAN	Diacylglycerol kinase zeta OS=Homo sapiens OX=9606 GN=DGKZ PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	260-UNIMOD:21,265-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|Q6NWY9|PR40B_HUMAN	Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens OX=9606 GN=PRPF40B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	764-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O60701|UGDH_HUMAN	UDP-glucose 6-dehydrogenase OS=Homo sapiens OX=9606 GN=UGDH PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	476-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q86YZ3|HORN_HUMAN	Hornerin OS=Homo sapiens OX=9606 GN=HRNR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	1008-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q7Z5P9|MUC19_HUMAN	Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	5836-UNIMOD:21,5853-UNIMOD:21	0.00	22.0	1	1	1
PRT	sp|P29590|PML_HUMAN	Protein PML OS=Homo sapiens OX=9606 GN=PML PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	8-UNIMOD:21,23-UNIMOD:35	0.03	22.0	1	1	0
PRT	sp|Q9UBP6-2|TRMB_HUMAN	Isoform 2 of tRNA (guanine-N(7)-)-methyltransferase OS=Homo sapiens OX=9606 GN=METTL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	27-UNIMOD:21,30-UNIMOD:35	0.08	21.0	2	1	0
PRT	sp|Q8WYP5|ELYS_HUMAN	Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1023-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q96L91-4|EP400_HUMAN	Isoform 4 of E1A-binding protein p400 OS=Homo sapiens OX=9606 GN=EP400	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	2696-UNIMOD:21	0.00	21.0	1	1	1
PRT	sp|Q13153|PAK1_HUMAN	Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	174-UNIMOD:21	0.07	21.0	2	1	0
PRT	sp|Q15772-1|SPEG_HUMAN	Isoform 1 of Striated muscle preferentially expressed protein kinase OS=Homo sapiens OX=9606 GN=SPEG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	560-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P02788-2|TRFL_HUMAN	Isoform DeltaLf of Lactotransferrin OS=Homo sapiens OX=9606 GN=LTF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1001-UNIMOD:21,1000-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|P82970|HMGN5_HUMAN	High mobility group nucleosome-binding domain-containing protein 5 OS=Homo sapiens OX=9606 GN=HMGN5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q02817|MUC2_HUMAN	Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	4835-UNIMOD:4	0.00	21.0	1	1	1
PRT	sp|Q9H2U2-6|IPYR2_HUMAN	Isoform 5 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q99798|ACON_HUMAN	Aconitate hydratase, mitochondrial OS=Homo sapiens OX=9606 GN=ACO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|Q9Y3X0|CCDC9_HUMAN	Coiled-coil domain-containing protein 9 OS=Homo sapiens OX=9606 GN=CCDC9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	137-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|O15372|EIF3H_HUMAN	Eukaryotic translation initiation factor 3 subunit H OS=Homo sapiens OX=9606 GN=EIF3H PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	235-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q9HCG1|ZN160_HUMAN	Zinc finger protein 160 OS=Homo sapiens OX=9606 GN=ZNF160 PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	326-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|P53365-3|ARFP2_HUMAN	Isoform 3 of Arfaptin-2 OS=Homo sapiens OX=9606 GN=ARFIP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	34-UNIMOD:21	0.06	21.0	1	1	0
PRT	sp|O94953-2|KDM4B_HUMAN	Isoform 2 of Lysine-specific demethylase 4B OS=Homo sapiens OX=9606 GN=KDM4B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|O43166-3|SI1L1_HUMAN	Isoform 3 of Signal-induced proliferation-associated 1-like protein 1 OS=Homo sapiens OX=9606 GN=SIPA1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1487-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q8NCF5|NF2IP_HUMAN	NFATC2-interacting protein OS=Homo sapiens OX=9606 GN=NFATC2IP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	369-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q6ZSZ5-2|ARHGI_HUMAN	Isoform 4 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	966-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|A0JLT2|MED19_HUMAN	Mediator of RNA polymerase II transcription subunit 19 OS=Homo sapiens OX=9606 GN=MED19 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	226-UNIMOD:21,232-UNIMOD:35	0.09	21.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	973-UNIMOD:21,1099-UNIMOD:21,1105-UNIMOD:4	0.02	21.0	3	2	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	104-UNIMOD:21	0.06	21.0	2	2	2
PRT	sp|Q7Z417-2|NUFP2_HUMAN	Isoform 2 of Nuclear fragile X mental retardation-interacting protein 2 OS=Homo sapiens OX=9606 GN=NUFIP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	87-UNIMOD:21	0.10	21.0	1	1	1
PRT	sp|Q9NVT9-2|ARMC1_HUMAN	Isoform 2 of Armadillo repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=ARMC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	87-UNIMOD:21	0.11	21.0	1	1	1
PRT	sp|Q86YA3-3|ZGRF1_HUMAN	Isoform 3 of Protein ZGRF1 OS=Homo sapiens OX=9606 GN=ZGRF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	671-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|O60885-2|BRD4_HUMAN	Isoform C of Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	294-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q92890-3|UFD1_HUMAN	Isoform 3 of Ubiquitin recognition factor in ER-associated degradation protein 1 OS=Homo sapiens OX=9606 GN=UFD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	247-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	328-UNIMOD:21,330-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9BPZ7-5|SIN1_HUMAN	Isoform 5 of Target of rapamycin complex 2 subunit MAPKAP1 OS=Homo sapiens OX=9606 GN=MAPKAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	186-UNIMOD:21,185-UNIMOD:21	0.05	21.0	2	1	0
PRT	sp|P29374-3|ARI4A_HUMAN	Isoform III of AT-rich interactive domain-containing protein 4A OS=Homo sapiens OX=9606 GN=ARID4A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	863-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q969H4-2|CNKR1_HUMAN	Isoform 2 of Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	282-UNIMOD:21,293-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q8N4X5-2|AF1L2_HUMAN	Isoform 2 of Actin filament-associated protein 1-like 2 OS=Homo sapiens OX=9606 GN=AFAP1L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	344-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9Y210-2|TRPC6_HUMAN	Isoform 2 of Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	699-UNIMOD:21	0.02	21.0	1	1	0
PRT	sp|Q7Z3V4-2|UBE3B_HUMAN	Isoform 2 of Ubiquitin-protein ligase E3B OS=Homo sapiens OX=9606 GN=UBE3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	419-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q96Q42|ALS2_HUMAN	Alsin OS=Homo sapiens OX=9606 GN=ALS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	353-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9NP71-5|MLXPL_HUMAN	Isoform 5 of Carbohydrate-responsive element-binding protein OS=Homo sapiens OX=9606 GN=MLXIPL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	196-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|Q12873-2|CHD3_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens OX=9606 GN=CHD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	73-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|O94880-2|PHF14_HUMAN	Isoform 2 of PHD finger protein 14 OS=Homo sapiens OX=9606 GN=PHF14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	550-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q6DN12-3|MCTP2_HUMAN	Isoform 3 of Multiple C2 and transmembrane domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MCTP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	453-UNIMOD:4,457-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|O75385|ULK1_HUMAN	Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	556-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q8WUM0|NU133_HUMAN	Nuclear pore complex protein Nup133 OS=Homo sapiens OX=9606 GN=NUP133 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	67-UNIMOD:35,72-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	372-UNIMOD:35,381-UNIMOD:35,393-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P35580|MYH10_HUMAN	Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	948-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	1034-UNIMOD:21,1035-UNIMOD:35	0.01	21.0	3	2	1
PRT	sp|Q8IY33-3|MILK2_HUMAN	Isoform 3 of MICAL-like protein 2 OS=Homo sapiens OX=9606 GN=MICALL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	315-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q6P1L5|F117B_HUMAN	Protein FAM117B OS=Homo sapiens OX=9606 GN=FAM117B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	307-UNIMOD:21,319-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|P98175-4|RBM10_HUMAN	Isoform 4 of RNA-binding protein 10 OS=Homo sapiens OX=9606 GN=RBM10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	719-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	322-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|O43294-2|TGFI1_HUMAN	Isoform 2 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	386-UNIMOD:21,388-UNIMOD:4,391-UNIMOD:4	0.04	21.0	1	1	1
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	94-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q96FT9-3|IFT43_HUMAN	Isoform 3 of Intraflagellar transport protein 43 homolog OS=Homo sapiens OX=9606 GN=IFT43	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	78-UNIMOD:21	0.11	21.0	1	1	1
PRT	sp|Q9BTE7|DCNL5_HUMAN	DCN1-like protein 5 OS=Homo sapiens OX=9606 GN=DCUN1D5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	9-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|O94808|GFPT2_HUMAN	Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 2 OS=Homo sapiens OX=9606 GN=GFPT2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	244-UNIMOD:21,247-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|O15234|CASC3_HUMAN	Protein CASC3 OS=Homo sapiens OX=9606 GN=CASC3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	363-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q9P2R3|ANFY1_HUMAN	Rabankyrin-5 OS=Homo sapiens OX=9606 GN=ANKFY1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	270-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q2TAC6|KIF19_HUMAN	Kinesin-like protein KIF19 OS=Homo sapiens OX=9606 GN=KIF19 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	836-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O60303|K0556_HUMAN	Protein KIAA0556 OS=Homo sapiens OX=9606 GN=KIAA0556 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1164-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P13861-2|KAP2_HUMAN	Isoform 2 of cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	101-UNIMOD:4,104-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q99547|MPH6_HUMAN	M-phase phosphoprotein 6 OS=Homo sapiens OX=9606 GN=MPHOSPH6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	124-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	289-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	303-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|Q9BZE4-3|NOG1_HUMAN	Isoform 3 of Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	415-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|P33241-2|LSP1_HUMAN	Isoform 2 of Lymphocyte-specific protein 1 OS=Homo sapiens OX=9606 GN=LSP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	49-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P29590-4|PML_HUMAN	Isoform PML-6 of Protein PML OS=Homo sapiens OX=9606 GN=PML	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	8-UNIMOD:21,23-UNIMOD:35	0.05	21.0	1	1	0
PRT	sp|O43491|E41L2_HUMAN	Band 4.1-like protein 2 OS=Homo sapiens OX=9606 GN=EPB41L2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	598-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	391-UNIMOD:21,400-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|Q86UW9-2|DTX2_HUMAN	Isoform 2 of Probable E3 ubiquitin-protein ligase DTX2 OS=Homo sapiens OX=9606 GN=DTX2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	234-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q86UU1-2|PHLB1_HUMAN	Isoform 2 of Pleckstrin homology-like domain family B member 1 OS=Homo sapiens OX=9606 GN=PHLDB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	516-UNIMOD:21,47-UNIMOD:21	0.03	21.0	2	2	2
PRT	sp|Q8NE01-2|CNNM3_HUMAN	Isoform 2 of Metal transporter CNNM3 OS=Homo sapiens OX=9606 GN=CNNM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	652-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q7Z2W4-2|ZCCHV_HUMAN	Isoform 2 of Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens OX=9606 GN=ZC3HAV1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	513-UNIMOD:4,518-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q969H4|CNKR1_HUMAN	Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	289-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O95359|TACC2_HUMAN	Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	953-UNIMOD:4,962-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P14921|ETS1_HUMAN	Protein C-ets-1 OS=Homo sapiens OX=9606 GN=ETS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	282-UNIMOD:21	0.05	21.0	1	1	0
PRT	sp|Q7Z2Z1|TICRR_HUMAN	Treslin OS=Homo sapiens OX=9606 GN=TICRR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	865-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q8TF74|WIPF2_HUMAN	WAS/WASL-interacting protein family member 2 OS=Homo sapiens OX=9606 GN=WIPF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	174-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9Y210|TRPC6_HUMAN	Short transient receptor potential channel 6 OS=Homo sapiens OX=9606 GN=TRPC6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	815-UNIMOD:21	0.02	21.0	1	1	0
PRT	sp|Q99447|PCY2_HUMAN	Ethanolamine-phosphate cytidylyltransferase OS=Homo sapiens OX=9606 GN=PCYT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	163-UNIMOD:21,166-UNIMOD:35	0.04	21.0	1	1	1
PRT	sp|Q9BZ95|NSD3_HUMAN	Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	457-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|Q6UXY1|BI2L2_HUMAN	Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	334-UNIMOD:21	0.03	21.0	1	1	0
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	374-UNIMOD:21,379-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q6P1X5|TAF2_HUMAN	Transcription initiation factor TFIID subunit 2 OS=Homo sapiens OX=9606 GN=TAF2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	1188-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|O95793|STAU1_HUMAN	Double-stranded RNA-binding protein Staufen homolog 1 OS=Homo sapiens OX=9606 GN=STAU1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	278-UNIMOD:21	0.04	21.0	1	1	0
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	619-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9UHD8-7|SEPT9_HUMAN	Isoform 7 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPT9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	123-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q8NFJ5|RAI3_HUMAN	Retinoic acid-induced protein 3 OS=Homo sapiens OX=9606 GN=GPRC5A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	347-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P11021|BIP_HUMAN	Endoplasmic reticulum chaperone BiP OS=Homo sapiens OX=9606 GN=HSPA5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	332-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	634-UNIMOD:21,631-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|Q6UXY1-2|BI2L2_HUMAN	Isoform 2 of Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 OS=Homo sapiens OX=9606 GN=BAIAP2L2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	334-UNIMOD:21	0.03	20.0	1	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	118-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P27448-8|MARK3_HUMAN	Isoform 7 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	39-UNIMOD:4,42-UNIMOD:21,46-UNIMOD:4,339-UNIMOD:21	0.06	20.0	2	2	2
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	418-UNIMOD:21	0.03	20.0	1	1	0
PRT	sp|Q8WXH0-7|SYNE2_HUMAN	Isoform 7 of Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	2773-UNIMOD:21,2779-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|P42166|LAP2A_HUMAN	Lamina-associated polypeptide 2, isoform alpha OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	74-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q16513-5|PKN2_HUMAN	Isoform 5 of Serine/threonine-protein kinase N2 OS=Homo sapiens OX=9606 GN=PKN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	632-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P25054-2|APC_HUMAN	Isoform 2 of Adenomatous polyposis coli protein OS=Homo sapiens OX=9606 GN=APC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	693-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q8NI27-2|THOC2_HUMAN	Isoform 2 of THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	337-UNIMOD:21,339-UNIMOD:4	0.04	20.0	1	1	1
PRT	sp|Q9H6U6-6|BCAS3_HUMAN	Isoform 6 of Breast carcinoma-amplified sequence 3 OS=Homo sapiens OX=9606 GN=BCAS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	604-UNIMOD:35,605-UNIMOD:21,607-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1859-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q14155-2|ARHG7_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 7 OS=Homo sapiens OX=9606 GN=ARHGEF7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	103-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q2KHM9-2|MOONR_HUMAN	Isoform 2 of Protein moonraker OS=Homo sapiens OX=9606 GN=KIAA0753	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	527-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P51956-2|NEK3_HUMAN	Isoform 2 of Serine/threonine-protein kinase Nek3 OS=Homo sapiens OX=9606 GN=NEK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	337-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	5-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q92622-3|RUBIC_HUMAN	Isoform 3 of Run domain Beclin-1-interacting and cysteine-rich domain-containing protein OS=Homo sapiens OX=9606 GN=RUBCN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	197-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q8N1S5-2|S39AB_HUMAN	Isoform 2 of Zinc transporter ZIP11 OS=Homo sapiens OX=9606 GN=SLC39A11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	125-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|Q9BZI7-2|REN3B_HUMAN	Isoform 2 of Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	297-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q5T5C0-2|STXB5_HUMAN	Isoform 2 of Syntaxin-binding protein 5 OS=Homo sapiens OX=9606 GN=STXBP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	723-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9UKA4|AKA11_HUMAN	A-kinase anchor protein 11 OS=Homo sapiens OX=9606 GN=AKAP11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	428-UNIMOD:4,433-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9HCH5-15|SYTL2_HUMAN	Isoform 12 of Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	12-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	44-UNIMOD:21	0.24	20.0	2	1	0
PRT	sp|A1A5D9-2|BICL2_HUMAN	Isoform 2 of BICD family-like cargo adapter 2 OS=Homo sapiens OX=9606 GN=BICDL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	141-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	594-UNIMOD:21,602-UNIMOD:35,608-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q14526-2|HIC1_HUMAN	Isoform 2 of Hypermethylated in cancer 1 protein OS=Homo sapiens OX=9606 GN=HIC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	229-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q8TEH3-7|DEN1A_HUMAN	Isoform 7 of DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	708-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q09161|NCBP1_HUMAN	Nuclear cap-binding protein subunit 1 OS=Homo sapiens OX=9606 GN=NCBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	21-UNIMOD:21,36-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q13237-2|KGP2_HUMAN	Isoform 2 of cGMP-dependent protein kinase 2 OS=Homo sapiens OX=9606 GN=PRKG2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	110-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q7Z406-4|MYH14_HUMAN	Isoform 4 of Myosin-14 OS=Homo sapiens OX=9606 GN=MYH14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	220-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P17302|CXA1_HUMAN	Gap junction alpha-1 protein OS=Homo sapiens OX=9606 GN=GJA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	364-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q92859-3|NEO1_HUMAN	Isoform 3 of Neogenin OS=Homo sapiens OX=9606 GN=NEO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1178-UNIMOD:21,1185-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	18-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P06702|S10A9_HUMAN	Protein S100-A9 OS=Homo sapiens OX=9606 GN=S100A9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.12	20.0	1	1	1
PRT	sp|Q5JNZ5|RS26L_HUMAN	Putative 40S ribosomal protein S26-like 1 OS=Homo sapiens OX=9606 GN=RPS26P11 PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	74-UNIMOD:4,76-UNIMOD:21,77-UNIMOD:4	0.11	20.0	1	1	1
PRT	sp|Q9UPS6-2|SET1B_HUMAN	Isoform 2 of Histone-lysine N-methyltransferase SETD1B OS=Homo sapiens OX=9606 GN=SETD1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	994-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q5VWQ8-3|DAB2P_HUMAN	Isoform 3 of Disabled homolog 2-interacting protein OS=Homo sapiens OX=9606 GN=DAB2IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	838-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q8NFH8-3|REPS2_HUMAN	Isoform 3 of RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens OX=9606 GN=REPS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	77-UNIMOD:21,82-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|P48730-2|KC1D_HUMAN	Isoform 2 of Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	395-UNIMOD:35,401-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q8TF74-2|WIPF2_HUMAN	Isoform 2 of WAS/WASL-interacting protein family member 2 OS=Homo sapiens OX=9606 GN=WIPF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	235-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q8NC74|RB8NL_HUMAN	RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	466-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q9Y6X9-2|MORC2_HUMAN	Isoform 2 of MORC family CW-type zinc finger protein 2 OS=Homo sapiens OX=9606 GN=MORC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	553-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q96PE2|ARHGH_HUMAN	Rho guanine nucleotide exchange factor 17 OS=Homo sapiens OX=9606 GN=ARHGEF17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	43-UNIMOD:21,44-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P12110|CO6A2_HUMAN	Collagen alpha-2(VI) chain OS=Homo sapiens OX=9606 GN=COL6A2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9ULG1|INO80_HUMAN	Chromatin-remodeling ATPase INO80 OS=Homo sapiens OX=9606 GN=INO80 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	240-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P49760-2|CLK2_HUMAN	Isoform 2 of Dual specificity protein kinase CLK2 OS=Homo sapiens OX=9606 GN=CLK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	50-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|Q2VIR3|IF2GL_HUMAN	Eukaryotic translation initiation factor 2 subunit 3B OS=Homo sapiens OX=9606 GN=EIF2S3B PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P50750|CDK9_HUMAN	Cyclin-dependent kinase 9 OS=Homo sapiens OX=9606 GN=CDK9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	347-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O95359-3|TACC2_HUMAN	Isoform 3 of Transforming acidic coiled-coil-containing protein 2 OS=Homo sapiens OX=9606 GN=TACC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	2072-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|A2A3K4|PTPC1_HUMAN	Protein tyrosine phosphatase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PTPDC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	392-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	515-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9BQF6-5|SENP7_HUMAN	Isoform 5 of Sentrin-specific protease 7 OS=Homo sapiens OX=9606 GN=SENP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	11-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q765P7|MTSSL_HUMAN	MTSS1-like protein OS=Homo sapiens OX=9606 GN=MTSS1L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	569-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q96AX9-9|MIB2_HUMAN	Isoform 9 of E3 ubiquitin-protein ligase MIB2 OS=Homo sapiens OX=9606 GN=MIB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	309-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P22087|FBRL_HUMAN	rRNA 2'-O-methyltransferase fibrillarin OS=Homo sapiens OX=9606 GN=FBL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	124-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	6-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P12643|BMP2_HUMAN	Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	117-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|Q13233|M3K1_HUMAN	Mitogen-activated protein kinase kinase kinase 1 OS=Homo sapiens OX=9606 GN=MAP3K1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	507-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P51787-2|KCNQ1_HUMAN	Isoform 2 of Potassium voltage-gated channel subfamily KQT member 1 OS=Homo sapiens OX=9606 GN=KCNQ1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	282-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9Y4K1|CRBG1_HUMAN	Beta/gamma crystallin domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CRYBG1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	103-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q5VZK9-2|CARL1_HUMAN	Isoform 2 of F-actin-uncapping protein LRRC16A OS=Homo sapiens OX=9606 GN=CARMIL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1088-UNIMOD:35,1094-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q2LD37-6|K1109_HUMAN	Isoform 6 of Transmembrane protein KIAA1109 OS=Homo sapiens OX=9606 GN=KIAA1109	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	3619-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|Q92614-5|MY18A_HUMAN	Isoform 5 of Unconventional myosin-XVIIIa OS=Homo sapiens OX=9606 GN=MYO18A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1541-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q5BJD5-3|TM41B_HUMAN	Isoform 3 of Transmembrane protein 41B OS=Homo sapiens OX=9606 GN=TMEM41B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	18-UNIMOD:21	0.16	20.0	1	1	1
PRT	sp|Q96JH7|VCIP1_HUMAN	Deubiquitinating protein VCIP135 OS=Homo sapiens OX=9606 GN=VCPIP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	998-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O94988|FA13A_HUMAN	Protein FAM13A OS=Homo sapiens OX=9606 GN=FAM13A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	287-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	424-UNIMOD:21,431-UNIMOD:4	0.02	20.0	1	1	1
PRT	sp|Q8TE67-2|ES8L3_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	229-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O94886|CSCL1_HUMAN	CSC1-like protein 1 OS=Homo sapiens OX=9606 GN=TMEM63A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	739-UNIMOD:21,745-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	281-UNIMOD:21	0.05	20.0	1	1	0
PRT	sp|P32519-2|ELF1_HUMAN	Isoform 2 of ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	166-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P16383-3|GCFC2_HUMAN	Isoform 3 of GC-rich sequence DNA-binding factor 2 OS=Homo sapiens OX=9606 GN=GCFC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	107-UNIMOD:21	0.09	20.0	1	1	1
PRT	sp|P30414|NKTR_HUMAN	NK-tumor recognition protein OS=Homo sapiens OX=9606 GN=NKTR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	866-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q8WXX7-5|AUTS2_HUMAN	Isoform 5 of Autism susceptibility gene 2 protein OS=Homo sapiens OX=9606 GN=AUTS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	654-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q5VV67-2|PPRC1_HUMAN	Isoform 2 of Peroxisome proliferator-activated receptor gamma coactivator-related protein 1 OS=Homo sapiens OX=9606 GN=PPRC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	943-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9NVZ3-4|NECP2_HUMAN	Isoform 4 of Adaptin ear-binding coat-associated protein 2 OS=Homo sapiens OX=9606 GN=NECAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	156-UNIMOD:21,155-UNIMOD:21	0.08	20.0	2	1	0
PRT	sp|Q86VM9|ZCH18_HUMAN	Zinc finger CCCH domain-containing protein 18 OS=Homo sapiens OX=9606 GN=ZC3H18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	842-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9ULH0|KDIS_HUMAN	Kinase D-interacting substrate of 220 kDa OS=Homo sapiens OX=9606 GN=KIDINS220 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	1163-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9BZL6|KPCD2_HUMAN	Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	199-UNIMOD:21	0.02	20.0	1	1	0
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	80-UNIMOD:28,82-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P61073|CXCR4_HUMAN	C-X-C chemokine receptor type 4 OS=Homo sapiens OX=9606 GN=CXCR4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	338-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	51-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P19338|NUCL_HUMAN	Nucleolin OS=Homo sapiens OX=9606 GN=NCL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	67-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.02	20.0	1	1	1
PRT	sp|Q5T8P6|RBM26_HUMAN	RNA-binding protein 26 OS=Homo sapiens OX=9606 GN=RBM26 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	127-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q6AWC2|WWC2_HUMAN	Protein WWC2 OS=Homo sapiens OX=9606 GN=WWC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	420-UNIMOD:21,421-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q99618|CDCA3_HUMAN	Cell division cycle-associated protein 3 OS=Homo sapiens OX=9606 GN=CDCA3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	68-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|Q9UK53|ING1_HUMAN	Inhibitor of growth protein 1 OS=Homo sapiens OX=9606 GN=ING1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q5T7B8|KIF24_HUMAN	Kinesin-like protein KIF24 OS=Homo sapiens OX=9606 GN=KIF24 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	583-UNIMOD:4,584-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q3V6T2|GRDN_HUMAN	Girdin OS=Homo sapiens OX=9606 GN=CCDC88A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	1820-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9Y6M7|S4A7_HUMAN	Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	556-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P31629|ZEP2_HUMAN	Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	464-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|O15355|PPM1G_HUMAN	Protein phosphatase 1G OS=Homo sapiens OX=9606 GN=PPM1G PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q6ZNE9|RUFY4_HUMAN	RUN and FYVE domain-containing protein 4 OS=Homo sapiens OX=9606 GN=RUFY4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	317-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O00461|GOLI4_HUMAN	Golgi integral membrane protein 4 OS=Homo sapiens OX=9606 GN=GOLIM4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	673-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|A6NEL2|SWAHB_HUMAN	Ankyrin repeat domain-containing protein SOWAHB OS=Homo sapiens OX=9606 GN=SOWAHB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	258-UNIMOD:21	0.04	20.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	1	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	42	10-UNIMOD:21	ms_run[2]:scan=8492	46.1	3	2671.2239	2671.2239	K	Q	710	737
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	2	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	41	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15394	87.22483833333332	3	3442.4026	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	3	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14926	84.15407666666667	3	3442.4010	3442.4027	K	L	104	135
PSM	KKEDDDGEIDDGEIDDDDLEEGEVK	4	sp|Q86VM9-2|ZCH18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39		ms_run[2]:scan=11427	62.481	3	2821.1785	2821.1785	K	D	187	212
PSM	KMPQLTASAIVSPHGDESPR	5	sp|Q9Y6J9|TAF6L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	2-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=9947	54.175	2	2216.0297	2216.0297	R	G	484	504
PSM	RQVSASELHTSGILGPETLR	6	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	4-UNIMOD:21	ms_run[2]:scan=14192	79.446	2	2230.1107	2230.1107	R	D	2715	2735
PSM	SLNSTPPPPPAPAPAPPPALAR	7	sp|Q8TE68-4|ES8L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	5-UNIMOD:21	ms_run[2]:scan=12705	70.151	2	2195.114	2195.1140	R	P	328	350
PSM	HQASDSENEELPKPR	8	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	6-UNIMOD:21	ms_run[2]:scan=4162	22.354	2	1815.7789	1815.7789	R	I	232	247
PSM	KPLTSSSAAPQRPISTQR	9	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	5-UNIMOD:21	ms_run[2]:scan=5086	27.34	2	2004.0154	2004.0154	K	T	151	169
PSM	RLSGGSHSYGGESPR	10	sp|Q13905-2|RPGF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21	ms_run[2]:scan=2786	15.475	2	1625.6947	1625.6947	R	L	294	309
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	11	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	38	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15553	88.22904833333332	3	3442.4016	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	12	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16316	93.35595333333333	3	3442.4005	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	13	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16002	91.265095	3	3442.3940	3442.4027	K	L	104	135
PSM	AAEDDEDDDVDTKK	14	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1186	7.7956	2	1564.6377	1564.6377	R	Q	90	104
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	15	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	28-UNIMOD:21	ms_run[2]:scan=10381	56.601	3	3407.6452	3407.6452	R	N	577	608
PSM	DLHQPSLSPASPHSQGFER	16	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	8-UNIMOD:21	ms_run[2]:scan=10420	56.814	2	2168.964	2168.9640	K	G	16	35
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	17	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	10-UNIMOD:21	ms_run[2]:scan=8660	47.107	3	2671.2239	2671.2239	K	Q	710	737
PSM	HIKEEPLSEEEPCTSTAIASPEK	18	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10442	56.939	2	2661.1881	2661.1881	K	K	495	518
PSM	KEEEEEEEEYDEGSNLKK	19	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=5192	27.871	2	2212.9495	2212.9495	K	Q	230	248
PSM	KPLTSSSAAPQRPISTQR	20	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	15-UNIMOD:21	ms_run[2]:scan=4501	24.143	2	2004.0154	2004.0154	K	T	151	169
PSM	KQSLGELIGTLNAAK	21	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=17597	102.22	2	1621.844	1621.8440	R	V	19	34
PSM	KSNLDEEVNVIPPHTPVR	22	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	15-UNIMOD:21	ms_run[2]:scan=11388	62.267	2	2123.0412	2123.0412	R	T	359	377
PSM	RHGSMVSLVSGASGYSATSTSSFK	23	sp|Q9Y5P4-2|C43BP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	4-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=11669	63.9	3	2499.1101	2499.1101	R	K	129	153
PSM	RHTVEDAVVSQGPEAAGPLSTPQEVSASR	24	sp|Q96NW4|ANR27_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	3-UNIMOD:21	ms_run[2]:scan=12587	69.436	3	3054.4408	3054.4408	R	S	1021	1050
PSM	SSSISEEKGDSDDEKPR	25	sp|Q9UKV3|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1254	8.0891	2	1864.8286	1864.8286	K	K	206	223
PSM	VLGAFSDGLAHLDNLK	26	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=17912	104.43	2	1668.8835	1668.8835	K	G	68	84
PSM	DPDAQPGGELMLGGTDSK	27	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:35	ms_run[2]:scan=9909	53.974	2	1802.7993	1802.7993	R	Y	236	254
PSM	IHIDPEIQDGSPTTSR	28	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:21	ms_run[2]:scan=10163	55.374	2	1844.8306	1844.8306	R	R	102	118
PSM	KEEEEEEEEYDEGSNLKK	29	sp|Q14165|MLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=5179	27.814	3	2212.9495	2212.9495	K	Q	230	248
PSM	LEQPEEDKYSKPTAPAPSAPPSPSAPEPPK	30	sp|P55198|AF17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	22-UNIMOD:21	ms_run[2]:scan=9540	51.883	3	3221.517	3221.5170	K	A	361	391
PSM	NKPGPNIESGNEDDDASFK	31	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	9-UNIMOD:21	ms_run[2]:scan=8373	45.415	2	2112.8637	2112.8637	K	I	206	225
PSM	RKPSPEPEGEVGPPK	32	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:21	ms_run[2]:scan=3931	21.199	2	1682.8029	1682.8029	K	I	341	356
PSM	SEVQQPVHPKPLSPDSR	33	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	13-UNIMOD:21	ms_run[2]:scan=6391	34.22	2	1979.9466	1979.9466	K	A	350	367
PSM	QVSASELHTSGILGPETLR	34	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=18113	105.84997166666666	2	2056.9819	2056.9825	R	D	2716	2735
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	35	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16468	94.40236833333333	3	3442.4014	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	36	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=17404	100.89598666666667	3	3442.4014	3442.4027	K	L	104	135
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	37	sp|Q0ZGT2|NEXN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=5975	31.982745	3	3008.170326	3007.187379	K	S	554	579
PSM	KMSDDEDDDEEEYGKEEHEK	38	sp|Q7KZ85|SPT6H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	2-UNIMOD:35,3-UNIMOD:21	ms_run[1]:scan=2793	15.500283333333334	3	2552.908605	2551.905784	K	E	123	143
PSM	KLSVPTSDEEDEVPAPKPR	39	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	7-UNIMOD:21	ms_run[2]:scan=10109	55.069	2	2173.0304	2173.0304	K	G	103	122
PSM	RGSLCSGCQKPITGR	40	sp|P49023-4|PAXI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21,5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=3668	19.874	2	1755.791	1755.7910	R	C	364	379
PSM	RLSTSPDVIQGHQPR	41	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21	ms_run[2]:scan=7246	39.125	2	1769.8574	1769.8574	R	D	264	279
PSM	RPAHPILATADGASQLVGME	42	sp|Q92766-5|RREB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	14-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=13785	76.832	2	2128.9977	2128.9977	K	-	1402	1422
PSM	RPASPSHNGSSGGGYGASK	43	sp|Q6PI98|IN80C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	4-UNIMOD:21	ms_run[2]:scan=906	6.677	2	1852.7854	1852.7854	K	K	23	42
PSM	SHVSSEPYEPISPPQVPVVHEK	44	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	12-UNIMOD:21	ms_run[2]:scan=14121	78.984	2	2521.189	2521.1890	R	Q	2037	2059
PSM	SLVHEVGKPPQDVTDDSPPSK	45	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:21	ms_run[2]:scan=8666	47.137	3	2311.0733	2311.0733	R	K	1206	1227
PSM	TGSGGPGNHPHGPDASAEGLNPYGLVAPR	46	sp|Q86UX7-2|URP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	1-UNIMOD:21	ms_run[2]:scan=14436	80.938	3	2861.2882	2861.2882	R	F	478	507
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	47	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16164	92.29077	3	3442.4014	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	48	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15086	85.18715999999999	3	3442.4019	3442.4027	K	L	104	135
PSM	AHSSPASLQLGAVSPGTLTPTGVVSGPAATPTAQHLR	49	sp|P46937-5|YAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=16961	97.807	3	3613.8254	3613.8254	R	Q	125	162
PSM	HREDSDVEMVEDDSR	50	sp|P40692-2|MLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=5658	30.307	2	1913.7099	1913.7099	R	K	232	247
PSM	HSPQPSPSSSFNEGLLTGGHR	51	sp|Q9Y2J4-3|AMOL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	2-UNIMOD:21	ms_run[2]:scan=12215	67.131	3	2271.007	2271.0070	R	H	599	620
PSM	HVFGESDELIGQK	52	sp|P60174-1|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=10346	56.419	2	1457.7151	1457.7151	R	V	101	114
PSM	KVEEEQEADEEDVSEEEAESK	53	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	14-UNIMOD:21	ms_run[2]:scan=6384	34.185	3	2516.9803	2516.9803	K	E	234	255
PSM	PGAEGAPLLPPPLPPPSPPGSGR	54	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:21	ms_run[2]:scan=16703	96.038	2	2237.1246	2237.1246	R	G	27	50
PSM	RAAEDDEDDDVDTKK	55	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=899	6.6517	2	1720.7388	1720.7388	K	Q	89	104
PSM	RVEHNQSYSQAGITETEWTSGSSK	56	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	9-UNIMOD:21	ms_run[2]:scan=10677	58.216	3	2761.1981	2761.1981	R	G	216	240
PSM	SAPTAPTPPPPPPPATPR	57	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	7-UNIMOD:21	ms_run[2]:scan=8551	46.46	2	1827.892	1827.8921	R	K	799	817
PSM	TKPIVKPQTSPEYGQGINPISR	58	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:21	ms_run[2]:scan=10954	59.758	2	2489.2679	2489.2679	K	L	188	210
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	59	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=24093	151.0751833333333	3	3442.4011	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	60	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16975	97.90008333333334	3	3442.4018	3442.4027	K	L	104	135
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	61	sp|Q8N122|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33	10-UNIMOD:21	ms_run[1]:scan=8986	48.825215	3	2672.209042	2671.223903	K	Q	868	895
PSM	TIDLGAAAHYTGDKASPDQNASTHTPQSSVK	62	sp|Q14677|EPN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33	16-UNIMOD:21	ms_run[1]:scan=10844	59.150484999999996	3	3248.462581	3247.478280	K	T	284	315
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	63	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	10-UNIMOD:21	ms_run[2]:scan=12781	70.578	3	2574.2228	2574.2228	K	K	408	434
PSM	ADEASEGDSPAPARPEDTPPAPPPPPAR	64	sp|Q6PJ61|FBX46_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=8467	45.96	3	2871.2712	2871.2712	R	D	330	358
PSM	DASDDLDDLNFFNQK	65	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=19161	113.33	2	1755.7588	1755.7588	K	K	65	80
PSM	DRSSPPPGYIPDELHQVAR	66	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=13372	74.24	3	2213.0266	2213.0266	R	N	161	180
PSM	FLQEHGSDSFLAEHK	67	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:21	ms_run[2]:scan=11376	62.19	2	1823.788	1823.7880	K	L	28	43
PSM	HGSFHEDEDPIGSPR	68	sp|Q96T58|MINT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=7544	40.8	2	1758.6999	1758.6999	R	L	1266	1281
PSM	KDDTDDEIAKYDGK	69	sp|P27824|CALX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5701	30.546	2	1611.7264	1611.7264	K	W	90	104
PSM	LKDQDQDEDEEEKEK	70	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=934	6.7874	2	1876.8174	1876.8174	R	R	182	197
PSM	NVAEALGHSPKDPGGGGGPVR	71	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	9-UNIMOD:21	ms_run[2]:scan=7671	41.469	2	2050.9586	2050.9586	K	A	428	449
PSM	PRPTEATVSLSSLVDYPHQAR	72	sp|Q92619|HMHA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	11-UNIMOD:21	ms_run[2]:scan=16955	97.761	3	2403.1584	2403.1584	R	V	941	962
PSM	RAAEDDEDDDVDTKK	73	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=894	6.6332	3	1720.7388	1720.7388	K	Q	89	104
PSM	RADDFPVRDDPSDVTDEDEGPAEPPPPPK	74	sp|Q3YEC7|RABL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=11872	65.086	3	3319.3595	3319.3595	R	L	585	614
PSM	RHTSAEEEEPPPVK	75	sp|Q9BZ95-3|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=2535	14.272	2	1684.7458	1684.7458	R	I	454	468
PSM	RISHSLYSGIEGLDESPSR	76	sp|Q8TEW0-9|PARD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=14230	79.677	2	2182.0056	2182.0056	R	N	700	719
PSM	RLPALSHSEGEEDEDEEEDEGK	77	sp|P55201-4|BRPF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	8-UNIMOD:21	ms_run[2]:scan=7806	42.2	3	2579.0184	2579.0184	R	G	455	477
PSM	RSPVSPQLQQQHQAAAAAFLQQR	78	sp|Q7Z5Q1-7|CPEB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	2-UNIMOD:21	ms_run[2]:scan=12763	70.478	3	2639.3082	2639.3082	R	N	66	89
PSM	SAPTAPTPPPPPPPATPR	79	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:21	ms_run[2]:scan=8379	45.449	2	1827.892	1827.8921	R	K	799	817
PSM	SHVSSEPYEPISPPQVPVVHEK	80	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:21	ms_run[2]:scan=13823	77.084	3	2521.189	2521.1890	R	Q	2037	2059
PSM	WAHDKFSGEEGEIEDDESGTENR	81	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:21	ms_run[2]:scan=11261	61.516	3	2716.0562	2716.0562	K	E	922	945
PSM	IYHLPDAESDEDEDFK	82	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	9-UNIMOD:21	ms_run[1]:scan=13699	76.28614166666667	2	2002.790742	2001.788099	K	E	210	226
PSM	RRTCETGEPMEAESGDTSSEGPAQVYLPGR	83	sp|Q9BQ67|GRWD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	3-UNIMOD:21,4-UNIMOD:4,10-UNIMOD:35	ms_run[1]:scan=11262	61.52002333333333	3	3361.414484	3362.418065	R	G	8	38
PSM	SRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVK	84	sp|Q00013|EM55_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	17-UNIMOD:35,27-UNIMOD:21	ms_run[1]:scan=11296	61.71268166666667	3	3433.547782	3432.565715	R	G	31	63
PSM	AHSLMELSPSAPPGGSPHLDSSR	85	sp|Q13586|STIM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=10574	57.663	3	2425.0733	2425.0733	K	S	593	616
PSM	EQLEEEEEAKHNLEK	86	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=6524	34.931	2	1853.8643	1853.8643	R	Q	1343	1358
PSM	GVPHPEDDHSQVEGPESLR	87	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:21	ms_run[2]:scan=8293	44.985	2	2163.9222	2163.9222	K	-	679	698
PSM	HFIDVGAGVIDEDYR	88	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=15155	85.643	2	1704.8107	1704.8107	K	G	92	107
PSM	HNPSIGEGSVGGLTGSLSASGSHMDR	89	sp|Q9NV58-2|RN19A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	20-UNIMOD:21,24-UNIMOD:35	ms_run[2]:scan=11857	65.001	3	2605.1228	2605.1228	R	I	499	525
PSM	KHVTTAEGTPGTTDQEGPPPDGPPEK	90	sp|O14497-3|ARI1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:21	ms_run[2]:scan=4993	26.823	3	2722.2123	2722.2123	R	R	1497	1523
PSM	KLSVPTSDEEDEVPAPKPR	91	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21	ms_run[2]:scan=9703	52.82	3	2173.0304	2173.0304	K	G	103	122
PSM	KNQDDDDDDDDGFFGPALPPGFK	92	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=18003	105.07	3	2524.0666	2524.0666	R	K	78	101
PSM	KNSEPGSPHSLEALR	93	sp|Q9ULC5-3|ACSL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=8078	43.77	2	1700.7883	1700.7883	R	D	26	41
PSM	KPRPSEGDEDCLPASK	94	sp|P78346|RPP30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3632	19.718	3	1864.8026	1864.8026	K	K	247	263
PSM	KPRPSEGDEDCLPASK	95	sp|P78346|RPP30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3836	20.742	3	1864.8026	1864.8026	K	K	247	263
PSM	KVLSPTAAKPSPFEGK	96	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=8764	47.662	2	1735.891	1735.8910	K	T	310	326
PSM	LGSVTHVTSFSHAPPSSR	97	sp|P53814-2|SMTN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=9478	51.521	2	1945.9047	1945.9047	R	G	65	83
PSM	LKDLFDYSPPLHK	98	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:21	ms_run[2]:scan=15616	88.614	2	1651.8011	1651.8011	K	N	503	516
PSM	PGAEGAPLLPPPLPPPSPPGSGR	99	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:21	ms_run[2]:scan=16545	94.936	2	2237.1246	2237.1246	R	G	27	50
PSM	PTSQHYTNPTSNPVPASPINFHPESR	100	sp|Q6N043-3|Z280D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:21	ms_run[2]:scan=12509	68.967	3	2954.3348	2954.3348	K	S	88	114
PSM	RAPSVANVGSHCDLSLK	101	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9922	54.042	2	1889.8819	1889.8819	R	I	2141	2158
PSM	RGPGYTSGTNSEASNASETESDHR	102	sp|Q06787-2|FMR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	17-UNIMOD:21	ms_run[2]:scan=3212	17.612	3	2589.0365	2589.0365	R	D	463	487
PSM	RLSSTSLASGHSVR	103	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=5435	29.129	2	1536.741	1536.7410	R	L	38	52
PSM	RPASVSSSAAVEHEQR	104	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=3146	17.311	2	1789.8108	1789.8108	K	E	237	253
PSM	RQDDATGAGQDSENEVSLVSGHQR	105	sp|P16157-10|ANK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=7912	42.788	3	2635.126	2635.1260	K	G	1655	1679
PSM	RQVSASELHTSGILGPETLR	106	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=14147	79.141	3	2230.1107	2230.1107	R	D	2715	2735
PSM	RRSTDSSSVSGSLQQETK	107	sp|Q9H8G2|CAAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=4657	24.992	3	2031.9222	2031.9222	K	Y	87	105
PSM	RVEHNQSYSQAGITETEWTSGSSK	108	sp|P42167|LAP2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	7-UNIMOD:21	ms_run[2]:scan=10489	57.203	3	2761.1981	2761.1981	R	G	216	240
PSM	RVSHQGYSTEAEFEEPR	109	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:21	ms_run[2]:scan=8581	46.632	3	2100.8902	2100.8902	R	V	240	257
PSM	SLSSSLQAPVVSTVGMQR	110	sp|P35900|K1C20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=15263	86.347	2	1941.9231	1941.9231	R	L	11	29
PSM	VIPAKSPPPPTHSTQLGAPSR	111	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21	ms_run[2]:scan=6806	36.609	3	2217.1307	2217.1307	K	K	200	221
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	112	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15706	89.23844166666666	3	3444.4062	3442.4022	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	113	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14076	78.71587833333334	3	3442.4027	3442.4027	K	L	104	135
PSM	EKEKEDDEEEEDEDASGGDQDQEER	114	sp|O60216|RAD21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1844	10.648045	3	2940.120985	2939.118416	K	R	530	555
PSM	QESCSPHHPQVLAQQGSGSSPK	115	sp|Q8N1G0|ZN687_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28,4-UNIMOD:4,20-UNIMOD:21	ms_run[1]:scan=5900	31.620468333333335	3	2408.0207	2408.0211	K	A	223	245
PSM	KVEEEDEEEEEEEEEEEEEEDE	116	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=6553	35.08461166666667	2	2798.047436	2797.994504	K	-	179	201
PSM	APTVPPPLPPTPPQPAR	117	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=12389	68.224	2	1811.9335	1811.9335	R	R	616	633
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	118	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=12748	70.406	3	3459.4297	3459.4297	K	L	104	135
PSM	DRDDFPVVLVGNK	119	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=14216	79.603	2	1472.7623	1472.7623	K	A	131	144
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	120	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21	ms_run[2]:scan=8314	45.093	3	2671.2239	2671.2239	K	Q	710	737
PSM	HIKEEPLSEEEPCTSTAIASPEK	121	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10488	57.201	3	2661.1881	2661.1881	K	K	495	518
PSM	HLDVDLDRQSLSSIDK	122	sp|Q9Y6D5|BIG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21	ms_run[2]:scan=12891	71.227	2	1919.899	1919.8990	K	N	1502	1518
PSM	HLEHAPSPSDVSNAPEVK	123	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21	ms_run[2]:scan=8121	44.024	3	1992.8942	1992.8942	K	A	439	457
PSM	HREDSDVEMVEDDSR	124	sp|P40692-2|MLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=5843	31.315	2	1913.7099	1913.7099	R	K	232	247
PSM	IEDVGSDEEDDSGKDK	125	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=3251	17.787	2	1816.6888	1816.6888	K	K	250	266
PSM	KKSPNELVDDLFK	126	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=16192	92.472	2	1611.7909	1611.7909	R	G	112	125
PSM	KRDSDAGSSTPTTSTR	127	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=811	6.3131	2	1745.7581	1745.7581	R	S	1381	1397
PSM	KREDDDDDDDDDDDYDNL	128	sp|Q16594|TAF9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7686	41.551	2	2201.7629	2201.7629	R	-	247	265
PSM	LKDLFDYSPPLHK	129	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21	ms_run[2]:scan=15764	89.623	2	1651.8011	1651.8011	K	N	503	516
PSM	LKDQDQDEDEEEKEK	130	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=927	6.7627	3	1876.8174	1876.8174	R	R	182	197
PSM	LKEEHGIELSSPR	131	sp|O14647-2|CHD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=6779	36.458	2	1573.7501	1573.7501	R	H	1355	1368
PSM	LLKPGEEPSEYTDEEDTK	132	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=8813	47.904	3	2158.9195	2158.9195	R	D	200	218
PSM	MGHAGAIIAGGK	133	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:35	ms_run[2]:scan=2498	14.067	2	1097.5652	1097.5652	R	G	297	309
PSM	PAAPAAHSAHSASVSPVESR	134	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:21	ms_run[2]:scan=3627	19.694	3	2007.9164	2007.9164	R	G	879	899
PSM	PAAPAAHSAHSASVSPVESR	135	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:21	ms_run[2]:scan=3650	19.8	2	2007.9164	2007.9164	R	G	879	899
PSM	PARPNLSGSSAGSPLSGLGGEGPGESEK	136	sp|Q9Y6C2|EMIL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12349	67.99	3	2594.2572	2594.2572	R	V	150	178
PSM	PFSPPIHSSSPPPIAPLAR	137	sp|Q9BQI5-4|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21	ms_run[2]:scan=15359	86.979	3	2047.0292	2047.0292	R	A	285	304
PSM	PFSPPIHSSSPPPIAPLAR	138	sp|Q9BQI5-4|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21	ms_run[2]:scan=15512	87.984	3	2047.0292	2047.0292	R	A	285	304
PSM	PGAEGAPLLPPPLPPPSPPGSGR	139	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:21	ms_run[2]:scan=16905	97.407	2	2237.1246	2237.1246	R	G	27	50
PSM	RAAEDDEDDDVDTK	140	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=1331	8.3972	2	1592.6438	1592.6438	K	K	89	103
PSM	RHSTEGEEGDVSDVGSR	141	sp|Q8TF61|FBX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=3203	17.573	2	1895.7647	1895.7647	R	T	476	493
PSM	RHSTEGEEGDVSDVGSR	142	sp|Q8TF61|FBX41_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=3205	17.586	3	1895.7647	1895.7647	R	T	476	493
PSM	RHTVEDAVVSQGPEAAGPLSTPQEVSASR	143	sp|Q96NW4|ANR27_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=12770	70.514	3	3054.4408	3054.4408	R	S	1021	1050
PSM	RKPSVPDSASPADDSFVDPGER	144	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=10870	59.301	3	2408.0645	2408.0645	K	L	18	40
PSM	RKSLSDSESDDSK	145	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=759	6.0975	2	1532.6356	1532.6356	K	S	91	104
PSM	RSSKEEAEMAYK	146	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1294	8.2473	2	1523.6327	1523.6327	K	D	733	745
PSM	SHLVHGSSPGVMGTSVATSASK	147	sp|P35658-2|NU214_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=5526	29.644	3	2191.9933	2191.9933	K	I	1027	1049
PSM	SHVSSEPYEPISPPQVPVVHEK	148	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=13981	78.092	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SRPFTVAASFQSTSVKSPK	149	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:21	ms_run[2]:scan=11622	63.638	3	2104.0354	2104.0354	R	T	588	607
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	150	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:21	ms_run[2]:scan=9032	49.092	3	3112.5078	3112.5078	R	S	818	847
PSM	VAHSDKPGSTSTASFR	151	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=3336	18.25	2	1726.7676	1726.7676	K	D	206	222
PSM	VGAHAGEYGAEALER	152	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=7751	41.885	2	1528.727	1528.7270	K	M	18	33
PSM	VHAYFAPVTPPPSVGGSR	153	sp|Q96IG2-2|FXL20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=13386	74.32	2	1917.9138	1917.9138	K	Q	377	395
PSM	VHAYFAPVTPPPSVGGSR	154	sp|Q96IG2-2|FXL20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	9-UNIMOD:21	ms_run[2]:scan=13416	74.504	2	1917.9138	1917.9138	K	Q	377	395
PSM	LSGINEIPRPFSPPVTSNTSPPPAAPLAR	155	sp|Q0JRZ9|FCHO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	20-UNIMOD:21	ms_run[1]:scan=17903	104.37138166666666	3	3063.561071	3062.559037	K	A	477	506
PSM	TYFPHFDLSHGSAQVK	156	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	9-UNIMOD:21	ms_run[1]:scan=14996	84.62347666666668	2	1912.851018	1912.850914	K	G	42	58
PSM	KFDHESSPGTDEDK	157	sp|Q13427|PPIG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:21	ms_run[1]:scan=1366	8.547868333333334	2	1669.647845	1670.646126	K	S	739	753
PSM	APTVPPPLPPTPPQPAR	158	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:21	ms_run[2]:scan=12554	69.237	2	1811.9335	1811.9335	R	R	616	633
PSM	DKYEPAAVSEQGDKK	159	sp|P05023-4|AT1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3191	17.524	2	1663.8053	1663.8053	R	G	8	23
PSM	DLLAEQQPHHLATAVPLTPR	160	sp|Q7L9B9|EEPD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	18-UNIMOD:21	ms_run[2]:scan=13961	77.972	3	2286.1522	2286.1522	R	V	117	137
PSM	FADQDDIGNVSFDR	161	sp|Q5H9R7-6|PP6R3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13632	75.877	2	1597.7009	1597.7009	K	V	540	554
PSM	GVVDSDDLPLNVSR	162	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=13847	77.235	2	1484.7471	1484.7471	K	E	435	449
PSM	HRPVSSSDSSDESPSTSFTSGSMYR	163	sp|Q92613|JADE3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21,23-UNIMOD:35	ms_run[2]:scan=8794	47.808	3	2786.1127	2786.1127	R	I	4	29
PSM	ILGSASPEEEQEKPILDRPTR	164	sp|Q7Z422-2|SZRD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=11051	60.334	2	2444.1948	2444.1948	R	I	82	103
PSM	KHSEEAEFTPPLK	165	sp|Q3B726|RPA43_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=9212	50.118	2	1591.7283	1591.7283	R	C	314	327
PSM	KISVQYGDAFHPR	166	sp|Q96D21|RHES_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=10990	59.979	3	1596.745	1596.7450	R	P	203	216
PSM	KKEEPSQNDISPK	167	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:21	ms_run[2]:scan=1419	8.7583	2	1578.7291	1578.7291	K	T	79	92
PSM	KKPGDASSLPDAGLSPGSQVDSK	168	sp|Q13459-2|MYO9B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	15-UNIMOD:21	ms_run[2]:scan=9283	50.484	3	2320.0948	2320.0948	K	S	1391	1414
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	169	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	17-UNIMOD:21	ms_run[2]:scan=13923	77.731	3	3605.6199	3605.6199	K	L	150	183
PSM	KNQDDDDDDDDGFFGPALPPGFK	170	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=18145	106.08	3	2524.0666	2524.0666	R	K	78	101
PSM	KRESESESDETPPAAPQLIK	171	sp|O60832|DKC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:21	ms_run[2]:scan=9630	52.416	2	2291.0682	2291.0682	R	K	448	468
PSM	PKSPHNSGLVNLTER	172	sp|Q96JM2|ZN462_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=8181	44.365	3	1727.8356	1727.8356	K	S	348	363
PSM	SLVHEVGKPPQDVTDDSPPSK	173	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	17-UNIMOD:21	ms_run[2]:scan=8497	46.124	3	2311.0733	2311.0733	R	K	1206	1227
PSM	SLVHEVGKPPQDVTDDSPPSK	174	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	17-UNIMOD:21	ms_run[2]:scan=8789	47.776	2	2311.0733	2311.0733	R	K	1206	1227
PSM	SRPLSHYSSFGSSGGSGGGSMMGGESADK	175	sp|Q7LFL8|CXXC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:21,21-UNIMOD:35,22-UNIMOD:35	ms_run[2]:scan=7192	38.838	3	2888.1379	2888.1379	R	A	76	105
PSM	STAQQELDGKPASPTPVIVASHTANK	176	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	13-UNIMOD:21	ms_run[2]:scan=9771	53.214	3	2726.3276	2726.3276	R	E	818	844
PSM	VDSTTCLFPVEEK	177	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=14983	84.535	2	1603.6841	1603.6841	R	A	241	254
PSM	VNVDEVGGEALGR	178	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=11013	60.1	2	1313.6575	1313.6575	K	L	19	32
PSM	YHGHSMSDPGVSYR	179	sp|P08559-4|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3414	18.628	2	1687.645	1687.6450	R	T	327	341
PSM	YSPESQAQSVHHQR	180	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	2-UNIMOD:21	ms_run[2]:scan=3035	16.76	2	1732.7319	1732.7319	R	P	1998	2012
PSM	KKNEPEDEEEEEEEEDEDEEEEDEDEE	181	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=7374	39.832575	3	3384.199864	3383.197574	K	-	183	210
PSM	KKVEEEDEEEEEEEEEEEEEEDE	182	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=6720	36.0874	3	2928.096105	2926.089467	R	-	178	201
PSM	ASPGHSPHYFAASSPTSPNALPPAR	183	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:21	ms_run[1]:scan=11088	60.553535	3	2595.185377	2596.186001	R	K	1847	1872
PSM	YRHPSGGSNGATCSTQVSMLTR	184	sp|P32241|VIPR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	8-UNIMOD:21,13-UNIMOD:4,19-UNIMOD:35	ms_run[1]:scan=7356	39.736763333333336	3	2463.029262	2462.046808	K	V	418	440
PSM	DKRPLSGPDVGTPQPAGLASGAK	185	sp|O96013|PAK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	6-UNIMOD:21	ms_run[1]:scan=10721	58.45345	2	2299.139812	2298.136926	R	L	176	199
PSM	APTVPPPLPPTPPQPAR	186	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=12720	70.246	2	1811.9335	1811.9335	R	R	616	633
PSM	DADDAVYELDGK	187	sp|Q13243-2|SRSF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9597	52.23	2	1309.5674	1309.5674	R	E	49	61
PSM	DTDDVPMILVGNK	188	sp|P61224-4|RAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:35	ms_run[2]:scan=13670	76.109	2	1431.6915	1431.6915	K	C	63	76
PSM	EEQTDTSDGESVTHHIR	189	sp|P36915|GNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=5014	26.945	2	2019.8171	2019.8171	R	R	45	62
PSM	FEPVHFVASSSKDER	190	sp|O15226|NKRF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	9-UNIMOD:21	ms_run[2]:scan=10272	56.005	2	1813.8036	1813.8036	R	Q	57	72
PSM	GLNSQSSDDHLNKR	191	sp|A8CG34-2|P121C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21	ms_run[2]:scan=2009	11.426	2	1649.7159	1649.7159	R	S	110	124
PSM	GVVDSDDLPLNVSR	192	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=14007	78.255	2	1484.7471	1484.7471	K	E	435	449
PSM	HADHSSLTLGSGSSTTR	193	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=4494	24.112	2	1792.7741	1792.7741	R	L	2522	2539
PSM	HCAPSPDRSPELSSSR	194	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=3892	21.01	2	1861.7778	1861.7778	R	D	622	638
PSM	HIKEEPLSEEEPCTSTAIASPEK	195	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=9714	52.877	3	2661.1881	2661.1881	K	K	495	518
PSM	HISESCPFPSPGGQLAEVHSVSPEQGAK	196	sp|Q5T1V6-2|DDX59_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=13804	76.967	3	3011.3485	3011.3485	R	D	55	83
PSM	HQASDSENEEPPKPR	197	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=1273	8.1692	2	1799.7476	1799.7476	R	M	193	208
PSM	IACRSPQPDPVGTPTIFKPQSK	198	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=12234	67.237	3	2503.2294	2503.2294	K	R	1859	1881
PSM	KEESEESDDDMGFGLFD	199	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:35	ms_run[2]:scan=16044	91.548	2	1964.7469	1964.7469	K	-	73	90
PSM	KFSAGGDSDPPLKR	200	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=5540	29.72	2	1553.7239	1553.7239	R	S	288	302
PSM	KHEADELSGDASVEDDAFIK	201	sp|Q9NWH9|SLTM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:21	ms_run[2]:scan=12819	70.804	3	2254.9631	2254.9631	K	D	86	106
PSM	KKEPAITSQNSPEAR	202	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=1965	11.223	2	1734.8302	1734.8302	K	E	69	84
PSM	KLNHTPVSTMSSSQPVSR	203	sp|Q6VMQ6-2|MCAF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=3070	16.947	3	2050.9507	2050.9507	K	P	983	1001
PSM	KPLPDHVSIVEPK	204	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:21	ms_run[2]:scan=10383	56.613	2	1537.7905	1537.7905	K	D	202	215
PSM	KSHSANDSEEFFR	205	sp|Q6ICG6-3|K0930_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=7810	42.223	3	1632.657	1632.6570	K	E	287	300
PSM	LHNENAEMDSDSSSSGTETDLHGSLR	206	sp|Q9H832-2|UBE2Z_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=6742	36.222	3	2884.1455	2884.1455	R	V	220	246
PSM	LLRPSLAELHDELEK	207	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=15455	87.604	2	1841.9288	1841.9288	K	E	238	253
PSM	LNHVAAGLVSPSLK	208	sp|Q05519-2|SRS11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=11721	64.203	2	1484.7752	1484.7752	K	S	198	212
PSM	NAIHTFVQSGSHLAAR	209	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=12323	67.816	3	1787.8468	1787.8468	K	E	507	523
PSM	PVQLSEHPEWNESMHSLR	210	sp|Q8WVQ1-2|CANT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=11657	63.833	3	2270.978	2270.9780	M	I	2	20
PSM	RDSITPDIATKPGQPLFLDSISPK	211	sp|Q2TB10|ZN800_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=17840	103.94	3	2675.3571	2675.3571	R	K	315	339
PSM	RHSTSDLSDATFSDIR	212	sp|Q9P227-2|RHG23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=11466	62.703	2	1886.816	1886.8160	K	R	675	691
PSM	RKPSPEPEGEVGPPK	213	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=4135	22.219	2	1682.8029	1682.8029	K	I	341	356
PSM	RKTITGVPDNIQK	214	sp|Q5SYE7-2|NHSL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=6218	33.277	2	1548.8025	1548.8025	R	E	207	220
PSM	RLIDSSGSASVLTHSSSGNSLK	215	sp|Q96SU4-5|OSBL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:21	ms_run[2]:scan=10490	57.207	3	2282.0904	2282.0904	K	R	132	154
PSM	RLSAPLPSSCGDPEKQR	216	sp|Q96EP0-3|RNF31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=7874	42.57	3	1976.9139	1976.9139	R	Q	313	330
PSM	RPQTPKEEAQALEDLTGFK	217	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=17755	103.35	3	2237.0729	2237.0729	R	E	972	991
PSM	RRPSGSEQSDNESVQSGR	218	sp|Q6PD62|CTR9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=945	6.8344	3	2054.8767	2054.8767	K	S	1094	1112
PSM	RRSEVVESTTESQDK	219	sp|Q5UIP0-2|RIF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=1761	10.26	2	1829.8157	1829.8157	R	E	1420	1435
PSM	RRTADDSATSDYCPAPK	220	sp|Q9UBC3-5|DNM3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=3483	18.968	3	1989.8252	1989.8252	R	R	361	378
PSM	RSSPSARPPDVPGQQPQAAK	221	sp|Q96JP5-2|ZFP91_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=5165	27.746	2	2153.0379	2153.0379	R	S	81	101
PSM	RTPTMPQEEAAACPPHILPPEK	222	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=10880	59.36	3	2565.1757	2565.1757	R	R	1243	1265
PSM	SHKDDSELDFSALCPK	223	sp|Q9H6L5-2|RETR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13678	76.153	2	1927.8023	1927.8023	K	I	135	151
PSM	SKDHFGLEGDEESTMLEDSVSPK	224	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:35,21-UNIMOD:21	ms_run[2]:scan=12756	70.446	3	2632.0888	2632.0888	K	K	405	428
PSM	VKHEVSGETVVFQGGALGK	225	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=11606	63.547	3	2020.9983	2020.9983	R	T	1038	1057
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	226	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=11515	62.998	3	2814.2433	2814.2433	R	G	194	223
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	227	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15240	86.20973333333333	3	3442.4029	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	228	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14773	83.13451666666666	3	3442.4032	3442.4027	K	L	104	135
PSM	KMPQLTASAIVSPHGDESPR	229	sp|Q9Y6J9|TAF6L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	2-UNIMOD:35,18-UNIMOD:21	ms_run[1]:scan=10026	54.60897166666667	3	2216.028098	2216.029684	R	G	484	504
PSM	AHSPQGEGEIPLHR	230	sp|Q9BYB0-3|SHAN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=6443	34.477	3	1606.7253	1606.7253	K	G	362	376
PSM	APAKPPGSGLDLADALDDQDDGR	231	sp|Q8TCZ2-6|C99L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=14982	84.531	3	2293.0822	2293.0822	R	R	62	85
PSM	APEKPLHEVPSGNSLLSSETILR	232	sp|Q96B97-2|SH3K1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=16325	93.413	3	2553.284	2553.2840	K	T	32	55
PSM	APEPHVEEDDDDELDSK	233	sp|P52566|GDIR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6870	36.965	3	1938.7967	1938.7967	K	L	5	22
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	234	sp|P46379-5|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	26-UNIMOD:21	ms_run[2]:scan=5955	31.886	3	2864.2839	2864.2839	R	G	88	119
PSM	ASPGHSPHYFAASSPTSPNALPPAR	235	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21	ms_run[2]:scan=11269	61.562	3	2596.186	2596.1860	R	K	1847	1872
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	236	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=13099	72.517	3	3459.4297	3459.4297	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	237	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=13930	77.767	3	3459.4297	3459.4297	K	L	104	135
PSM	ELLHSVHPESPNLK	238	sp|Q9Y217|MTMR6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=9263	50.381	2	1678.808	1678.8080	K	T	552	566
PSM	GDTPGHATPGHGGATSSAR	239	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:21	ms_run[2]:scan=903	6.6661	2	1812.7541	1812.7541	R	K	271	290
PSM	HADHSSLTLGSGSSTTR	240	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=4296	23.061	2	1792.7741	1792.7741	R	L	2522	2539
PSM	HKSDNETNLQQQVVWGNR	241	sp|Q7Z401|MYCPP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=10918	59.582	3	2232.0073	2232.0073	R	N	1013	1031
PSM	HQASDSENEELPKPR	242	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=3957	21.332	2	1815.7789	1815.7789	R	I	232	247
PSM	HRPSEADEEELAR	243	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=4234	22.727	3	1617.6784	1617.6784	K	R	486	499
PSM	IGHHSTSDDSSAYR	244	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=1394	8.6596	3	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	245	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=1998	11.375	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYRSVDEVNYWDK	246	sp|P12694|ODBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21,15-UNIMOD:21	ms_run[2]:scan=12504	68.931	3	2927.1437	2927.1437	R	Q	333	357
PSM	KFELLPTPPLSPSR	247	sp|P01106|MYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=17933	104.57	2	1660.859	1660.8590	K	R	52	66
PSM	KHDSGAADLER	248	sp|Q9NX55-3|HYPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=1571	9.396	2	1277.5401	1277.5401	R	V	35	46
PSM	KHEDDDDNDIM	249	sp|Q9HBM6|TAF9B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=1088	7.3967	2	1361.5041	1361.5041	R	-	241	252
PSM	KLEDVKNSPTFK	250	sp|P55327-2|TPD52_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=5350	28.674	2	1484.7276	1484.7276	K	S	124	136
PSM	KLSVPTSDEEDEVPAPKPR	251	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=10252	55.904	3	2173.0304	2173.0304	K	G	103	122
PSM	KNQDDDDDDDDGFFGPALPPGFK	252	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=17709	103.01	3	2524.0666	2524.0666	R	K	78	101
PSM	KPASPPLPATQQEKPSQTPEAGR	253	sp|Q6ZU35|K1211_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=6505	34.82	3	2494.2217	2494.2217	R	K	1039	1062
PSM	KPEEMPTACPGHSPR	254	sp|Q9NZC9|SMAL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=1314	8.3244	3	1788.7325	1788.7325	K	S	100	115
PSM	KREPEDEGEDDD	255	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=730	5.9799	2	1432.559	1432.5590	R	-	238	250
PSM	LKEEHGIELSSPR	256	sp|O14647-2|CHD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=6758	36.313	3	1573.7501	1573.7501	R	H	1355	1368
PSM	NGLHRPVSTDFAQYNSYGDVSGGVR	257	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=14097	78.838	3	2775.2402	2775.2402	R	D	285	310
PSM	PYFEGLSHSSSQTEIGSIHSAR	258	sp|Q86VP3-4|PACS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=13410	74.47	3	2469.0962	2469.0962	R	S	246	268
PSM	QGHRPLSQSIVEAGSVGQTDLNK	259	sp|A6NDB9|PALM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=12861	71.045	3	2500.2071	2500.2071	R	R	118	141
PSM	RADAGSHTEGSPSQPR	260	sp|Q86V15-2|CASZ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=696	5.8362	2	1731.7326	1731.7326	K	D	47	63
PSM	RGAAAADLLSSSPESQHGGTQSPGGGQPLLQPTK	261	sp|Q9H3S7|PTN23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=13192	73.083	3	3379.6158	3379.6158	R	V	1112	1146
PSM	RISHSLYSGIEGLDESPSR	262	sp|Q8TEW0-9|PARD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=14213	79.584	3	2182.0056	2182.0056	R	N	700	719
PSM	RKSELEFETLK	263	sp|Q5JSH3-4|WDR44_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=9908	53.97	2	1458.712	1458.7120	K	T	235	246
PSM	RKTVTAMDVVYALK	264	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=12904	71.312	2	1689.8525	1689.8525	K	R	79	93
PSM	RLSGGSHSYGGESPR	265	sp|Q13905-2|RPGF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=2777	15.437	2	1625.6947	1625.6947	R	L	294	309
PSM	RPDDVPLSLSPSKR	266	sp|Q9UFC0|LRWD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=9361	50.89	3	1645.8189	1645.8189	K	A	234	248
PSM	RPPGPDLSPDGPR	267	sp|P22455-3|FGFR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=7350	39.703	2	1439.6558	1439.6558	R	S	356	369
PSM	RSNSAPLIHGLSDTSPVFQAEAPSAR	268	sp|Q96E09|F122A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=16213	92.61	3	2787.3341	2787.3341	R	R	34	60
PSM	RSSPPGHYYQK	269	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=1813	10.498	2	1398.6082	1398.6082	R	S	121	132
PSM	SHYTMEFGYSSNSPSTHR	270	sp|O75581|LRP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7407	39.999	3	2182.8415	2182.8415	R	S	1496	1514
PSM	SLGNILQAKPTSSPAKGPPQK	271	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=10509	57.301	3	2198.146	2198.1460	K	A	494	515
PSM	SPSPSSPAAVNHHSSSDISPVSNESTSSSPGK	272	sp|O75381-2|PEX14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	29-UNIMOD:21	ms_run[2]:scan=7024	37.871	3	3200.3895	3200.3895	K	E	204	236
PSM	SRSPLLVTVVESDPRPQGQPR	273	sp|Q5VWN6-2|F208B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=14093	78.817	3	2397.2166	2397.2166	R	R	1230	1251
PSM	SRSPSPSPLPSPASGPGPGAPGPR	274	sp|Q9BYB0-3|SHAN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=9964	54.265	3	2289.0903	2289.0903	R	R	1515	1539
PSM	TPPGPPPPDDDEDDPVPLPVSGDKEEDAPHR	275	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=12844	70.943	3	3366.4565	3366.4565	R	E	184	215
PSM	VHKPSSLSYEPEMR	276	sp|Q8IZQ1-2|WDFY3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=6214	33.254	2	1754.7699	1754.7699	R	S	965	979
PSM	VHYRSPPLATGEPVDNLSPEER	277	sp|Q86U06-4|RBM23_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=12027	65.98	3	2542.1853	2542.1853	R	D	108	130
PSM	VKHEVSGETVVFQGGALGK	278	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=11629	63.667	2	2020.9983	2020.9983	R	T	1038	1057
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	279	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=11864	65.043	3	2814.2433	2814.2433	R	G	194	223
PSM	KKNEPEDEEEEEEEEDEDEEEEDEDEE	280	sp|P26583|HMGB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=7142	38.58546333333334	3	3384.200694	3383.197574	K	-	183	210
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	281	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16818	96.82569666666667	3	3444.4062	3442.4022	K	L	104	135
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	282	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	6-UNIMOD:4,24-UNIMOD:21	ms_run[1]:scan=11160	60.96857166666667	3	2813.240235	2814.243258	R	G	194	223
PSM	CRDDSFFGETSHNYHK	283	sp|P43243|MATR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=11162	60.97996333333333	3	2061.7669	2061.7671	R	F	230	246
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	284	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	8-UNIMOD:21	ms_run[1]:scan=12138	66.64132333333333	3	3173.555962	3174.559825	K	N	773	803
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	285	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=12753	70.431	2	2574.2228	2574.2228	K	K	408	434
PSM	AGVLAGHDNR	286	sp|P62879-2|GBB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1675	9.8422	2	1008.5101	1008.5101	R	V	205	215
PSM	ARHDSPDLAPNVTYSLPR	287	sp|Q9BRD0|BUD13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=13190	73.071	3	2087.979	2087.9790	R	T	267	285
PSM	ASLLHSMPTHSSPR	288	sp|O75122-3|CLAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:21	ms_run[2]:scan=7685	41.549	3	1599.7229	1599.7229	K	S	1223	1237
PSM	AVAGVMITASHNR	289	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=5994	32.067	2	1421.6486	1421.6486	K	K	166	179
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	290	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=15783	89.754	3	3459.4297	3459.4297	K	L	104	135
PSM	DGGGVRDEGPAAAGDGLGRPLGPTPSQSR	291	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	26-UNIMOD:21	ms_run[2]:scan=10966	59.823	3	2826.3046	2826.3046	R	F	52	81
PSM	DLDDFQSWLSR	292	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=19905	118.83	2	1380.631	1380.6310	R	T	1057	1068
PSM	DLDDNLFGQHLAK	293	sp|O14656-2|TOR1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14729	82.833	2	1484.726	1484.7260	K	K	64	77
PSM	GPPSPPAPVMHSPSR	294	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5264	28.242	2	1608.712	1608.7120	R	K	221	236
PSM	GSPKPSPQPSPKPSPK	295	sp|P29536-2|LMOD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=1409	8.7185	2	1694.8393	1694.8393	K	N	479	495
PSM	HADHSSLTLGSGSSTTR	296	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=4481	24.056	3	1792.7741	1792.7741	R	L	2522	2539
PSM	HFIDVGAGVIDEDYR	297	sp|P33316-2|DUT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=15148	85.592	3	1704.8107	1704.8107	K	G	92	107
PSM	HIAECHPECSPNEDR	298	sp|Q96K83|ZN521_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:4,9-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=2214	12.507	2	1929.7135	1929.7135	K	A	264	279
PSM	HLEHAPSPSDVSNAPEVK	299	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=8104	43.924	2	1992.8942	1992.8942	K	A	439	457
PSM	HLSPYATLTVGDSSHK	300	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=8741	47.554	2	1791.8193	1791.8193	K	T	818	834
PSM	HPPLYQAGLTPPLSPPK	301	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=15019	84.778	2	1891.9597	1891.9597	R	S	474	491
PSM	HQLLEADISAHEDR	302	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=9503	51.651	3	1712.7519	1712.7519	K	L	1680	1694
PSM	HREDSDVEMVEDDSR	303	sp|P40692-2|MLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=5647	30.253	3	1913.7099	1913.7099	R	K	232	247
PSM	HSSKPVLPTSGWK	304	sp|Q9C0I1-3|MTMRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=9501	51.644	2	1502.7283	1502.7283	R	A	604	617
PSM	IFQGSFGGPTLYENPHYQSPNMHR	305	sp|Q8TDN6|BRX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	19-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=14552	81.662	3	2872.2429	2872.2429	K	R	243	267
PSM	IGHHSTSDDSSAYR	306	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=1556	9.3377	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	307	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=1780	10.344	2	1611.6315	1611.6315	R	S	333	347
PSM	KGAGDGSDEEVDGK	308	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=1060	7.2799	2	1442.5562	1442.5562	R	A	1937	1951
PSM	KKEPAITSQNSPEAR	309	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=1751	10.215	2	1734.8302	1734.8302	K	E	69	84
PSM	KKEPAITSQNSPEAR	310	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=2105	11.886	2	1734.8302	1734.8302	K	E	69	84
PSM	KKSIVAVEPR	311	sp|Q5VZL5-3|ZMYM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=3348	18.307	2	1205.6533	1205.6533	R	S	855	865
PSM	KLSVPTSDEEDEVPAPKPR	312	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=10070	54.846	3	2173.0304	2173.0304	K	G	103	122
PSM	KLSVPTSDEEDEVPAPKPR	313	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=9925	54.056	2	2173.0304	2173.0304	K	G	103	122
PSM	KNQKPSQVNGAPGSPTEPAGQK	314	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:21	ms_run[2]:scan=2547	14.341	3	2299.0958	2299.0958	K	Q	1254	1276
PSM	KNSEPGSPHSLEALR	315	sp|Q9ULC5-3|ACSL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=8184	44.38	3	1700.7883	1700.7883	R	D	26	41
PSM	KPGDGEVSPSTEDAPFQHSPLGK	316	sp|O60318|GANP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=11983	65.732	3	2459.1006	2459.1006	K	A	520	543
PSM	KPSDGSPDTKPSR	317	sp|Q92733|PRCC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=610	5.5081	2	1450.6453	1450.6453	R	L	207	220
PSM	KRDSDAGSSTPTTSTR	318	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=812	6.3168	3	1745.7581	1745.7581	R	S	1381	1397
PSM	LHQLSGSDQLESTAHSR	319	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=7595	41.057	3	1944.8691	1944.8691	K	I	179	196
PSM	LKEDILENEDEQNSPPKK	320	sp|Q9NTI5-5|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=8276	44.886	3	2205.0202	2205.0202	R	G	40	58
PSM	LKGTSPSSSSRPQR	321	sp|Q8N1F7-2|NUP93_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=944	6.8308	2	1566.7515	1566.7515	R	V	640	654
PSM	MRSPQPARPGSAAVPGAAFAPIPR	322	sp|Q8N3V7-2|SYNPO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35,3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=14281	79.977	3	2577.2077	2577.2077	R	S	802	826
PSM	NAIHTFVQSGSHLAAR	323	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=10435	56.892	2	1787.8468	1787.8468	K	E	507	523
PSM	NFTKPQDGDVIAPLITPQKK	324	sp|Q9Y3Z3-3|SAMH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:21	ms_run[2]:scan=13529	75.237	3	2289.177	2289.1770	R	E	507	527
PSM	PFSSPSMSPSHGMNIHNLASGK	325	sp|Q96S59-2|RANB9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:35,8-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=8499	46.136	3	2394.0134	2394.0134	R	G	139	161
PSM	PGAEGAPLLPPPLPPPSPPGSGR	326	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	17-UNIMOD:21	ms_run[2]:scan=16843	96.987	2	2237.1246	2237.1246	R	G	27	50
PSM	PVLHMVSSEQHSADLNR	327	sp|Q05209-2|PTN12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=7297	39.418	2	2014.8932	2014.8932	K	N	261	278
PSM	RAPSVANVGSHCDLSLK	328	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=10262	55.96	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RATISNPITGDLETVHYR	329	sp|P13674|P4HA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=15063	85.048	3	2122.0208	2122.0208	R	I	362	380
PSM	RGHTASESDEQQWPEEK	330	sp|Q9NTI5-5|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=5261	28.226	3	2092.8487	2092.8487	K	R	22	39
PSM	RGLLYDSDEEDEERPAR	331	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=9306	50.605	3	2128.9063	2128.9063	R	K	133	150
PSM	RGSIGENQIKDEK	332	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=3505	19.081	3	1552.7247	1552.7247	K	I	194	207
PSM	RHSTSDLSDATFSDIR	333	sp|Q9P227-2|RHG23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=11465	62.7	3	1886.816	1886.8160	K	R	675	691
PSM	RKPSVPDSASPADDSFVDPGER	334	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=10691	58.29	3	2408.0645	2408.0645	K	L	18	40
PSM	RKSSENNGTLVSK	335	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=1300	8.2682	2	1498.7141	1498.7141	K	Q	262	275
PSM	RKTSDFNTFLAQEGCTK	336	sp|Q9UHD1-2|CHRD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=12338	67.916	3	2081.9242	2081.9242	R	G	178	195
PSM	RLSAQAHPAGK	337	sp|Q2TAZ0|ATG2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=1103	7.453	2	1214.5921	1214.5921	R	M	401	412
PSM	RMEDEGGFPVPQENGQPESPRR	338	sp|Q6ZRV2|FA83H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=9091	49.416	3	2607.1173	2607.1173	R	L	980	1002
PSM	RPASMGSEGLGGDADPMKR	339	sp|Q6DT37|MRCKG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,5-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=3990	21.501	3	2042.8551	2042.8551	R	K	1489	1508
PSM	RPPSAATTCDPVVEEHFR	340	sp|Q14135-5|VGLL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=10280	56.046	3	2147.946	2147.9460	R	R	113	131
PSM	RQSPSPSTRPIR	341	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2272	12.799	2	1540.6913	1540.6913	R	R	711	723
PSM	RRPSDENTIAPSEVQK	342	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=4627	24.817	3	1905.8946	1905.8946	R	W	638	654
PSM	RRSDSTLFSTVDTDEIPAK	343	sp|Q9HC62|SENP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=14033	78.421	3	2217.0315	2217.0315	R	R	30	49
PSM	SSSPGKPQAVSSLNSSHSR	344	sp|Q9UHB7-2|AFF4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=3941	21.239	3	1991.9062	1991.9062	R	S	178	197
PSM	SSWHQSSFHSTR	345	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=4373	23.47	2	1525.61	1525.6100	R	T	288	300
PSM	STAQQELDGKPASPTPVIVASHTANK	346	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	13-UNIMOD:21	ms_run[2]:scan=10037	54.667	3	2726.3276	2726.3276	R	E	818	844
PSM	SVAPASPPPPDGPLAHR	347	sp|Q2M2I3|FA83E_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=8632	46.935	2	1744.8298	1744.8298	R	L	319	336
PSM	VPFSPGPAPPPHMGELDQER	348	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=11417	62.43	3	2252.9926	2252.9926	R	L	584	604
PSM	VPFSPGPAPPPHMGELDQER	349	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=14127	79.022	3	2236.9977	2236.9977	R	L	584	604
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	350	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=11692	64.028	3	2814.2433	2814.2433	R	G	194	223
PSM	VQTPDKQPLRPLVPDASK	351	sp|Q9NR12-2|PDLI7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=10433	56.885	2	2068.0718	2068.0718	K	Q	94	112
PSM	YHGHSMSDPGVSYR	352	sp|P08559-4|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21,6-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=4150	22.296	2	1767.6114	1767.6114	R	T	327	341
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	353	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	15-UNIMOD:21	ms_run[1]:scan=9691	52.756056666666666	3	3112.500156	3112.507789	R	S	847	876
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	354	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=17798	103.65481833333334	3	3442.4021	3442.4027	K	L	104	135
PSM	CHSLGYNFIHK	355	sp|Q86X27|RGPS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=13876	77.43137833333333	2	1437.5894	1437.5895	K	M	341	352
PSM	SSSQSTFHIPLSPVEVKPGNVR	356	sp|O15085|ARHGB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	12-UNIMOD:21	ms_run[1]:scan=16089	91.828365	3	2445.204358	2445.205340	K	N	545	567
PSM	GEKEDEDEDVKK	357	sp|O43823|AKAP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=677	5.753338333333333	2	1418.655221	1419.636533	R	R	358	370
PSM	HPSVGDNKPVELQPER	358	sp|Q03112|MECOM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:21	ms_run[1]:scan=7242	39.11025333333333	3	1879.884871	1880.878192	K	S	548	564
PSM	ADDKETCFAEEGKK	359	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:4	ms_run[2]:scan=2579	14.517	3	1626.7196	1626.7196	K	L	585	599
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	360	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=7952	43.029	3	2465.0431	2465.0431	R	A	90	114
PSM	DADDAVYELNGK	361	sp|Q13247-2|SRSF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9816	53.474	2	1308.5834	1308.5834	R	E	47	59
PSM	DKDDDEVFEKK	362	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3380	18.46	2	1366.6252	1366.6252	K	Q	658	669
PSM	DKYEPAAVSEQGDKK	363	sp|P05023-4|AT1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=3159	17.381	3	1663.8053	1663.8053	R	G	8	23
PSM	DLDDIEDENEQLK	364	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11794	64.614	2	1574.6948	1574.6948	R	Q	313	326
PSM	DRDDFPVVLVGNK	365	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=14385	80.617	2	1472.7623	1472.7623	K	A	131	144
PSM	DRRPSVDAPVTDVGFLR	366	sp|Q9BUH8|BEGIN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=15021	84.789	3	1978.9626	1978.9626	R	A	242	259
PSM	DSRPLSPILHIVK	367	sp|O95487-2|SC24B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=17140	99.016	3	1553.8331	1553.8331	R	D	1184	1197
PSM	EKEEEEEEKPK	368	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=597	5.4556	2	1402.6464	1402.6464	K	R	183	194
PSM	EKEISDDEAEEEKGEK	369	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=2843	15.751	2	1943.7885	1943.7885	R	E	222	238
PSM	EPRPNSSPSPSPGQASETPHPRPS	370	sp|O00204-2|ST2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=4660	25.014	3	2575.1453	2575.1453	R	-	327	351
PSM	ERRTPSDDEEDNLFAPPK	371	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=11105	60.647	3	2194.9532	2194.9532	K	L	328	346
PSM	ERTESEVPPRPASPK	372	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=4020	21.659	2	1758.8302	1758.8302	K	V	532	547
PSM	ESEDKPEIEDVGSDEEEEKK	373	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=7011	37.81	3	2399.9741	2399.9741	K	D	251	271
PSM	FKDLGEENFK	374	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8906	48.403	2	1225.5979	1225.5979	R	A	35	45
PSM	FNLTYVSHDGDDK	375	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=10445	56.955	2	1509.6736	1509.6736	R	K	571	584
PSM	FRSDVHTEAVQAALAK	376	sp|Q14689-3|DIP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=10342	56.401	3	1821.8775	1821.8775	R	Y	92	108
PSM	GGVRPVTHQLSSLALVASK	377	sp|Q9P107-2|GMIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=14819	83.451	3	1999.0616	1999.0616	R	L	849	868
PSM	GHTDTEGRPPSPPPTSTPEK	378	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=4105	22.066	2	2166.9583	2166.9583	R	C	353	373
PSM	GPPSPPAPVMHSPSR	379	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5063	27.23	2	1608.712	1608.7120	R	K	221	236
PSM	GVVDSDDLPLNVSR	380	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13882	77.473	3	1484.7471	1484.7471	K	E	435	449
PSM	HAQRSPEASQTDSPVESPR	381	sp|O95049-5|ZO3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=3307	18.086	3	2157.944	2157.9440	R	L	279	298
PSM	HGESAWNLENR	382	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=7749	41.878	2	1311.5956	1311.5956	R	F	11	22
PSM	HGLQLGAQSPGR	383	sp|Q8N1G0|ZN687_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=5973	31.971	2	1299.6085	1299.6085	R	G	1049	1061
PSM	HISDLYEDLR	384	sp|Q15149-7|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12590	69.452	2	1259.6146	1259.6146	R	D	30	40
PSM	HPPVLTPPDQEVIR	385	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=12641	69.742	3	1676.8287	1676.8287	R	N	636	650
PSM	HQASDSENEELPKPR	386	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=4053	21.816	3	1815.7789	1815.7789	R	I	232	247
PSM	HQASDSENEELPKPR	387	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=4256	22.839	3	1815.7789	1815.7789	R	I	232	247
PSM	HQDGLPYIDDSPSSSPHLSSK	388	sp|P11274-2|BCR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=12857	71.018	3	2346.0165	2346.0165	R	G	449	470
PSM	HRPSEADEEELAR	389	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=4031	21.711	3	1617.6784	1617.6784	K	R	486	499
PSM	IEDVGSDEEDDSGKDKK	390	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=2196	12.392	2	1944.7837	1944.7837	K	K	250	267
PSM	IGHHSTSDDSSAYR	391	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=1641	9.6806	3	1611.6315	1611.6315	R	S	333	347
PSM	IIKPFPAPQTPGR	392	sp|P78536|ADA17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=10821	59.02	2	1500.7854	1500.7854	R	L	726	739
PSM	IKIEHAPSPSSGGTLK	393	sp|Q14004-2|CDK13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=7263	39.225	2	1700.8499	1700.8499	K	N	518	534
PSM	KHSQTDLVSR	394	sp|O14683|P5I11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=1895	10.895	2	1249.5816	1249.5816	K	L	12	22
PSM	KKEEPSQNDISPK	395	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=1659	9.7668	2	1578.7291	1578.7291	K	T	79	92
PSM	KLSVPTSDEEDEVPAPKPR	396	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=9881	53.838	3	2173.0304	2173.0304	K	G	103	122
PSM	KLVILEGELER	397	sp|P67936|TPM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13511	75.11	2	1297.7606	1297.7606	R	A	132	143
PSM	KNSIHELLLER	398	sp|Q76I76|SSH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=11937	65.454	2	1430.7283	1430.7283	K	A	782	793
PSM	KPEEMPTACPGHSPR	399	sp|Q9NZC9|SMAL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:35,9-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=1316	8.3318	2	1788.7325	1788.7325	K	S	100	115
PSM	KPTSAKPSSTTPR	400	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=625	5.568	2	1436.7025	1436.7025	K	L	634	647
PSM	KQPPKEPSEVPTPK	401	sp|P17096-2|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:21	ms_run[2]:scan=3762	20.373	2	1640.8175	1640.8175	R	R	31	45
PSM	KQQHVISTEEGDMMETNSTDDEK	402	sp|Q9H0E3-2|SP130_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:35,14-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=3371	18.419	3	2763.0888	2763.0889	R	S	403	426
PSM	KRSVQEGENPDDGVR	403	sp|P42696-2|RBM34_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=1874	10.793	3	1764.7792	1764.7792	R	G	12	27
PSM	KSQVAELNDDDKDDEIVFK	404	sp|Q9BYG3|MK67I_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=11781	64.543	3	2207.0594	2207.0594	R	Q	246	265
PSM	KTFPTVNPSTGEVICQVAEGDKEDVDK	405	sp|P05091|ALDH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:4	ms_run[2]:scan=14927	84.158	3	2962.423	2962.4230	R	A	52	79
PSM	KVEVIKPLVAETDTPNR	406	sp|P04035-2|HMDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:21	ms_run[2]:scan=10372	56.551	3	1988.0344	1988.0344	R	A	396	413
PSM	LGIHEDSTNR	407	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2728	15.212	2	1140.5523	1140.5523	K	R	439	449
PSM	LSHLKPSSEGLAIVTK	408	sp|P10155-3|RO60_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=11451	62.611	3	1758.9281	1758.9281	R	Y	185	201
PSM	LSVHDMKPLDSPGR	409	sp|Q15643|TRIPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5573	29.893	2	1646.7488	1646.7488	K	R	1881	1895
PSM	NAIHTFVQSGSHLAAR	410	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=10596	57.78	3	1787.8468	1787.8468	K	E	507	523
PSM	RAPSVANVGSHCDLSLK	411	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9900	53.934	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RHTVDEYSPQK	412	sp|Q92565-2|RPGF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=2326	13.079	2	1438.6242	1438.6242	R	K	205	216
PSM	RLSSTSLASGHSVR	413	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=5430	29.102	3	1536.741	1536.7410	R	L	38	52
PSM	RLSSTSLASGHSVR	414	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=5616	30.116	3	1536.741	1536.7410	R	L	38	52
PSM	RNSSEASSGDFLDLK	415	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=13500	75.036	2	1704.7356	1704.7356	R	G	39	54
PSM	RRSEVVESTTESQDK	416	sp|Q5UIP0-2|RIF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=1760	10.256	3	1829.8157	1829.8157	R	E	1420	1435
PSM	RRSNVSSPATPTASSSSSTTPTR	417	sp|Q12888|TP53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=3327	18.201	3	2414.1187	2414.1187	K	K	1629	1652
PSM	RSPVSTRPLPSASQK	418	sp|Q8ND56-3|LS14A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=4081	21.958	2	1689.8563	1689.8563	R	A	174	189
PSM	RSPVSTRPLPSASQK	419	sp|Q8ND56-3|LS14A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=4280	22.965	2	1689.8563	1689.8563	R	A	174	189
PSM	RSTVLGLPQHVQK	420	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=8528	46.33	3	1541.8079	1541.8079	R	E	160	173
PSM	RTDALTSSPGR	421	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=2126	11.975	2	1239.5609	1239.5609	R	D	34	45
PSM	RTPTMPQEEAAACPPHILPPEK	422	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=11063	60.406	3	2565.1757	2565.1757	R	R	1243	1265
PSM	RTPTMPQEEAAACPPHILPPEK	423	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=10703	58.355	3	2565.1757	2565.1757	R	R	1243	1265
PSM	SHLGNVHDQDN	424	sp|Q8WW12-3|PCNP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1177	7.758	2	1234.5327	1234.5327	K	-	45	56
PSM	SKHPSGSNVSFSR	425	sp|Q12767|TMM94_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=3198	17.556	2	1468.646	1468.6460	R	D	509	522
PSM	SKTPTPSVETLPHLR	426	sp|Q5T5Y3-2|CAMP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=11519	63.021	3	1741.8764	1741.8764	R	P	842	857
PSM	SLNSTPPPPPAPAPAPPPALAR	427	sp|Q8TE68-4|ES8L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=12540	69.146	2	2195.114	2195.1140	R	P	328	350
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	428	sp|Q68EM7-2|RHG17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:21	ms_run[2]:scan=9270	50.417	3	2686.2501	2686.2501	R	R	596	622
PSM	SRDSGDENEPIQER	429	sp|Q8WX93-2|PALLD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=2966	16.388	2	1710.6846	1710.6846	R	F	894	908
PSM	SRLSPAGEMKPMPLSEGK	430	sp|Q9BXK5-4|B2L13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,9-UNIMOD:35,12-UNIMOD:35	ms_run[2]:scan=6153	32.931	2	2025.9265	2025.9265	K	S	279	297
PSM	SRPFTVAASFQSTSVKSPK	431	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=11623	63.64	2	2104.0354	2104.0354	R	T	588	607
PSM	SSGVSGGKPGLLPAHSR	432	sp|Q8IWB9|TEX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:21	ms_run[2]:scan=5837	31.28	2	1685.825	1685.8250	K	H	717	734
PSM	STAQQELDGKPASPTPVIVASHTANK	433	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=9397	51.083	3	2726.3276	2726.3276	R	E	818	844
PSM	TKPTQAAGPSSPQKPPTPEETK	434	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=4119	22.136	3	2356.1312	2356.1312	K	A	437	459
PSM	TYSECEDGTYSPEISWHHR	435	sp|P48651-3|PTSS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=11985	65.742	3	2432.9369	2432.9369	K	K	212	231
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	436	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=12460	68.651	3	3174.5598	3174.5598	K	N	773	803
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	437	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=11343	61.99	3	2814.2433	2814.2433	R	G	194	223
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	438	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14440	80.96502666666667	3	3460.427040	3459.429735	K	L	104	135
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	439	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:4,24-UNIMOD:21	ms_run[1]:scan=12757	70.44958333333334	3	2815.245552	2814.243258	R	G	194	223
PSM	TRQDGSQEAPEAPLSSELEPFHPK	440	sp|Q14676|MDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	6-UNIMOD:21	ms_run[1]:scan=15169	85.742275	3	2730.234050	2729.233405	K	P	1081	1105
PSM	ATGNDLRPPPPSPSSDLTHPMK	441	sp|Q9P275|UBP36_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:21,21-UNIMOD:35	ms_run[1]:scan=9082	49.370215	3	2410.091337	2410.098826	R	T	702	724
PSM	QERLSPEVAPPAHR	442	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=6084	32.532705	3	1648.7705	1648.7717	K	R	31	45
PSM	LKFSDEEDGRDSDEEGAEGHR	443	sp|P48634|PRC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	4-UNIMOD:21,12-UNIMOD:21	ms_run[1]:scan=6799	36.573955	3	2537.940481	2536.938102	K	D	339	360
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	444	sp|Q9C0B5|ZDHC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=12907	71.33082833333333	3	3074.3982	3072.3932	R	T	553	583
PSM	HGAEPQASPAVHLPESPQSPK	445	sp|Q03989|ARI5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	19-UNIMOD:21	ms_run[1]:scan=9278	50.460366666666665	3	2243.027892	2243.037212	R	G	282	303
PSM	KVSIVSKPVLYR	446	sp|Q9NRY4|RHG35_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21	ms_run[1]:scan=10053	54.75471666666666	2	1467.820613	1467.821452	R	T	1148	1160
PSM	PFSSPSMSPSHGMNIHNLASGK	447	sp|Q96S59|RANB9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:35,8-UNIMOD:21	ms_run[1]:scan=11610	63.56497333333333	3	2378.014632	2378.018467	R	G	480	502
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	448	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15436	87.48518666666666	3	3458.409732	3459.429735	K	L	104	135
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	449	sp|O60784-3|TOM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=12610	69.571	3	2574.2228	2574.2228	K	K	408	434
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	450	sp|Q9BUJ2-3|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	28-UNIMOD:21	ms_run[2]:scan=10199	55.584	3	3407.6452	3407.6452	R	N	577	608
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	451	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=14087	78.779	3	3459.4297	3459.4297	K	L	104	135
PSM	DAVEDLESVGK	452	sp|P81605|DCD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12658	69.842	2	1160.5561	1160.5561	K	G	86	97
PSM	DGGGVRDEGPAAAGDGLGRPLGPTPSQSR	453	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	26-UNIMOD:21	ms_run[2]:scan=10370	56.543	3	2826.3046	2826.3046	R	F	52	81
PSM	DGGGVRDEGPAAAGDGLGRPLGPTPSQSR	454	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	26-UNIMOD:21	ms_run[2]:scan=10783	58.792	3	2826.3046	2826.3046	R	F	52	81
PSM	DLVAQAPLKPKTPR	455	sp|O94776-2|MTA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=8623	46.873	2	1612.8702	1612.8702	K	G	350	364
PSM	DTGKTPVEPEVAIHR	456	sp|P60866|RS20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=7775	42.021	3	1727.8244	1727.8244	K	I	5	20
PSM	ESEDKPEIEDVGSDEEEEK	457	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=8212	44.526	2	2271.8792	2271.8792	K	K	251	270
PSM	FHPEPYGLEDDQR	458	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9675	52.673	3	1601.711	1601.7110	R	S	174	187
PSM	FSGDLDDQTCR	459	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:4	ms_run[2]:scan=6160	32.968	2	1312.5354	1312.5354	K	E	236	247
PSM	GIRPFPSEETTENDDDVYR	460	sp|P52735-3|VAV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=11680	63.968	3	2239.0029	2239.0029	K	S	125	144
PSM	GMKDDKEEEEDGTGSPQLNNR	461	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=2689	15.041	2	2443.9799	2443.9799	K	-	390	411
PSM	GPKPEPPGSGSPAPPR	462	sp|Q9UKJ3-2|GPTC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=3916	21.131	3	1606.7505	1606.7505	R	R	652	668
PSM	GPPSPPAPVMHSPSR	463	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5455	29.251	2	1608.712	1608.7120	R	K	221	236
PSM	HASSGSFLPSANEHLK	464	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=10126	55.163	2	1760.7883	1760.7883	R	E	115	131
PSM	HFSEHPSTSK	465	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1295	8.2505	2	1235.4972	1235.4972	R	M	401	411
PSM	HGSCDLENLHLR	466	sp|Q14586|ZN267_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=10521	57.366	2	1529.6446	1529.6446	R	K	103	115
PSM	HLAEDDTHPPASLR	467	sp|Q13477-4|MADCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=6112	32.688	2	1637.7199	1637.7199	R	L	165	179
PSM	HLQVNVTNPVQCSLHGK	468	sp|O94832|MYO1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=10374	56.563	3	2009.9506	2009.9506	R	K	959	976
PSM	HQASDSENEEPPKPR	469	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=1292	8.2419	3	1799.7476	1799.7476	R	M	193	208
PSM	HREDSDVEMVEDDSR	470	sp|P40692-2|MLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=5833	31.262	3	1913.7099	1913.7099	R	K	232	247
PSM	HRTLTAEEAEEEWER	471	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=11208	61.223	3	1964.8265	1964.8265	R	R	152	167
PSM	IGHHSTSDDSSAYR	472	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=1852	10.688	3	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	473	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=2067	11.705	3	1611.6315	1611.6315	R	S	333	347
PSM	IYHLPDAESDEDEDFKEQTR	474	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=12539	69.143	3	2516.0381	2516.0381	K	L	210	230
PSM	KAPPPPISPTQLSDVSSPR	475	sp|Q9P0K7-3|RAI14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	16-UNIMOD:21	ms_run[2]:scan=11875	65.105	3	2053.0245	2053.0245	R	S	266	285
PSM	KASFDHSPDSLPLR	476	sp|Q8NB78-2|KDM1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=10485	57.186	2	1648.761	1648.7610	K	S	11	25
PSM	KHPSSPECLVSAQK	477	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=4981	26.761	3	1646.7488	1646.7488	R	V	73	87
PSM	KKEQSEVSVSPR	478	sp|Q7L4I2|RSRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=1991	11.347	2	1452.6974	1452.6974	K	A	23	35
PSM	KKSPNELVDDLFK	479	sp|Q9UNZ2-4|NSF1C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=16340	93.496	2	1611.7909	1611.7909	R	G	112	125
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	480	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	17-UNIMOD:21	ms_run[2]:scan=13233	73.35	3	3605.6199	3605.6199	K	L	150	183
PSM	KPGDLSDELR	481	sp|Q13435|SF3B2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6855	36.892	2	1128.5775	1128.5775	K	I	605	615
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	482	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=13371	74.237	3	2662.3156	2662.3156	K	K	763	788
PSM	KPTHSQEPQGPEAMER	483	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=1395	8.6622	2	1916.8088	1916.8088	R	R	1485	1501
PSM	KRSPQDVEVLK	484	sp|Q99996-5|AKAP9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=4983	26.774	3	1377.7017	1377.7017	K	T	2675	2686
PSM	KTPSKPPAQLSPSVPK	485	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=6669	35.796	2	1740.9175	1740.9175	K	R	256	272
PSM	LDTDDLDEIEK	486	sp|Q9UMR2-3|DD19B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12059	66.153	2	1304.5984	1304.5984	R	I	357	368
PSM	LELKASPNVEAPQPHR	487	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=9053	49.213	2	1864.9197	1864.9197	R	H	1256	1272
PSM	LHQLSGSDQLESTAHSR	488	sp|O60271-5|JIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=6811	36.633	3	1944.8691	1944.8691	K	I	179	196
PSM	LKAEPAAPPAAPSTPAPPPAVPK	489	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=9956	54.224	3	2254.1763	2254.1763	R	E	504	527
PSM	LKTEKEPDATPPSPR	490	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=3737	20.231	2	1744.8397	1744.8397	K	T	329	344
PSM	LKTEKEPDATPPSPR	491	sp|P28715|ERCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=3903	21.066	3	1744.8397	1744.8397	K	T	329	344
PSM	LPPPKPLPGTLK	492	sp|O14672-2|ADA10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=10091	54.966	2	1336.752	1336.7520	K	R	409	421
PSM	LQHYTSGHMTPGMK	493	sp|P29323-2|EPHB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:35,10-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=1418	8.7553	3	1698.6895	1698.6895	K	I	581	595
PSM	LQHYTSGHMTPGMK	494	sp|P29323-2|EPHB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,9-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=1960	11.199	2	1698.6895	1698.6895	K	I	581	595
PSM	LSGEHSESSTPRPR	495	sp|Q7Z3K3-5|POGZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=1004	7.0625	2	1618.7101	1618.7101	K	S	1264	1278
PSM	LSVHDMKPLDSPGR	496	sp|Q15643|TRIPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5799	31.095	3	1646.7488	1646.7488	K	R	1881	1895
PSM	LSVHDMKPLDSPGR	497	sp|Q15643|TRIPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=9799	53.378	3	1630.7538	1630.7538	K	R	1881	1895
PSM	MPIHDHDSGVEDEDFSPR	498	sp|Q15468|STIL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=8188	44.398	3	2177.8361	2177.8361	K	P	388	406
PSM	NAGSAVTMSDEHANKPAESPTSVLEKPDR	499	sp|Q9C0G0-3|ZN407_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=8805	47.865	3	3133.4023	3133.4023	K	G	934	963
PSM	NFTKPQDGDVIAPLITPQKK	500	sp|Q9Y3Z3-3|SAMH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	16-UNIMOD:21	ms_run[2]:scan=13369	74.226	3	2289.177	2289.1770	R	E	507	527
PSM	PGAEGAPLLPPPLPPPSPPGSGR	501	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	17-UNIMOD:21	ms_run[2]:scan=16694	95.971	3	2237.1246	2237.1246	R	G	27	50
PSM	RCSAGLGALAQRPGSVSK	502	sp|Q9NXV2|KCTD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4,3-UNIMOD:21	ms_run[2]:scan=9163	49.843	3	1893.9244	1893.9244	R	W	27	45
PSM	RDSLQKPGLEAPPR	503	sp|Q9NRM7|LATS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=7033	37.922	3	1642.8192	1642.8192	R	A	378	392
PSM	RESKPEEPPPPK	504	sp|O00255-3|MEN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1459	8.9182	2	1469.6916	1469.6916	R	K	450	462
PSM	RGSVSSVSPKPPSSFK	505	sp|Q9NZJ0|DTL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=7566	40.904	2	1725.8451	1725.8451	R	M	483	499
PSM	RHSSLIDIDSVPTYK	506	sp|Q7LDG7|GRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=13985	78.117	2	1809.8662	1809.8662	R	W	114	129
PSM	RKGSLADVVDTLK	507	sp|P35711-4|SOX5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=12623	69.639	3	1480.7651	1480.7651	R	Q	122	135
PSM	RKPSTPLSEVIVK	508	sp|Q92547|TOPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=10732	58.513	3	1532.8327	1532.8327	K	N	857	870
PSM	RLSTSPDVIQGHQPR	509	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=7234	39.059	3	1769.8574	1769.8574	R	D	264	279
PSM	RMSLIEEEGSKR	510	sp|P06737-2|PYGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,3-UNIMOD:21	ms_run[2]:scan=3885	20.974	3	1529.6909	1529.6909	R	I	394	406
PSM	RNTDLPLLDMHTVTR	511	sp|Q8IWJ2|GCC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=12309	67.732	3	1876.8866	1876.8866	R	E	1498	1513
PSM	RPASVSSSAAVEHEQR	512	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=3355	18.346	3	1789.8108	1789.8108	K	E	237	253
PSM	RPETWESPEKPK	513	sp|Q5VUA4|ZN318_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=4486	24.078	2	1562.713	1562.7130	K	T	1965	1977
PSM	RSASASHQADIK	514	sp|Q14739|LBR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=898	6.6482	2	1349.6089	1349.6089	R	E	96	108
PSM	RSSPPGHYYQK	515	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1779	10.341	3	1398.6082	1398.6082	R	S	121	132
PSM	RSSPPGHYYQK	516	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1996	11.37	3	1398.6082	1398.6082	R	S	121	132
PSM	RTHSDASDDEAFTTSK	517	sp|Q13017-2|RHG05_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=3564	19.346	3	1846.7371	1846.7371	R	T	1170	1186
PSM	RVGEQDSAPTQEKPTSPGK	518	sp|Q9BX66-3|SRBS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	16-UNIMOD:21	ms_run[2]:scan=2102	11.875	3	2090.9634	2090.9634	R	A	266	285
PSM	RVSSSGKPTSLK	519	sp|Q9ULD2|MTUS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=1359	8.5179	2	1325.6704	1325.6704	R	T	758	770
PSM	RVTQGAASPGHGIQEK	520	sp|Q9HB58-2|SP110_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=2261	12.748	2	1714.8152	1714.8152	R	L	170	186
PSM	SGGGLHSVAEGVRLSPEPGR	521	sp|Q9NWK9-2|BCD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=11094	60.586	2	2040.9742	2040.9742	K	E	11	31
PSM	SGHHPGETPPLITPGSAQS	522	sp|Q14802|FXYD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	19-UNIMOD:21	ms_run[2]:scan=9892	53.891	2	1948.868	1948.8680	K	-	69	88
PSM	SHSPVPAAAPAHSPSPASPR	523	sp|Q2KJY2-2|KI26B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=4742	25.462	3	1999.9265	1999.9265	R	S	621	641
PSM	SHTSLKDELSDVSQGGSK	524	sp|O60271-5|JIP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=8036	43.497	3	1953.8681	1953.8681	R	A	242	260
PSM	SHVSSEPYEPISPPQVPVVHEK	525	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=14140	79.102	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SLNSTPPPPPAPAPAPPPALAR	526	sp|Q8TE68-4|ES8L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=12616	69.606	3	2195.114	2195.1140	R	P	328	350
PSM	SPSDPSHVSVPPPPLLLPAATTR	527	sp|Q8NDX5-2|PHC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=17708	103.01	3	2415.2199	2415.2199	K	S	634	657
PSM	SPSHSSSNRPFTPPTSTGGSK	528	sp|Q15648|MED1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=5144	27.645	2	2194.9644	2194.9644	K	S	1021	1042
PSM	SRDDLYDQDDSR	529	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3731	20.203	2	1483.6175	1483.6175	R	D	374	386
PSM	SRLEQEIATYR	530	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10927	59.619	2	1364.7048	1364.7048	K	S	371	382
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	531	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=9439	51.318	3	3112.5078	3112.5078	R	S	818	847
PSM	VAHSDKPGSTSTASFR	532	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=2815	15.613	2	1726.7676	1726.7676	K	D	206	222
PSM	VGGSEVTELSGSGHDSSYYDDRSDHER	533	sp|Q9H8M2|BRD9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	23-UNIMOD:21	ms_run[2]:scan=9077	49.34	3	3020.2057	3020.2057	K	E	34	61
PSM	VPPLQPMGPTCPTPAPVPPPEAPSPFR	534	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=16221	92.664	3	2929.3908	2929.3908	R	A	635	662
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	535	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:4,23-UNIMOD:21	ms_run[2]:scan=12369	68.114	3	2814.2433	2814.2433	R	G	194	223
PSM	VREEEIEVDSR	536	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5276	28.299	2	1359.663	1359.6630	R	V	628	639
PSM	WAHDKFSGEEGEIEDDESGTENR	537	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=10926	59.616	3	2716.0562	2716.0562	K	E	922	945
PSM	YHGHSMSDPGVSYR	538	sp|P08559-4|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3597	19.54	3	1687.645	1687.6450	R	T	327	341
PSM	YHGHSMSDPGVSYR	539	sp|P08559-4|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3613	19.625	2	1687.645	1687.6450	R	T	327	341
PSM	VFDEFKPLVEEPQNLIK	540	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=19227	113.80632666666666	2	2045.086648	2044.088094	K	Q	397	414
PSM	VGAHAGEYGAEALER	541	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7737	41.814593333333335	3	1528.726615	1528.727020	K	M	18	33
PSM	TYFPHFDLSHGSAQVK	542	sp|P69905|HBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	2-UNIMOD:21	ms_run[1]:scan=14078	78.727	3	1912.850839	1912.850914	K	G	42	58
PSM	HIKEEPLSEEEPCTSTAIASPEK	543	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=11253	61.47319833333333	3	2662.174342	2661.188095	K	K	495	518
PSM	QDDSPPRPIIGPALPPGFIK	544	sp|Q8IXQ4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=20160	120.66180166666666	2	2178.0932	2177.0912	K	S	102	122
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	545	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	15-UNIMOD:21	ms_run[1]:scan=8848	48.08356666666667	3	3112.498979	3112.507789	R	S	847	876
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	546	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14727	82.82221	3	3459.418883	3459.429735	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	547	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15854	90.245775	3	3442.4009	3442.4027	K	L	104	135
PSM	KSNLDEEVNVIPPHTPVR	548	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	15-UNIMOD:21	ms_run[1]:scan=11540	63.15377666666667	3	2123.042257	2123.041234	R	T	359	377
PSM	SETAPAAPAAPAPAEKTPVK	549	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7950	43.01559833333334	2	2024.9812	2024.9815	M	K	2	22
PSM	GRSLERGLDHDFGPSR	550	sp|Q9UDY2|ZO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=11281	61.625685	3	1878.838403	1877.853374	R	D	218	234
PSM	KADTTTPTTIDPIHEPPSLPPEPK	551	sp|O60885|BRD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	6-UNIMOD:21	ms_run[1]:scan=13680	76.163965	3	2660.292889	2661.293880	R	T	291	315
PSM	HPEPVPEEGSEDELPPQVHK	552	sp|Q7Z3C6|ATG9A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:21	ms_run[1]:scan=9418	51.203133333333334	3	2329.029673	2329.026372	R	V	819	839
PSM	QERLSPEVAPPAHR	553	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=8242	44.68486666666667	2	1648.7716	1648.7717	K	R	31	45
PSM	KNQKPSQVNGAPGSPTEPAGQK	554	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	14-UNIMOD:21	ms_run[1]:scan=2854	15.803754999999999	3	2300.079409	2299.095789	K	Q	1254	1276
PSM	RLSTSPDVIQGHQPR	555	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=8149	44.16941166666666	3	1770.841665	1769.857397	R	D	264	279
PSM	RQDDATGAGQDSENEVSLVSGHQR	556	sp|P16157|ANK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	17-UNIMOD:21	ms_run[1]:scan=8195	44.44307833333333	3	2636.111076	2635.125980	K	G	1655	1679
PSM	ARGSEDDDAQAQHPR	557	sp|Q6UB99|ANR11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	4-UNIMOD:21	ms_run[1]:scan=722	5.946763333333333	3	1731.688018	1731.696205	K	K	2371	2386
PSM	KKSPNELVDDLFK	558	sp|Q9UNZ2|NSF1C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=16031	91.46800333333333	2	1612.792753	1611.790940	R	G	112	125
PSM	KEESEESDDDMGFGLFD	559	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=17120	98.88493333333334	2	2045.712967	2044.713279	K	-	98	115
PSM	SETAPAETATPAPVEKSPAK	560	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7381	39.862321666666666	2	2102.9763	2102.9768	M	K	2	22
PSM	RKTDVISDTFPGK	561	sp|Q9BY89|K1671_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=9126	49.631096666666664	3	1541.758898	1542.744324	R	I	1177	1190
PSM	KKEEPSQNDISPK	562	sp|Q9NR30|DDX21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	11-UNIMOD:21	ms_run[1]:scan=1667	9.804133333333333	2	1579.718540	1578.729068	K	T	79	92
PSM	EKEISDDEAEEEK	563	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:21	ms_run[1]:scan=2905	16.065991666666665	2	1629.628749	1629.629473	R	G	222	235
PSM	RLPQDHADSCVVSSDDEELSR	564	sp|P78317|RNF4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:4,14-UNIMOD:21	ms_run[1]:scan=8769	47.684455	3	2493.038730	2494.043162	R	D	82	103
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	565	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15032	84.85167666666668	3	3458.402491	3459.429735	K	L	104	135
PSM	ADDKETCFAEEGKK	566	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4	ms_run[2]:scan=3287	17.965	3	1626.7196	1626.7196	K	L	585	599
PSM	AGDLLEDSPKRPK	567	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=5419	29.037	2	1504.7287	1504.7287	R	E	151	164
PSM	AGVLAHLEEER	568	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10386	56.628	2	1222.6306	1222.6306	R	D	765	776
PSM	AIHVNRTYDEQVTSR	569	sp|Q9HCR9|PDE11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=6816	36.658	3	1867.8578	1867.8578	K	A	130	145
PSM	AQLHVQGLLHEAGSTDDR	570	sp|Q9H2V7-3|SPNS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:21	ms_run[2]:scan=11829	64.82	3	2025.9269	2025.9269	R	I	418	436
PSM	AQTPHEDGGPQPHR	571	sp|Q9BRZ2|TRI56_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=932	6.7802	2	1605.6685	1605.6685	R	G	440	454
PSM	ARHTLDELNPQK	572	sp|Q13131|AAPK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=5918	31.706	2	1500.7086	1500.7086	R	S	385	397
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	573	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=7985	43.212	2	2465.0431	2465.0431	R	A	90	114
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	574	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=8123	44.034	3	2465.0431	2465.0431	R	A	90	114
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	575	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=8305	45.047	3	2465.0431	2465.0431	R	A	90	114
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	576	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=14604	82.004	3	3459.4297	3459.4297	K	L	104	135
PSM	DRDDEEAAPLLR	577	sp|P51798-2|CLCN7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8545	46.426	2	1398.6739	1398.6739	R	R	14	26
PSM	FLQEHGSDSFLAEHK	578	sp|Q00688|FKBP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=11362	62.114	3	1823.788	1823.7880	K	L	28	43
PSM	GMKDDKEEEEDGTGSPQLNNR	579	sp|P49407-2|ARRB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:21	ms_run[2]:scan=3877	20.933	3	2427.985	2427.9850	K	-	390	411
PSM	GPGAPASPSASHPQGLDTTPKPH	580	sp|P98171|RHG04_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=6187	33.115	2	2286.043	2286.0430	R	-	924	947
PSM	GPPSPPAPVMHSPSR	581	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=8238	44.66	3	1592.7171	1592.7171	R	K	221	236
PSM	GRISAHQGAQVDSR	582	sp|O95049-5|ZO3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=1975	11.265	2	1560.7158	1560.7158	R	H	825	839
PSM	GRKESEFDDEPK	583	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=2950	16.311	3	1515.6243	1515.6243	K	F	440	452
PSM	GRPPAEKLSPNPPK	584	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=3886	20.978	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPK	585	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=4167	22.376	2	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPK	586	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=4355	23.382	2	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPNLTK	587	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=8173	44.322	3	1894.9666	1894.9666	R	K	1411	1428
PSM	GVPHPEDDHSQVEGPESLR	588	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:21	ms_run[2]:scan=8408	45.613	3	2163.9222	2163.9222	K	-	679	698
PSM	HAHSLGSLDASK	589	sp|Q96JN0-3|LCOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=4092	22.008	2	1301.5765	1301.5765	R	V	1045	1057
PSM	HESEEKGDVEQKPESESALDMR	590	sp|Q15751|HERC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=4945	26.559	3	2625.0902	2625.0902	R	T	2420	2442
PSM	HGLTSGSASPPPPALPLYPDPVR	591	sp|Q92610|ZN592_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=16541	94.914	3	2405.1781	2405.1781	K	L	683	706
PSM	HIDLVEGDEGR	592	sp|P19367-4|HXK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6406	34.294	2	1238.5891	1238.5891	R	M	232	243
PSM	HPEPVPEEGSEDELPPQVHK	593	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=10368	56.532	3	2329.0264	2329.0264	R	V	758	778
PSM	HRPSEADEEELAR	594	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=4427	23.751	3	1617.6784	1617.6784	K	R	486	499
PSM	HRPSPPATPPPK	595	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1802	10.445	2	1440.6316	1440.6316	R	T	399	411
PSM	HSLPSGLGLSETQITSHGFDNTK	596	sp|P53367-2|ARFP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=16273	93.028	3	2505.1537	2505.1537	K	E	35	58
PSM	HVVLGAIENKVESK	597	sp|P41227-2|NAA10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=9607	52.289	2	1601.8178	1601.8178	R	G	155	169
PSM	IRLDETDDPDDYGDR	598	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9382	50.997	2	1793.7704	1793.7704	K	E	399	414
PSM	KGPSGYGFNLHSDK	599	sp|O14745-2|NHRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=9388	51.029	3	1585.6926	1585.6926	K	S	3	17
PSM	KHSLSSVTYVPR	600	sp|Q9Y271|CLTR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=7681	41.531	3	1452.7126	1452.7126	R	K	311	323
PSM	KHSLSSVTYVPR	601	sp|Q9Y271|CLTR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=7689	41.567	2	1452.7126	1452.7126	R	K	311	323
PSM	KKEPAITSQNSPEAR	602	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=1742	10.172	3	1734.8302	1734.8302	K	E	69	84
PSM	KPASPPLPATQQEKPSQTPEAGR	603	sp|Q6ZU35|K1211_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=6312	33.809	3	2494.2217	2494.2217	R	K	1039	1062
PSM	KPEPLSPASYHQPEGVAR	604	sp|O94964-3|SOGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=9090	49.412	3	2041.9623	2041.9623	K	I	444	462
PSM	KPSHTSAVSIAGK	605	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=2627	14.748	2	1361.6704	1361.6704	R	E	92	105
PSM	KQPPKEPSEVPTPK	606	sp|P17096-2|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=3971	21.404	2	1640.8175	1640.8175	R	R	31	45
PSM	KRLSQSDEDVIR	607	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=5360	28.722	2	1524.7297	1524.7297	K	L	118	130
PSM	KSVSSENPTYPSAPLKPVTVPPR	608	sp|Q5HYK7-2|SH319_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=11764	64.444	3	2530.2833	2530.2833	K	L	147	170
PSM	LELKASPNVEAPQPHR	609	sp|P50851-2|LRBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=9040	49.141	3	1864.9197	1864.9197	R	H	1256	1272
PSM	LKGMKDDDYDDQLC	610	sp|P32121-5|ARRB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=5938	31.805	2	1730.7128	1730.7128	R	-	381	395
PSM	LLYAGHVQTVHSPDIYR	611	sp|O15417|TNC18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=12141	66.661	3	2047.9881	2047.9881	K	V	2173	2190
PSM	LQHYTSGHMTPGMK	612	sp|P29323-2|EPHB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:35,10-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=1422	8.7687	2	1698.6895	1698.6895	K	I	581	595
PSM	LRPGALGGAADVEDTK	613	sp|Q01970-2|PLCB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=8243	44.689	3	1568.8158	1568.8158	R	E	940	956
PSM	LSVHDMKPLDSPGR	614	sp|Q15643|TRIPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5762	30.898	2	1646.7488	1646.7488	K	R	1881	1895
PSM	LVPIKPAPLPLSPGK	615	sp|Q02086-2|SP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=14540	81.583	2	1605.9259	1605.9259	K	N	60	75
PSM	MSKPGSPGSVIPAQAHGK	616	sp|Q8IZD2-6|KMT2E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=6367	34.096	2	1843.8652	1843.8652	K	I	1354	1372
PSM	NKPGPNIESGNEDDDASFK	617	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=8336	45.222	3	2112.8637	2112.8637	K	I	206	225
PSM	NTPSQHSHSIQHSPER	618	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,13-UNIMOD:21	ms_run[2]:scan=986	6.989	2	2000.7891	2000.7891	K	S	254	270
PSM	PGAEGAPLLPPPLPPPSPPGSGR	619	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:21	ms_run[2]:scan=16841	96.976	3	2237.1246	2237.1246	R	G	27	50
PSM	RAPSVANVGSHCDLSLK	620	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=10089	54.956	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RASAAAAAGGGATGHPGGGQGAENPAGLK	621	sp|Q07617|SPAG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=5807	31.134	3	2538.1725	2538.1725	R	S	421	450
PSM	RDTSGGIDLGEEQHPLGTPTPGR	622	sp|Q9UIF8-4|BAZ2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	18-UNIMOD:21	ms_run[2]:scan=11233	61.357	3	2469.1285	2469.1285	K	K	1070	1093
PSM	RELDRYSLDSEDLYSR	623	sp|Q9UPX8-4|SHAN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=12572	69.352	2	2095.9212	2095.9212	R	N	359	375
PSM	RGAAAADLLSSSPESQHGGTQSPGGGQPLLQPTK	624	sp|Q9H3S7|PTN23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	22-UNIMOD:21	ms_run[2]:scan=13379	74.278	3	3379.6158	3379.6158	R	V	1112	1146
PSM	RGFEGSCSQKESEEGNPVR	625	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=4895	26.29	2	2231.9267	2231.9267	K	G	474	493
PSM	RGHTASESDEQQWPEEK	626	sp|Q9NTI5-5|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=5285	28.342	2	2092.8487	2092.8487	K	R	22	39
PSM	RGSGHPAYAEVEPVGEK	627	sp|Q6UX71-2|PXDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=6900	37.145	3	1861.836	1861.8360	R	E	455	472
PSM	RGSGHPAYAEVEPVGEK	628	sp|Q6UX71-2|PXDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=6913	37.229	2	1861.836	1861.8360	R	E	455	472
PSM	RIQLVEEELDR	629	sp|P09493-2|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11847	64.936	2	1398.7467	1398.7467	R	A	35	46
PSM	RKSELPQDVYTIK	630	sp|Q14738-3|2A5D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9747	53.055	2	1655.8284	1655.8284	R	A	465	478
PSM	RKSGGNEVSIEER	631	sp|Q15061|WDR43_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3074	16.966	2	1539.7042	1539.7042	K	L	429	442
PSM	RPASPSSPEHLPATPAESPAQR	632	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=7968	43.129	3	2362.1067	2362.1067	K	F	231	253
PSM	RPILQLSPPGPR	633	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=13156	72.866	3	1409.7544	1409.7544	R	G	12	24
PSM	RPMEEDGEEKSPSK	634	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=633	5.5908	2	1713.6917	1713.6917	K	K	372	386
PSM	RRDSDGVDGFEAEGK	635	sp|Q96KR1|ZFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=5970	31.96	3	1716.7105	1716.7105	R	K	1051	1066
PSM	RRPGASPTGETPTIEEGEEDEDEASEAEGAR	636	sp|P04920-2|B3A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=10735	58.528	3	3351.4012	3351.4012	R	A	94	125
PSM	RRSIYDTVTDTEMVEK	637	sp|Q6PIF6-2|MYO7B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=9445	51.352	3	2037.9078	2037.9078	K	V	902	918
PSM	RSNSEVEDVGPTSHNR	638	sp|Q13206|DDX10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=3224	17.668	3	1862.7908	1862.7908	K	K	828	844
PSM	RSSGREEDDEELLR	639	sp|O14639-4|ABLM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=6601	35.361	2	1769.7581	1769.7581	R	R	208	222
PSM	RSSKEEAEMAYK	640	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1293	8.2447	3	1523.6327	1523.6327	K	D	733	745
PSM	RSSPPGHYYQK	641	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=2194	12.385	3	1398.6082	1398.6082	R	S	121	132
PSM	RSTVLGLPQHVQK	642	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=8421	45.697	2	1541.8079	1541.8079	R	E	160	173
PSM	RVSVHPDYR	643	sp|P00736|C1R_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3940	21.236	2	1207.5499	1207.5499	R	Q	539	548
PSM	SDSVLPASHGHLPQAGSLER	644	sp|Q8N4C8-5|MINK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:21	ms_run[2]:scan=11444	62.573	2	2136.9953	2136.9953	R	N	690	710
PSM	SFSRDRDEAGGK	645	sp|P29536-2|LMOD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=1584	9.4477	2	1403.5831	1403.5831	K	S	105	117
PSM	SGHHPGETPPLITPGSAQS	646	sp|Q14802|FXYD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:21	ms_run[2]:scan=9646	52.504	2	1948.868	1948.8680	K	-	69	88
PSM	SHVSSEPYEPISPPQVPVVHEK	647	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=13665	76.079	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SKHPSGSNVSFSR	648	sp|Q12767|TMM94_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=3189	17.517	3	1468.646	1468.6460	R	D	509	522
PSM	SKPLAASPKPAGLK	649	sp|P46821|MAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=4585	24.585	2	1443.7851	1443.7851	K	E	2265	2279
PSM	SLASPAGLQDGSAQHHPK	650	sp|Q9NQG7-2|HPS4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=6165	33.001	2	1879.8578	1879.8578	R	G	287	305
PSM	SLSQGTQLPSHVTPTTGVPTMSLHTPPSPSR	651	sp|Q9NZN8-4|CNOT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	21-UNIMOD:35,28-UNIMOD:21	ms_run[2]:scan=12797	70.676	3	3293.5752	3293.5752	R	G	99	130
PSM	SLSSSLQAPVVSTVGMQR	652	sp|P35900|K1C20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=15279	86.443	3	1941.9231	1941.9231	R	L	11	29
PSM	SPSPPLPTHIPPEPPR	653	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=12964	71.679	3	1797.8815	1797.8815	R	T	326	342
PSM	SRSDNALHLASER	654	sp|Q7Z3G6|PRIC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=6353	34.027	3	1534.6889	1534.6889	R	E	693	706
PSM	SRSLSQIHEAAVR	655	sp|Q9NZM1-5|MYOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=6173	33.038	3	1532.7461	1532.7461	R	M	727	740
PSM	SRTHSTSSSLGSGESPFSR	656	sp|Q9UGV2-2|NDRG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=8015	43.363	3	2045.8804	2045.8804	R	S	315	334
PSM	SSVVSPSHPPPAPPLGSPPGPK	657	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=11687	64.002	3	2168.0667	2168.0667	R	P	292	314
PSM	SVHISTPEKEPCAPLTIPSIR	658	sp|P28290-2|ITPI2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=15231	86.152	3	2411.192	2411.1920	K	N	284	305
PSM	TPPGPPPPDDDEDDPVPLPVSGDKEEDAPHR	659	sp|Q69YN4-4|VIR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=13013	71.962	3	3366.4565	3366.4565	R	E	184	215
PSM	VDINTPDVDVHGPDWHLK	660	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=14592	81.923	3	2135.9677	2135.9677	K	M	4762	4780
PSM	VHAYFAPVTPPPSVGGSR	661	sp|Q96IG2-2|FXL20_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=13414	74.493	3	1917.9138	1917.9138	K	Q	377	395
PSM	VIPAKSPPPPTHSTQLGAPSR	662	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=6639	35.599	3	2217.1307	2217.1307	K	K	200	221
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	663	sp|Q9Y2D5|AKAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=12295	67.646	3	3174.5598	3174.5598	K	N	773	803
PSM	VKVEEEEEEKVAEEEETSVK	664	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10593	57.764	3	2348.1119	2348.1119	K	K	466	486
PSM	VPFSPGPAPPPHMGELDQER	665	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=14342	80.338	3	2236.9977	2236.9977	R	L	584	604
PSM	VPHLEEVMSPVTTPTDEDVGHR	666	sp|Q3KR37-3|GRM1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=11801	64.656	3	2540.1254	2540.1254	R	I	264	286
PSM	VPLFIRPEDDDEK	667	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11954	65.55	2	1571.7831	1571.7831	R	Q	946	959
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	668	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=12048	66.095	3	2814.2433	2814.2433	R	G	194	223
PSM	VPSYDSFDSEDYPAALPNHKPK	669	sp|P14921-4|ETS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=13668	76.098	3	2556.121	2556.1210	R	G	64	86
PSM	VVSHPTLPVTITAHEDR	670	sp|Q13033-2|STRN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=11999	65.814	3	1950.9564	1950.9564	R	H	603	620
PSM	YHGHSMSDPGVSYR	671	sp|P08559-4|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=5898	31.613	2	1671.6501	1671.6501	R	T	327	341
PSM	ADDKETCFAEEGKK	672	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:4	ms_run[1]:scan=2865	15.850376666666666	3	1625.697097	1626.719552	K	L	585	599
PSM	SEVQQPVHPKPLSPDSR	673	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:21	ms_run[1]:scan=6675	35.83173166666666	3	1980.936086	1979.946606	K	A	350	367
PSM	GRPPAEKLSPNPPNLTK	674	sp|P51532|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:21	ms_run[1]:scan=8075	43.75125833333333	3	1895.952504	1894.966613	R	K	1444	1461
PSM	KSNLDEEVNVIPPHTPVR	675	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:21	ms_run[1]:scan=11367	62.13957833333333	3	2123.042257	2123.041234	R	T	359	377
PSM	SRSPLLVTVVESD	676	sp|Q5VWN6|F208B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	3-UNIMOD:21	ms_run[1]:scan=16175	92.36471166666666	2	1480.7174	1480.7169	R	P	2035	2048
PSM	HPSHSTTPSGPGDEVAR	677	sp|P53365|ARFP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=2751	15.318056666666669	2	1810.763396	1810.763556	R	G	70	87
PSM	QSPLHGNHITISHTQATGSR	678	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=8560	46.5094	3	2204.0121	2204.0119	R	S	257	277
PSM	QRGSETDTDSEIHESASDKDSLSK	679	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=6679	35.85102	3	2684.1077	2684.1081	R	G	1260	1284
PSM	VNHEPEPAGGATPGATLPKSPSQLR	680	sp|O00499|BIN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	20-UNIMOD:21	ms_run[1]:scan=10497	57.245284999999996	3	2590.255886	2590.254081	R	K	312	337
PSM	NRHSSGDPSSEGTSGSGSVSIR	681	sp|Q9UPU7|TBD2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:21	ms_run[1]:scan=3918	21.137908333333336	3	2239.945824	2239.945496	K	K	313	335
PSM	RRSPSPTPTPGPSR	682	sp|P49450|CENPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21,5-UNIMOD:21	ms_run[1]:scan=1451	8.88068	3	1651.721921	1651.723285	R	R	15	29
PSM	FASDDEHDEHDENGATGPVK	683	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=3669	19.877231666666667	3	2169.872188	2168.888284	K	R	364	384
PSM	RQDDATGAGQDSENEVSLVSGHQR	684	sp|P16157|ANK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	17-UNIMOD:21	ms_run[1]:scan=8380	45.45299833333333	3	2636.110738	2635.125980	K	G	1655	1679
PSM	AAVVTSPPPTTAPHKER	685	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=4133	22.212	3	1837.9088	1837.9088	R	Y	7	24
PSM	AHTFSHPPSSTK	686	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2122	11.952	2	1375.5922	1375.5922	R	R	640	652
PSM	AKSPQPPVEEEDEHFDDTVVCLDTYNCDLHFK	687	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,21-UNIMOD:4,27-UNIMOD:4	ms_run[2]:scan=18468	108.42	4	3913.6489	3913.6489	R	I	250	282
PSM	ANVLSSPCDQAGLHHR	688	sp|Q14153-2|FA53B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=7410	40.015	2	1840.804	1840.8040	R	F	174	190
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	689	sp|P46379-5|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	26-UNIMOD:21	ms_run[2]:scan=6933	37.343	3	2864.2839	2864.2839	R	G	88	119
PSM	AQTPHEDGGPQPHR	690	sp|Q9BRZ2|TRI56_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=959	6.8904	3	1605.6685	1605.6685	R	G	440	454
PSM	ASPGHSPHYFAASSPTSPNALPPAR	691	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=11678	63.957	3	2596.186	2596.1860	R	K	1847	1872
PSM	ASPPPQGPLPGPPGALHR	692	sp|Q96G74-2|OTUD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=11207	61.219	2	1824.9036	1824.9036	R	W	39	57
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	693	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=13771	76.755	3	3459.4297	3459.4297	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	694	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=16758	96.429	3	3459.4297	3459.4297	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	695	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=17521	101.72	3	3459.4297	3459.4297	K	L	104	135
PSM	CLHEDPQSPPPLPAEKPIGNTFSTVSGK	696	sp|Q5HYK7-2|SH319_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=14624	82.144	3	3082.4471	3082.4471	K	L	268	296
PSM	DAYRPTTDADKIEDEVTR	697	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11453	62.622	3	2093.9865	2093.9865	K	Q	5023	5041
PSM	DEGNYLDDALVR	698	sp|P09525-2|ANXA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=14840	83.573	2	1378.6365	1378.6365	R	Q	79	91
PSM	DHVYGIHNPVMTSPSQH	699	sp|O43490-2|PROM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=9010	48.969	3	2013.8404	2013.8404	K	-	840	857
PSM	DKEVSDDEAEEKEDK	700	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=1333	8.4044	2	1844.7201	1844.7201	R	E	227	242
PSM	DKSFDDEESVDGNRPSSAASAFK	701	sp|O75122-3|CLAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=9876	53.806	3	2458.0884	2458.0884	K	V	239	262
PSM	DLDKDDFLGR	702	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11005	60.063	2	1192.5724	1192.5724	K	C	724	734
PSM	DQHHLGSPSR	703	sp|Q9H8M2|BRD9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=1030	7.1684	2	1212.5037	1212.5037	R	L	560	570
PSM	DREPHGYSPER	704	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=2287	12.862	3	1421.5725	1421.5725	R	L	930	941
PSM	DRSSPPPGYIPDELHQVAR	705	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13213	73.227	3	2213.0266	2213.0266	R	N	161	180
PSM	DRSVPNLTEGSLHEPGR	706	sp|Q96NW4|ANR27_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10357	56.48	3	1942.8898	1942.8898	R	Q	960	977
PSM	DRTPPHLLYSDR	707	sp|Q8NDT2-2|RB15B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8985	48.821	3	1548.7086	1548.7086	R	D	203	215
PSM	FHQLDIDDLQSIR	708	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=16068	91.695	2	1598.8053	1598.8053	R	A	59	72
PSM	FNGGHSPTHSPEK	709	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=1029	7.1648	2	1473.6038	1473.6038	R	I	505	518
PSM	GLAHPPSYSNPPVYHGNSPK	710	sp|Q92738|US6NL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	18-UNIMOD:21	ms_run[2]:scan=8855	48.118	3	2197.9946	2197.9946	R	H	625	645
PSM	GLHSENREDEGWQVYR	711	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=10315	56.239	3	2053.8643	2053.8643	R	L	81	97
PSM	GMAYGHIDSYGADDSEEEGAGPVERPPVR	712	sp|Q8NG27-3|PJA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=11399	62.329	3	3156.3132	3156.3132	R	G	57	86
PSM	GPPSPPAPVMHSPSR	713	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=8117	43.998	2	1592.7171	1592.7171	R	K	221	236
PSM	GPQLFHMDPSGTFVQCDAR	714	sp|P28066-2|PSA5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35,16-UNIMOD:4	ms_run[2]:scan=13092	72.477	3	2177.9623	2177.9623	K	A	92	111
PSM	GVGHEFQKVSVDK	715	sp|Q6GYQ0-3|RGPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=6400	34.268	3	1508.7025	1508.7025	K	S	702	715
PSM	GVPHPEDDHSQVEGPESLR	716	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=8780	47.735	3	2163.9222	2163.9222	K	-	679	698
PSM	HEIVDTPPGPEHLQDK	717	sp|Q96S15-2|WDR24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=8894	48.338	3	1890.8513	1890.8513	R	A	576	592
PSM	HFILDECDK	718	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:4	ms_run[2]:scan=8895	48.342	2	1175.5281	1175.5281	K	M	192	201
PSM	HFVLDECDK	719	sp|O00148-3|DX39A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:4	ms_run[2]:scan=7194	38.851	2	1161.5125	1161.5125	K	M	191	200
PSM	HGAEPQASPAVHLPESPQSPK	720	sp|Q03989-5|ARI5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=9097	49.448	3	2243.0372	2243.0372	R	G	214	235
PSM	HGSCDLENLHLR	721	sp|Q14586|ZN267_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=10486	57.189	3	1529.6446	1529.6446	R	K	103	115
PSM	HHNSTAELQK	722	sp|P33527-8|MRP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=925	6.7559	3	1243.5347	1243.5347	R	A	812	822
PSM	HIAEEADR	723	sp|P06753-4|TPM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=958	6.8876	2	939.44101	939.4410	K	K	117	125
PSM	HPPLYQAGLTPPLSPPK	724	sp|Q9ULL5-2|PRR12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:21	ms_run[2]:scan=14870	83.77	2	1891.9597	1891.9597	R	S	474	491
PSM	HPPVLTPPDQEVIR	725	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=12308	67.728	3	1676.8287	1676.8287	R	N	636	650
PSM	HPPVLTPPDQEVIR	726	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=12474	68.733	3	1676.8287	1676.8287	R	N	636	650
PSM	HQASINELKR	727	sp|Q9H4G0-4|E41L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=3826	20.694	3	1274.6132	1274.6132	K	T	464	474
PSM	HRPSEADEEELAR	728	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=4132	22.209	2	1617.6784	1617.6784	K	R	486	499
PSM	HRPSEADEEELAR	729	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=4616	24.756	3	1617.6784	1617.6784	K	R	486	499
PSM	HRPSPPATPPPK	730	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1585	9.4512	2	1440.6316	1440.6316	R	T	399	411
PSM	HVFGESDELIGQK	731	sp|P60174-1|TPIS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10350	56.446	3	1457.7151	1457.7151	R	V	101	114
PSM	IADPEHDHTGFLTEYVATR	732	sp|P27361-2|MK03_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21	ms_run[2]:scan=13104	72.546	3	2250.9947	2250.9947	R	W	190	209
PSM	IGHHSTSDDSSAYR	733	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=1318	8.3391	2	1611.6315	1611.6315	R	S	333	347
PSM	IIKPFPAPQTPGR	734	sp|P78536|ADA17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=10635	58.002	2	1500.7854	1500.7854	R	L	726	739
PSM	IRSHVATCSK	735	sp|Q9Y508-2|RN114_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=847	6.4588	2	1237.5639	1237.5639	K	Y	103	113
PSM	ISHEGSPVKPVAIR	736	sp|Q96II8-3|LRCH3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=5816	31.174	2	1568.8076	1568.8076	R	E	414	428
PSM	KFQEQECPPSPEPTRK	737	sp|P62070-2|RRAS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=4652	24.966	3	2036.9027	2036.9027	R	E	100	116
PSM	KFSAGGDSDPPLKR	738	sp|O75152|ZC11A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=5543	29.734	3	1553.7239	1553.7239	R	S	288	302
PSM	KIKTVVQEVVDGK	739	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=14668	82.439	2	1521.8168	1521.8168	R	V	399	412
PSM	KKDELSDYAEK	740	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=4571	24.508	2	1404.6174	1404.6174	K	S	988	999
PSM	KKEPAITSQNSPEAR	741	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=2115	11.928	3	1734.8302	1734.8302	K	E	69	84
PSM	KKSPIINESR	742	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1590	9.4759	3	1250.6384	1250.6384	R	S	275	285
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	743	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=12903	71.308	3	3605.6199	3605.6199	K	L	150	183
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	744	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=13070	72.344	3	3605.6199	3605.6199	K	L	150	183
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	745	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=13409	74.466	3	3605.6199	3605.6199	K	L	150	183
PSM	KLSHDAESER	746	sp|Q92766-5|RREB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=866	6.5299	2	1250.5292	1250.5292	R	E	173	183
PSM	KNKSPPADPPR	747	sp|O60566-2|BUB1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=870	6.544	2	1285.618	1285.6180	K	V	491	502
PSM	KNLEHTSFR	748	sp|Q6UXY8-2|TMC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=3406	18.591	2	1210.5496	1210.5496	R	I	186	195
PSM	KNQDDDDDDDDGFFGPALPPGFK	749	sp|Q8IXQ4-4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=17856	104.06	3	2524.0666	2524.0666	R	K	78	101
PSM	KNSEPGSPHSLEALR	750	sp|Q9ULC5-3|ACSL5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8016	43.367	3	1700.7883	1700.7883	R	D	26	41
PSM	KNVDRVSIR	751	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=3167	17.418	2	1165.5969	1165.5969	R	S	667	676
PSM	KPDAKPENFITQIETTPTETASR	752	sp|Q96IY1|NSL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21	ms_run[2]:scan=13957	77.945	3	2653.2636	2653.2636	R	K	227	250
PSM	KPLPDHVSIVEPK	753	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=10570	57.639	2	1537.7905	1537.7905	K	D	202	215
PSM	KPSHTSAVSIAGK	754	sp|Q9HC35-2|EMAL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=2625	14.741	3	1361.6704	1361.6704	R	E	92	105
PSM	KQDFDEDDILK	755	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10848	59.173	2	1364.646	1364.6460	K	E	50	61
PSM	KRPASLSTAPSEK	756	sp|Q9UPN4-3|CP131_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=2260	12.744	2	1450.7181	1450.7181	K	G	110	123
PSM	KRSAEPAEALVLACK	757	sp|Q96CW6|S7A6O_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=10884	59.383	3	1721.8536	1721.8536	R	R	14	29
PSM	KRSPSPSPTPEAK	758	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=978	6.9614	2	1460.7025	1460.7025	R	K	300	313
PSM	KSPSGPVKSPPLSPVGTTPVK	759	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=9551	51.946	3	2139.1341	2139.1341	R	L	177	198
PSM	KSPVGKSPPSTGSTYGSSQK	760	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=3908	21.091	3	2058.9623	2058.9623	K	E	314	334
PSM	LEDPHGKPYFYNPEDSSVR	761	sp|Q6ZUM4-2|RHG27_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=11747	64.354	3	2329.0052	2329.0052	R	W	79	98
PSM	LFRPPSPAPAAPGAR	762	sp|Q86U90|YRDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=9875	53.804	3	1583.7974	1583.7974	R	L	32	47
PSM	LLRPLSPVTPPPPNSGSK	763	sp|Q9C0A6-2|SETD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=11467	62.707	3	1936.0183	1936.0183	K	S	736	754
PSM	LRLSPSPTSQR	764	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=7018	37.84	2	1400.6214	1400.6214	R	S	288	299
PSM	LSEHSSPEEEASPHQR	765	sp|Q9UD71-2|PPR1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=2234	12.623	3	1898.7796	1898.7796	R	A	5	21
PSM	LVHSGSGCRSPSLGSDLTFATR	766	sp|Q13425|SNTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=13087	72.451	3	2384.0944	2384.0944	R	T	384	406
PSM	MHPSLSHSEALASPAK	767	sp|Q6R327|RICTR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=7085	38.261	2	1757.7808	1757.7808	R	D	1341	1357
PSM	MRSPQPARPGSAAVPGAAFAPIPR	768	sp|Q8N3V7-2|SYNPO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,3-UNIMOD:21,11-UNIMOD:21	ms_run[2]:scan=14255	79.819	3	2577.2077	2577.2077	R	S	802	826
PSM	NHSPLPPPQTNHEEPSR	769	sp|Q13094|LCP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=3835	20.738	3	2015.8851	2015.8851	R	S	205	222
PSM	PFSPPIHSSSPPPIAPLAR	770	sp|Q9BQI5-4|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=15433	87.466	2	2047.0292	2047.0292	R	A	285	304
PSM	PKSPSSGSGGGGPKPYK	771	sp|Q9ULD5|ZN777_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=1157	7.6678	2	1666.7716	1666.7716	R	C	621	638
PSM	PSPTSPVKPSSPASKPDGPAELPLTDR	772	sp|Q13905-2|RPGF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=11547	63.195	3	2807.3743	2807.3743	R	E	174	201
PSM	PTTPLSVGTIVPPPRPASR	773	sp|Q0JRZ9-3|FCHO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=13676	76.142	2	2022.0663	2022.0663	R	P	418	437
PSM	RAETFGGFDSHQMNASK	774	sp|Q12802-4|AKP13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=7110	38.4	3	1977.804	1977.8040	R	G	2444	2461
PSM	RDSSESQLASTESDKPTTGR	775	sp|Q96B23-2|CR025_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=4673	25.078	3	2230.9703	2230.9703	R	V	64	84
PSM	REQDSPPMKPSALDAIR	776	sp|Q16799-2|RTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=9374	50.956	3	2005.9292	2005.9292	K	E	63	80
PSM	RESKPEEPPPPK	777	sp|O00255-3|MEN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1445	8.8577	3	1469.6916	1469.6916	R	K	450	462
PSM	RFDEDDDK	778	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1261	8.1221	2	1038.4254	1038.4254	R	S	1125	1133
PSM	RGDDSFGDK	779	sp|P23588-2|IF4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1381	8.6066	2	995.43084	995.4308	R	Y	176	185
PSM	RGLLYDSDEEDEERPAR	780	sp|P49736|MCM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=9276	50.449	2	2128.9063	2128.9063	R	K	133	150
PSM	RGSLCSGCQKPITGR	781	sp|P49023-4|PAXI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=3667	19.872	3	1755.791	1755.7910	R	C	364	379
PSM	RHPDYSVVLLLR	782	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=15305	86.614	3	1466.8358	1466.8358	R	L	361	373
PSM	RIQLVEEELDR	783	sp|P09493-2|TPM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11850	64.951	3	1398.7467	1398.7467	R	A	35	46
PSM	RKSVDAIGGESMPIPTIDTSR	784	sp|Q9BWT3|PAPOG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=11504	62.937	3	2325.1036	2325.1036	K	K	682	703
PSM	RKTVTAMDVVYALK	785	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=12883	71.173	3	1689.8525	1689.8525	K	R	79	93
PSM	RLIDSSGSASVLTHSSSGNSLK	786	sp|Q96SU4-5|OSBL9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	20-UNIMOD:21	ms_run[2]:scan=10224	55.751	3	2282.0904	2282.0904	K	R	132	154
PSM	RNPSPDHSYK	787	sp|Q15696|U2AFM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=1002	7.0555	2	1279.5347	1279.5347	R	R	381	391
PSM	RNSIEVAGLSHGLEGLR	788	sp|Q16825|PTN21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=15260	86.332	2	1886.9364	1886.9364	K	L	635	652
PSM	RPAEATSSPTSPERPR	789	sp|Q9BU76|MMTA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=1799	10.431	2	1817.8421	1817.8421	R	H	210	226
PSM	RPILQLSPPGPR	790	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=13338	74.018	2	1409.7544	1409.7544	R	G	12	24
PSM	RPMEEDGEEKSPSK	791	sp|Q12906-5|ILF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=650	5.6529	3	1713.6917	1713.6917	K	K	372	386
PSM	RPPSSSSSSSASSYTGRPIELDK	792	sp|Q9BZL6-2|KPCD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=8369	45.396	3	2475.1279	2475.1279	R	M	76	99
PSM	RRTASPPPPPK	793	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1368	8.5552	3	1362.6211	1362.6211	K	R	612	623
PSM	RSSPPGHYYQK	794	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2026	11.502	2	1398.6082	1398.6082	R	S	121	132
PSM	RVSEVEEEKEPVPQPLPSDDTR	795	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10394	56.67	3	2615.2116	2615.2116	R	V	446	468
PSM	RVSLEPHQGPGTPESK	796	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=5270	28.272	2	1797.8411	1797.8411	K	K	853	869
PSM	SAHTVEHGSPR	797	sp|Q96GP6-2|SREC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=631	5.5837	2	1256.5299	1256.5299	K	T	705	716
PSM	SATASPQLSHHSLR	798	sp|Q9BX66-3|SRBS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=4368	23.447	2	1570.7253	1570.7253	R	A	800	814
PSM	SDSVLPASHGHLPQAGSLER	799	sp|Q8N4C8-5|MINK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=11498	62.904	3	2136.9953	2136.9953	R	N	690	710
PSM	SEVQQPVHPKPLSPDSR	800	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=6207	33.216	2	1979.9466	1979.9466	K	A	350	367
PSM	SHSPVPAAAPAHSPSPASPR	801	sp|Q2KJY2-2|KI26B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=4797	25.738	2	1999.9265	1999.9265	R	S	621	641
PSM	SKSPNNEGDVHFSR	802	sp|Q8NAP3|ZBT38_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=4097	22.032	2	1652.6944	1652.6944	R	E	307	321
PSM	SNHLNHVSPGQLTK	803	sp|Q8N7R7-3|CCYL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=6795	36.555	2	1610.7566	1610.7566	K	K	35	49
PSM	SNSQSYIGRPIHLDK	804	sp|Q15139|KPCD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=9884	53.852	2	1793.8462	1793.8462	R	I	247	262
PSM	SPSPPLPTHIPPEPPR	805	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12458	68.639	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	806	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12795	70.665	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	807	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13922	77.727	3	1797.8815	1797.8815	R	T	326	342
PSM	SRPLATGPSSQSHQEK	808	sp|Q96RL1-2|UIMC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=1485	9.0313	2	1788.8156	1788.8156	R	T	131	147
PSM	SSGVSGGKPGLLPAHSR	809	sp|Q8IWB9|TEX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=5803	31.114	3	1685.825	1685.8250	K	H	717	734
PSM	TKPIVKPQTSPEYGQGINPISR	810	sp|O95793-2|STAU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=10909	59.534	3	2489.2679	2489.2679	K	L	188	210
PSM	TLRDSPNVEAAHLAR	811	sp|Q9UHF7|TRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=7889	42.645	3	1728.8308	1728.8308	K	P	826	841
PSM	VAHSDKPGSTSTASFR	812	sp|Q9P0L0|VAPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=3559	19.321	2	1726.7676	1726.7676	K	D	206	222
PSM	VHIDIGADGR	813	sp|P31942-6|HNRH3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7019	37.844	2	1051.5411	1051.5411	R	A	86	96
PSM	VNHEPEPAGGATPGATLPKSPSQLR	814	sp|O00499-6|BIN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	20-UNIMOD:21	ms_run[2]:scan=10316	56.243	3	2590.2541	2590.2541	R	K	281	306
PSM	VPFSPGPAPPPHMGELDQER	815	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=11587	63.44	3	2252.9926	2252.9926	R	L	584	604
PSM	VPKSPEHSAEPIR	816	sp|Q9ULH0-5|KDIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=3341	18.277	3	1525.729	1525.7290	R	T	324	337
PSM	VPPLQPMGPTCPTPAPVPPPEAPSPFR	817	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=16372	93.727	3	2929.3908	2929.3908	R	A	635	662
PSM	VPPLQPMGPTCPTPAPVPPPEAPSPFR	818	sp|Q8IZL8|PELP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35,11-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=16517	94.739	3	2929.3908	2929.3908	R	A	635	662
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	819	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:4,21-UNIMOD:21	ms_run[2]:scan=12211	67.107	3	2814.2433	2814.2433	R	G	194	223
PSM	VQTPDKQPLRPLVPDASK	820	sp|Q9NR12-2|PDLI7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=10376	56.575	3	2068.0718	2068.0718	K	Q	94	112
PSM	YCRPESQEHPEADPGSAAPYLK	821	sp|P40763-3|STAT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=8306	45.05	3	2581.0945	2581.0945	K	T	686	708
PSM	HIKEEPLSEEEPCTSTAIASPEK	822	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	8-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=10305	56.185516666666665	3	2662.177568	2661.188095	K	K	495	518
PSM	QDDSPPRPIIGPALPPGFIK	823	sp|Q8IXQ4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=20022	119.69799499999999	3	2178.0942	2177.0912	K	S	102	122
PSM	ERDHSPTPSVFNSDEER	824	sp|Q6UN15|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:27,7-UNIMOD:21	ms_run[1]:scan=7395	39.93438	3	2062.8381	2062.8377	R	Y	488	505
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	825	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14598	81.96132166666666	3	3442.4025	3442.4027	K	L	104	135
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	826	sp|P46379|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	26-UNIMOD:21	ms_run[1]:scan=6584	35.25718166666667	3	2864.271645	2864.283877	R	G	88	119
PSM	SRSPLLVTVVESDPRPQGQPR	827	sp|Q5VWN6|F208B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=14043	78.48528666666667	2	2397.215183	2397.216573	R	R	2035	2056
PSM	RPVSAIFTESIQPQKPGPGAAATVGK	828	sp|Q9BY89|K1671_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:21	ms_run[1]:scan=14701	82.66468166666667	3	2685.382025	2686.384367	R	V	241	267
PSM	SHVSSEPYEPISPPQVPVVHEK	829	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:21	ms_run[1]:scan=14321	80.19434833333332	3	2522.177335	2521.189021	R	Q	2140	2162
PSM	KKEPAITSQNSPEAR	830	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:21	ms_run[1]:scan=2300	12.931578333333334	3	1735.814157	1734.830179	K	E	90	105
PSM	QERLSPEVAPPAHR	831	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=8253	44.75740833333333	3	1648.7712	1648.7717	K	R	31	45
PSM	KNQKPSQVNGAPGSPTEPAGQK	832	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	14-UNIMOD:21	ms_run[1]:scan=2633	14.780613333333333	3	2301.083992	2299.095789	K	Q	1254	1276
PSM	APTVPPPLPPTPPQPAR	833	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	11-UNIMOD:21	ms_run[1]:scan=12895	71.254175	2	1812.936521	1811.933522	R	R	616	633
PSM	SGLQHLAPPPPTPGAPCSESER	834	sp|Q13574|DGKZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:21,17-UNIMOD:4	ms_run[1]:scan=10164	55.377398333333325	3	2365.058340	2364.056961	K	Q	249	271
PSM	GSPSSHLLGADHGLR	835	sp|Q6NWY9|PR40B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	2-UNIMOD:21	ms_run[1]:scan=8345	45.26913	2	1582.7249	1582.7248	R	K	763	778
PSM	RIPYAPSGEIPK	836	sp|O60701|UGDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:21	ms_run[1]:scan=11889	65.18463833333333	2	1406.695455	1406.695917	K	F	470	482
PSM	QSLGHGQHGSGSGQSPSPSR	837	sp|Q86YZ3|HORN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	17-UNIMOD:21	ms_run[1]:scan=1052	7.251276666666667	3	2027.843332	2026.860644	R	G	992	1012
PSM	KNQKPSQVNGAPGSPTEPAGQK	838	sp|Q9BQG0|MBB1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	16-UNIMOD:21	ms_run[1]:scan=3088	17.040863333333334	3	2300.080770	2299.095789	K	Q	1254	1276
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	839	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=19136	113.15744166666667	3	3461.432516	3459.429735	K	L	104	135
PSM	GTTGQSAEVTGATGQSVGVTGTTR	840	sp|Q7Z5P9|MUC19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	6-UNIMOD:21,23-UNIMOD:21	ms_run[1]:scan=3624	19.674898333333335	3	2381.986680	2382.010144	K	S	5831	5855
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	841	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:21,19-UNIMOD:35	ms_run[1]:scan=8670	47.163288333333334	3	2466.027970	2465.043102	R	A	90	114
PSM	SPRPQQDPARPQEPTMPPPETPSEGR	842	sp|P29590|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:21,16-UNIMOD:35	ms_run[1]:scan=6530	34.966998333333336	3	2977.338215	2977.338950	R	Q	8	34
PSM	SRPEAVSHPLNTVTEDMYTNGSPAPGSPAQVK	843	sp|Q00013|EM55_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	17-UNIMOD:35,27-UNIMOD:21	ms_run[1]:scan=11098	60.608628333333336	3	3433.549315	3432.565715	R	G	31	63
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	844	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15341	86.85401666666667	3	3458.416137	3459.429735	K	L	104	135
PSM	ADDKETCFAEEGKK	845	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:4	ms_run[2]:scan=2581	14.524	2	1626.7196	1626.7196	K	L	585	599
PSM	AGDLLEDSPK	846	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=7655	41.387	2	1123.4798	1123.4798	R	R	151	161
PSM	AHSNPMADHTLR	847	sp|Q9UBP6-2|TRMB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=1498	9.0948	3	1444.5919	1444.5919	R	Y	25	37
PSM	AKPYHLSTSSVFR	848	sp|Q8WYP5|ELYS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=11599	63.512	2	1571.7497	1571.7497	R	L	1016	1029
PSM	ALVLIAFAQYLQQCPFEDHVK	849	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:4	ms_run[2]:scan=24134	151.39	3	2489.2777	2489.2777	K	L	45	66
PSM	AMHTPKPSVGEEK	850	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=1403	8.6913	2	1505.6585	1505.6585	K	D	935	948
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	851	sp|P46379-5|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	26-UNIMOD:21	ms_run[2]:scan=6146	32.891	3	2864.2839	2864.2839	R	G	88	119
PSM	ASLLHSMPTHSSPR	852	sp|O75122-3|CLAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:21	ms_run[2]:scan=7691	41.575	2	1599.7229	1599.7229	K	S	1223	1237
PSM	ASPGHSPHYFAASSPTSPNALPPAR	853	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=11446	62.585	3	2596.186	2596.1860	R	K	1847	1872
PSM	ATGNDLRPPPPSPSSDLTHPMK	854	sp|Q9P275|UBP36_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=8887	48.304	3	2410.0988	2410.0988	R	T	702	724
PSM	AVGKLTPEHLIK	855	sp|Q96L91-4|EP400_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=9873	53.792	2	1384.748	1384.7480	K	M	2691	2703
PSM	AVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTK	856	sp|Q13153|PAK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:21	ms_run[2]:scan=13061	72.286	3	3887.7262	3887.7262	K	S	163	199
PSM	AVSPAAAQPPSPSSAEKPGDEPGRPR	857	sp|Q15772-1|SPEG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:21	ms_run[2]:scan=7305	39.469	3	2635.2392	2635.2392	R	S	547	573
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	858	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=18817	110.84	3	3459.4297	3459.4297	K	L	104	135
PSM	DEDDADYKPK	859	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=1561	9.3555	2	1194.5041	1194.5041	R	K	141	151
PSM	DGDDVIIIGVFK	860	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=19400	115	2	1289.6867	1289.6867	K	G	302	314
PSM	DLHQPSLSPASPHSQGFER	861	sp|Q9BZF1-3|OSBL8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=10240	55.835	3	2168.964	2168.9640	K	G	16	35
PSM	DLLFKDSAIGFSR	862	sp|P02788-2|TRFL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=16765	96.476	2	1467.7722	1467.7722	K	V	272	285
PSM	EDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPR	863	sp|Q9Y618-5|NCOR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	32-UNIMOD:21	ms_run[2]:scan=10550	57.542	3	3548.6573	3548.6573	R	G	970	1004
PSM	EDLKEEEEGKEEDEIK	864	sp|P82970|HMGN5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6195	33.159	3	1947.8797	1947.8797	K	E	254	270
PSM	EFGEHFEFDCK	865	sp|Q02817|MUC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:4	ms_run[2]:scan=12752	70.429	2	1443.5765	1443.5765	R	N	4826	4837
PSM	ERTESEVPPRPASPK	866	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:21	ms_run[2]:scan=3207	17.594	2	1758.8302	1758.8302	K	V	532	547
PSM	FHDIDDVK	867	sp|Q9H2U2-6|IPYR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5314	28.494	2	987.46616	987.4662	K	K	115	123
PSM	FHQLDIDDLQSIR	868	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=16070	91.707	3	1598.8053	1598.8053	R	A	59	72
PSM	FRLEAPDADELPK	869	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=13951	77.903	2	1499.762	1499.7620	K	G	522	535
PSM	GPPSPPAPVMHSPSR	870	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=8060	43.649	3	1592.7171	1592.7171	R	K	221	236
PSM	GRGSPHLSGAGDTSISDR	871	sp|Q9Y3X0|CCDC9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=5610	30.086	3	1848.8116	1848.8116	R	K	134	152
PSM	GRISAHQGAQVDSR	872	sp|O95049-5|ZO3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=1952	11.162	3	1560.7158	1560.7158	R	H	825	839
PSM	GRPPAEKLSPNPPK	873	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=4086	21.98	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GVPHPEDDHSQVEGPESLR	874	sp|Q6P996-3|PDXD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=8796	47.82	3	2163.9222	2163.9222	K	-	679	698
PSM	HELLSLASSNHLGK	875	sp|O15372|EIF3H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=11782	64.546	3	1584.7661	1584.7661	K	N	228	242
PSM	HGSDPAFAPGPR	876	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=5652	30.275	2	1287.5397	1287.5398	R	G	521	533
PSM	HHNSTAELQK	877	sp|P33527-8|MRP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=924	6.7532	2	1243.5347	1243.5347	R	A	812	822
PSM	HNSYLATHR	878	sp|Q9HCG1|ZN160_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=2246	12.682	2	1177.503	1177.5030	R	R	324	333
PSM	HPDVEVDGFSELR	879	sp|P09874|PARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=13125	72.664	3	1498.7052	1498.7052	R	W	66	79
PSM	HPEPVPEEGSEDELPPQVHK	880	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=10187	55.52	3	2329.0264	2329.0264	R	V	758	778
PSM	HPSHSTTPSGPGDEVAR	881	sp|P53365-3|ARFP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=2937	16.249	3	1810.7636	1810.7636	R	G	32	49
PSM	HQASINELKR	882	sp|Q9H4G0-4|E41L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=3821	20.67	2	1274.6132	1274.6132	K	T	464	474
PSM	HQDFDDLER	883	sp|O94953-2|KDM4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6534	34.986	2	1173.5051	1173.5051	R	K	112	121
PSM	HQSDGNEIAHTR	884	sp|O43166-3|SI1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=1358	8.5143	2	1443.5892	1443.5892	R	L	1485	1497
PSM	HQTLEVSLSRDSPLK	885	sp|Q8NCF5|NF2IP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:21	ms_run[2]:scan=10753	58.633	2	1788.8771	1788.8771	K	T	358	373
PSM	HRPSPPATPPPK	886	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1581	9.4374	3	1440.6316	1440.6316	R	T	399	411
PSM	HSPAPPPDPGFPAPSPPPADSPSEGFSLK	887	sp|Q6ZSZ5-2|ARHGI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:21	ms_run[2]:scan=16083	91.79	3	2959.343	2959.3430	R	A	952	981
PSM	HSPDHPGMGSSQASSSSSLR	888	sp|A0JLT2|MED19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=1798	10.427	3	2106.8426	2106.8426	R	-	225	245
PSM	HSQPSPEPHSPTEPPAWGSSIVK	889	sp|Q5VZ89-5|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=12029	65.991	3	2531.1482	2531.1482	K	V	964	987
PSM	HSQPSPEPHSPTEPPAWGSSIVK	890	sp|Q5VZ89-5|DEN4C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=12195	67.006	3	2531.1482	2531.1482	K	V	964	987
PSM	HTGPNSPDTANDGFVR	891	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=6579	35.225	2	1763.7264	1763.7264	K	L	99	115
PSM	HTLQQHQETPK	892	sp|Q7Z417-2|NUFP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=754	6.0754	2	1425.6402	1425.6402	K	K	79	90
PSM	IGHHSTSDDSSAYR	893	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21	ms_run[2]:scan=2559	14.413	2	1611.6315	1611.6315	R	S	333	347
PSM	IRLDETDDPDDYGDR	894	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=9369	50.933	3	1793.7704	1793.7704	K	E	399	414
PSM	IRSDLKAEALASAIASTK	895	sp|Q9NVT9-2|ARMC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=15218	86.063	3	1924.0031	1924.0031	R	V	85	103
PSM	IRSPPPDHVEVETAR	896	sp|Q86YA3-3|ZGRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=5812	31.155	3	1781.8462	1781.8462	K	E	669	684
PSM	ISMPDLDLHLKSPK	897	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=12280	67.549	2	1688.8209	1688.8209	K	A	2386	2400
PSM	KADTTTPTTIDPIHEPPSLPPEPK	898	sp|O60885-2|BRD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=13837	77.175	3	2661.2939	2661.2939	R	T	291	315
PSM	KASGPPVSELITK	899	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=11230	61.342	2	1405.7218	1405.7218	R	A	34	47
PSM	KGVEPSPSPIKPGDIK	900	sp|Q92890-3|UFD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=8392	45.518	2	1727.8859	1727.8859	K	R	240	256
PSM	KHDSGAADLER	901	sp|Q9NX55-3|HYPK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=1574	9.4067	3	1277.5401	1277.5401	R	V	35	46
PSM	KHSEEAEFTPPLK	902	sp|Q3B726|RPA43_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=9035	49.114	2	1591.7283	1591.7283	R	C	314	327
PSM	KHSPSPPPPTPTESR	903	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=2230	12.6	3	1773.7488	1773.7488	R	K	326	341
PSM	KIDVYLPLHSSQDR	904	sp|Q9BPZ7-5|SIN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=13167	72.921	2	1749.8451	1749.8451	K	L	176	190
PSM	KILGQSSPEKK	905	sp|P29374-3|ARI4A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=2083	11.781	2	1293.6694	1293.6694	R	I	858	869
PSM	KIPIPETPPQTPPQVLDSPHQR	906	sp|Q969H4-2|CNKR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21,18-UNIMOD:21	ms_run[2]:scan=14329	80.248	3	2634.2608	2634.2608	K	S	276	298
PSM	KKEPAITSQNSPEAR	907	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=1958	11.193	3	1734.8302	1734.8302	K	E	69	84
PSM	KKSTSLEPVER	908	sp|Q8N4X5-2|AF1L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=2945	16.288	2	1352.6701	1352.6701	R	S	342	353
PSM	KLGILGSHEDLSK	909	sp|Q9Y210-2|TRPC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21	ms_run[2]:scan=10643	58.043	2	1475.7385	1475.7385	K	L	693	706
PSM	KLLESQEPAHAQPASPQNVLPVK	910	sp|Q7Z3V4-2|UBE3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:21	ms_run[2]:scan=11806	64.679	3	2560.3051	2560.3051	K	S	405	428
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	911	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	17-UNIMOD:21	ms_run[2]:scan=14085	78.768	3	3605.6199	3605.6199	K	L	150	183
PSM	KLSDHSVR	912	sp|Q96Q42|ALS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=1149	7.6356	2	1020.4754	1020.4754	R	E	351	359
PSM	KNVDRVSIR	913	sp|P01833|PIGR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21	ms_run[2]:scan=3376	18.441	2	1165.5969	1165.5969	R	S	667	676
PSM	KPGDGEVSPSTEDAPFQHSPLGK	914	sp|O60318|GANP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=11812	64.722	3	2459.1006	2459.1006	K	A	520	543
PSM	KPGDGEVSPSTEDAPFQHSPLGK	915	sp|O60318|GANP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=11993	65.782	2	2459.1006	2459.1006	K	A	520	543
PSM	KPLPDHVSIVEPK	916	sp|P23396|RS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=10477	57.137	3	1537.7905	1537.7905	K	D	202	215
PSM	KPLTSSSAAPQRPISTQR	917	sp|Q15691|MARE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21	ms_run[2]:scan=5290	28.366	2	2004.0154	2004.0154	K	T	151	169
PSM	KPRPSEGDEDCLPASK	918	sp|P78346|RPP30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=3649	19.797	2	1864.8026	1864.8026	K	K	247	263
PSM	KPSREDDLLAPK	919	sp|Q9NP71-5|MLXPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=5960	31.909	3	1447.7072	1447.7072	R	Q	194	206
PSM	KQDFDEDDILK	920	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10846	59.162	3	1364.646	1364.6460	K	E	50	61
PSM	KQPPKEPSEVPTPK	921	sp|P17096-2|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:21	ms_run[2]:scan=3637	19.741	3	1640.8175	1640.8175	R	R	31	45
PSM	KRDSEEEFGSER	922	sp|Q12873-2|CHD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=2649	14.858	2	1547.6253	1547.6253	K	D	70	82
PSM	KRSFVPEEEK	923	sp|O94880-2|PHF14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=3416	18.64	2	1327.6173	1327.6173	R	H	548	558
PSM	KSNLDEEVNVIPPHTPVR	924	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:21	ms_run[2]:scan=11215	61.261	2	2123.0412	2123.0412	R	T	359	377
PSM	KSNLDEEVNVIPPHTPVR	925	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:21	ms_run[2]:scan=11591	63.463	2	2123.0412	2123.0412	R	T	359	377
PSM	KSPSGPVKSPPLSPVGTTPVK	926	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=9592	52.205	3	2139.1341	2139.1341	R	L	177	198
PSM	KVLSPTAAKPSPFEGK	927	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=8584	46.647	2	1735.891	1735.8910	K	T	310	326
PSM	LCSSHSPLRK	928	sp|Q6DN12-3|MCTP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4,6-UNIMOD:21	ms_run[2]:scan=1406	8.708	2	1263.5795	1263.5795	K	K	452	462
PSM	LDELRDEGK	929	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2873	15.885	2	1073.5353	1073.5353	K	A	206	215
PSM	LGSVTHVTSFSHAPPSSR	930	sp|P53814-2|SMTN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=9636	52.455	3	1945.9047	1945.9047	R	G	65	83
PSM	LHSAPNLSDLHVVR	931	sp|O75385|ULK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=12989	71.817	3	1636.8087	1636.8087	R	P	554	568
PSM	LQHYTSGHMTPGMK	932	sp|P29323-2|EPHB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,9-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=939	6.8057	2	1698.6895	1698.6895	K	I	581	595
PSM	LQHYTSGHMTPGMK	933	sp|P29323-2|EPHB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,9-UNIMOD:35,13-UNIMOD:35	ms_run[2]:scan=942	6.8231	3	1698.6895	1698.6895	K	I	581	595
PSM	MFPHHSITESVNYDVK	934	sp|Q8WUM0|NU133_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=10937	59.672	3	1998.8547	1998.8547	R	T	67	83
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKR	935	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35,10-UNIMOD:35,22-UNIMOD:21	ms_run[2]:scan=13401	74.413	3	3742.5652	3742.5652	R	I	372	405
PSM	MQAHIQDLEEQLDEEEGAR	936	sp|P35580|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35	ms_run[2]:scan=14134	79.063	3	2255.9965	2255.9965	K	Q	948	967
PSM	MSKPGSPGSVIPAQAHGK	937	sp|Q8IZD2-6|KMT2E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:35,6-UNIMOD:21	ms_run[2]:scan=6355	34.038	3	1843.8652	1843.8652	K	I	1354	1372
PSM	NKHESMISELEVR	938	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=7770	41.995	3	1666.7386	1666.7386	K	L	1030	1043
PSM	NVAEALGHSPKDPGGGGGPVR	939	sp|Q8IU81|I2BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=7642	41.323	3	2050.9586	2050.9586	K	A	428	449
PSM	PGRPLSPANVPALPGETVTSPVR	940	sp|Q8IY33-3|MILK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	20-UNIMOD:21	ms_run[2]:scan=14852	83.65	3	2391.2312	2391.2312	K	L	296	319
PSM	QSPFHGNHAAINQCQAPVPK	941	sp|Q6P1L5|F117B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=8465	45.948	3	2280.0259	2280.0259	R	S	306	326
PSM	RAHLSENELEALEK	942	sp|P98175-4|RBM10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21	ms_run[2]:scan=11917	65.342	3	1717.8036	1717.8036	R	N	715	729
PSM	RGEGDAPFSEPGTTSTQRPSSPETATK	943	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	20-UNIMOD:21	ms_run[2]:scan=7860	42.483	3	2870.272	2870.2720	R	Q	303	330
PSM	RGSIGENQIKDEK	944	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=3506	19.085	2	1552.7247	1552.7247	K	I	194	207
PSM	RGSLCATCGLPVTGR	945	sp|O43294-2|TGFI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,5-UNIMOD:4,8-UNIMOD:4	ms_run[2]:scan=10231	55.783	2	1683.7586	1683.7586	R	C	384	399
PSM	RGSLSNAGDPEIVK	946	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=7459	40.29	2	1521.7188	1521.7188	R	S	92	106
PSM	RKASEEIEDFR	947	sp|Q96FT9-3|IFT43_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=7750	41.881	2	1458.6504	1458.6504	R	L	75	86
PSM	RKSELEFETLK	948	sp|Q5JSH3-4|WDR44_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=10203	55.611	3	1458.712	1458.7120	K	T	235	246
PSM	RKSLSDSESDDSK	949	sp|Q13185|CBX3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=755	6.079	3	1532.6356	1532.6356	K	S	91	104
PSM	RKSPGVAAAVAEDGGLK	950	sp|Q9BTE7|DCNL5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=8861	48.15	3	1704.856	1704.8560	K	K	7	24
PSM	RKTVTAMDVVYALK	951	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=13101	72.527	3	1689.8525	1689.8525	K	R	79	93
PSM	RLDSSACLHAVGDK	952	sp|O94808|GFPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=6625	35.51	2	1607.7127	1607.7127	K	A	241	255
PSM	RLEQTSVRDPSPEADAPVLGSPEK	953	sp|O15234|CASC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=10666	58.154	3	2657.2698	2657.2698	R	E	353	377
PSM	RLESIATTLVSHK	954	sp|Q9P2R3|ANFY1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=14693	82.62	3	1533.7916	1533.7916	R	A	267	280
PSM	RNSIEVAGLSHGLEGLR	955	sp|Q16825|PTN21_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=15221	86.081	3	1886.9364	1886.9364	K	L	635	652
PSM	RPILQLSPPGPR	956	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21	ms_run[2]:scan=13315	73.871	3	1409.7544	1409.7544	R	G	12	24
PSM	RPPSPTLQHAASEDNLSSSTGEAPSR	957	sp|Q2TAC6|KIF19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=8983	48.809	3	2771.2512	2771.2512	K	A	831	857
PSM	RPSTADGEGDERPFTQAGLGADER	958	sp|O60303|K0556_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=10011	54.522	3	2611.13	2611.1300	R	I	1161	1185
PSM	RRSIYDTVTDTEMVEK	959	sp|Q6PIF6-2|MYO7B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=9453	51.39	2	2037.9078	2037.9078	K	V	902	918
PSM	RTPTMPQEEAAACPPHILPPEK	960	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=11247	61.438	3	2565.1757	2565.1757	R	R	1243	1265
PSM	RVSVCAETYNPDEEEEDTDPR	961	sp|P13861-2|KAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:4,8-UNIMOD:21	ms_run[2]:scan=10074	54.868	3	2590.0167	2590.0167	R	V	97	118
PSM	RYETLVGTIGKK	962	sp|Q99547|MPH6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=8868	48.185	3	1443.7487	1443.7487	R	F	117	129
PSM	SDKSPDLAPTPAPQSTPR	963	sp|Q9BY44-2|EIF2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21	ms_run[2]:scan=6965	37.544	3	1943.899	1943.8990	R	N	289	307
PSM	SFATASHRNTEEEGLK	964	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=5207	27.949	2	1855.8102	1855.8102	K	Y	420	436
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	965	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	21-UNIMOD:21	ms_run[2]:scan=7351	39.707	3	2455.0765	2455.0765	R	S	283	308
PSM	SKGHYEVTGSDDETGK	966	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=2262	12.751	2	1788.7204	1788.7204	K	L	5832	5848
PSM	SLGVDMDDKDDAHYAVQAR	967	sp|Q9BZE4-3|NOG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:35	ms_run[2]:scan=7868	42.537	3	2120.9433	2120.9433	R	R	410	429
PSM	SLVHEVGKPPQDVTDDSPPSK	968	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	17-UNIMOD:21	ms_run[2]:scan=8240	44.671	3	2311.0733	2311.0733	R	K	1206	1227
PSM	SLVHEVGKPPQDVTDDSPPSK	969	sp|Q96T58|MINT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	17-UNIMOD:21	ms_run[2]:scan=8880	48.264	3	2311.0733	2311.0733	R	K	1206	1227
PSM	SPEGEQEDRPGLHAYEK	970	sp|P33241-2|LSP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21	ms_run[2]:scan=5886	31.548	2	2020.8528	2020.8528	R	E	49	66
PSM	SPPDQPAVPHPPPSTPIK	971	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:21	ms_run[2]:scan=9208	50.095	2	1940.9397	1940.9397	K	L	600	618
PSM	SPRPQQDPARPQEPTMPPPETPSEGR	972	sp|P29590-4|PML_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=6700	35.979	3	2977.3389	2977.3389	R	Q	8	34
PSM	SPTKAPHLQLIEGK	973	sp|O43491|E41L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21	ms_run[2]:scan=10345	56.415	2	1597.8229	1597.8229	R	K	598	612
PSM	SRSGEGEVSGLMR	974	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=4807	25.784	2	1459.6127	1459.6127	R	K	389	402
PSM	SRSPLLVTVVESDPRPQGQPR	975	sp|Q5VWN6-2|F208B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21	ms_run[2]:scan=13937	77.812	3	2397.2166	2397.2166	R	R	1230	1251
PSM	SSVVSPSHPPPAPPLGSPPGPK	976	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21	ms_run[2]:scan=11615	63.591	2	2168.0667	2168.0667	R	P	292	314
PSM	TASVFGTHQAFAPYNKPSLSGAR	977	sp|Q86UW9-2|DTX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21	ms_run[2]:scan=14116	78.958	3	2486.1744	2486.1744	R	S	234	257
PSM	TRSPSPTLGESLAPHK	978	sp|Q86UU1-2|PHLB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21	ms_run[2]:scan=8257	44.776	3	1756.8509	1756.8509	R	G	516	532
PSM	TTTAAGSSHSRPGVPVEGSPGRNPGV	979	sp|Q8NE01-2|CNNM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	19-UNIMOD:21	ms_run[2]:scan=7522	40.675	3	2554.1925	2554.1925	K	-	634	660
PSM	VDDHDSEEICLDHLCK	980	sp|Q7Z2W4-2|ZCCHV_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:4,15-UNIMOD:4	ms_run[2]:scan=10697	58.321	3	1983.8302	1983.8302	R	G	504	520
PSM	VDINTPDVDVHGPDWHLK	981	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21	ms_run[2]:scan=14613	82.067	2	2135.9677	2135.9677	K	M	4762	4780
PSM	VHIEIGPDGR	982	sp|P55795|HNRH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7798	42.151	2	1091.5724	1091.5724	R	V	317	327
PSM	VKTPEMIIQKPK	983	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=5809	31.146	3	1506.7881	1506.7881	K	I	488	500
PSM	VPFSPGPAPPPHMGELDQER	984	sp|Q6Y7W6-4|GGYF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=11413	62.407	2	2252.9926	2252.9926	R	L	584	604
PSM	VQTDKPHLVSLGSGR	985	sp|Q86UU1-2|PHLB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:21	ms_run[2]:scan=8445	45.823	3	1672.8298	1672.8298	K	L	35	50
PSM	WAHDKFSGEEGEIEDDESGTENR	986	sp|Q9Y2W1|TR150_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21	ms_run[2]:scan=11284	61.64	2	2716.0562	2716.0562	K	E	922	945
PSM	YSPSQNSPIHHIPSR	987	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21	ms_run[2]:scan=6793	36.543	2	1798.8152	1798.8152	R	R	282	297
PSM	KVPQVSTPTLVEVSR	988	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=12204	67.060775	3	1639.930643	1638.930471	K	N	438	453
PSM	TGVLAHLEEER	989	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=10422	56.821805000000005	2	1253.645499	1252.641165	R	D	772	783
PSM	IPIPETPPQTPPQVLDSPHQR	990	sp|Q969H4|CNKR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:21	ms_run[1]:scan=14443	80.98386333333333	3	2427.204825	2426.199526	K	S	284	305
PSM	RPEGACGDGQSSRVSPPAADVLK	991	sp|O95359|TACC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=9194	50.01116833333334	3	2433.110759	2433.110788	K	D	948	971
PSM	VPSYDSFDSEDYPAALPNHKPK	992	sp|P14921|ETS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:21	ms_run[1]:scan=13743	76.58125833333334	3	2556.132936	2556.121001	R	G	280	302
PSM	HKSIAEVSQNLR	993	sp|Q7Z2Z1|TICRR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:21	ms_run[1]:scan=5824	31.210805	3	1460.713033	1460.713692	R	Q	863	875
PSM	HPPVLTPPDQEVIR	994	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:21	ms_run[1]:scan=12539	69.142815	2	1676.829473	1676.828722	R	N	636	650
PSM	HSSSAPPPPPPGR	995	sp|Q8TF74|WIPF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	3-UNIMOD:21	ms_run[1]:scan=1351	8.483816666666668	2	1362.6169	1362.6076	K	R	172	185
PSM	KLGILGSHEDLSK	996	sp|Q9Y210|TRPC6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:21	ms_run[1]:scan=10668	58.16136166666667	2	1475.737889	1475.738510	K	L	809	822
PSM	AHHSSQEMSSEYR	997	sp|Q99447|PCY2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:21,8-UNIMOD:35	ms_run[1]:scan=895	6.636896666666666	2	1643.618403	1643.603550	K	E	159	172
PSM	RHTSAEEEEPPPVK	998	sp|Q9BZ95|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:21	ms_run[1]:scan=2821	15.64269	3	1683.741002	1684.745781	R	I	454	468
PSM	ALVSHSEGANHTLLR	999	sp|Q6UXY1|BI2L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:21	ms_run[1]:scan=8311	45.07777	3	1683.808897	1683.809384	R	F	331	346
PSM	KKDSLHGSTGAVNATR	1000	sp|Q9HBL0|TENS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:21,9-UNIMOD:21	ms_run[1]:scan=2055	11.647464999999999	2	1800.790951	1800.792093	K	P	371	387
PSM	EKDKEPFTFSSPASGR	1001	sp|Q6P1X5|TAF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	14-UNIMOD:21	ms_run[1]:scan=10627	57.95936	3	1861.824823	1861.824759	K	S	1175	1191
PSM	SEVQQPVHPKPLSPDSR	1002	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	13-UNIMOD:21	ms_run[1]:scan=7243	39.114088333333335	3	1980.931508	1979.946606	K	A	350	367
PSM	TKPIVKPQTSPEYGQGINPISR	1003	sp|O95793|STAU1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	10-UNIMOD:21	ms_run[1]:scan=11321	61.86577666666667	3	2490.252882	2489.267940	K	L	269	291
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	1004	sp|P35606|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	13-UNIMOD:21	ms_run[1]:scan=9813	53.45860666666667	3	3113.491767	3112.507789	R	S	847	876
PSM	AAEDDEDDDVDTKK	1005	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=918	6.7253	2	1564.6377	1564.6377	R	Q	90	104
PSM	AAPPPPPPPPPLESSPR	1006	sp|Q5T4S7-5|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=10030	54.631	3	1782.8706	1782.8706	K	V	606	623
PSM	ADDKETCFAEEGKK	1007	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:4	ms_run[2]:scan=3163	17.4	3	1626.7196	1626.7196	K	L	585	599
PSM	AEVLGHKTPEPAPR	1008	sp|Q9UHD8-7|SEPT9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21	ms_run[2]:scan=4524	24.25	3	1580.7712	1580.7712	R	R	116	130
PSM	AHAWPSPYKDYEVK	1009	sp|Q8NFJ5|RAI3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21	ms_run[2]:scan=10042	54.694	2	1769.7814	1769.7814	R	K	340	354
PSM	AHSNPMADHTLR	1010	sp|Q9UBP6-2|TRMB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=1499	9.0974	2	1444.5919	1444.5919	R	Y	25	37
PSM	AKFEELNMDLFR	1011	sp|P11021|BIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:35	ms_run[2]:scan=15043	84.915	3	1527.7392	1527.7392	R	S	325	337
PSM	ALEHFTDLYDIKR	1012	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=13393	74.365	3	1699.7971	1699.7971	R	A	626	639
PSM	ALEHFTDLYDIKR	1013	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=13423	74.55	2	1699.7971	1699.7971	R	A	626	639
PSM	ALVSHSEGANHTLLR	1014	sp|Q6UXY1-2|BI2L2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=8357	45.33	2	1683.8094	1683.8094	R	F	331	346
PSM	APTVPPPLPPTPPQPAR	1015	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=13057	72.263	2	1811.9335	1811.9335	R	R	616	633
PSM	ARPFPDGLAEDIDK	1016	sp|P13639|EF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=13716	76.392	2	1542.7678	1542.7678	K	G	606	620
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	1017	sp|Q6P1N0-2|C2D1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:21	ms_run[2]:scan=11715	64.164	3	2956.4332	2956.4332	K	L	117	144
PSM	AVGGLGKLGK	1018	sp|P81605|DCD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5185	27.838	2	898.56	898.5600	K	D	76	86
PSM	AVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTK	1019	sp|Q13153|PAK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:21	ms_run[2]:scan=13226	73.299	3	3887.7262	3887.7262	K	S	163	199
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	1020	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=16411	94.001	3	3459.4297	3459.4297	K	L	104	135
PSM	CRNSIASCADEQPHIGNYR	1021	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:4,4-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=9275	50.445	3	2326.9573	2326.9573	R	L	39	58
PSM	DHVYGIHNPVMTSPSQH	1022	sp|O43490-2|PROM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=8823	47.956	3	2013.8404	2013.8404	K	-	840	857
PSM	DIDIHEVR	1023	sp|Q00839-2|HNRPU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6914	37.233	2	995.50361	995.5036	K	I	334	342
PSM	DKRPLSGPDVGTPQPAGLASGAK	1024	sp|O96013|PAK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=10667	58.158	3	2298.1369	2298.1369	R	L	176	199
PSM	DQSPPPSPPPSYHPPPPPTK	1025	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=8215	44.541	3	2199.0038	2199.0038	K	K	667	687
PSM	EDAAPTKPAPPAPPPPQNLQPESDAPQQPGSSPR	1026	sp|Q9Y618-5|NCOR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	31-UNIMOD:21	ms_run[2]:scan=10367	56.529	3	3548.6573	3548.6573	R	G	970	1004
PSM	EPRPNSSPSPSPGQASETPHPRPS	1027	sp|O00204-2|ST2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=4473	24.011	3	2575.1453	2575.1453	R	-	327	351
PSM	ERDHSPTPSVFNSDEER	1028	sp|Q6UN15-3|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=7321	39.559	3	2080.8487	2080.8487	R	Y	414	431
PSM	ERTESEVPPRPASPK	1029	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:21	ms_run[2]:scan=4223	22.666	2	1758.8302	1758.8302	K	V	532	547
PSM	ESEDKPEIEDVGSDEEEEK	1030	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:21	ms_run[2]:scan=8208	44.507	3	2271.8792	2271.8792	K	K	251	270
PSM	FRLEAPDADELPK	1031	sp|Q99798|ACON_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=13950	77.899	3	1499.762	1499.7620	K	G	522	535
PSM	GESEEPSSPQSLCHLVAPGHER	1032	sp|Q8WXH0-7|SYNE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12228	67.203	3	2482.0584	2482.0584	R	S	2767	2789
PSM	GFGFVTFDDHDPVDK	1033	sp|P22626-2|ROA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=16443	94.214	2	1694.7577	1694.7577	R	I	142	157
PSM	GPGAPASPSASHPQGLDTTPKPH	1034	sp|P98171|RHG04_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=6134	32.82	3	2286.043	2286.0430	R	-	924	947
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	1035	sp|P42166|LAP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=12528	69.072	3	2649.1708	2649.1708	K	S	61	87
PSM	GREDVSNFDDEFTSEAPILTPPREPR	1036	sp|Q16513-5|PKN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	20-UNIMOD:21	ms_run[2]:scan=16982	97.954	3	3053.3768	3053.3768	R	I	613	639
PSM	GRGSPHLSGAGDTSISDR	1037	sp|Q9Y3X0|CCDC9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=5624	30.148	2	1848.8116	1848.8116	R	K	134	152
PSM	GRPPAEKLSPNPPK	1038	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=4284	22.991	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPK	1039	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=4472	24.009	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPK	1040	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=4661	25.017	3	1566.7919	1566.7919	R	L	1369	1383
PSM	HFEELETIMDR	1041	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:35	ms_run[2]:scan=10610	57.854	2	1434.6449	1434.6449	R	E	936	947
PSM	HIAEDADR	1042	sp|P09493-2|TPM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=862	6.5167	2	925.42536	925.4254	K	K	97	105
PSM	HKQSLYGDYVFDTNR	1043	sp|P25054-2|APC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=12687	70.037	3	1921.836	1921.8360	R	H	690	705
PSM	HKSESPCESPYPNEK	1044	sp|Q8NI27-2|THOC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=2780	15.448	2	1867.7448	1867.7448	K	D	333	348
PSM	HMSSMEHTEEGLR	1045	sp|Q9H6U6-6|BCAS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:35,3-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=1670	9.8198	2	1654.6117	1654.6117	R	E	603	616
PSM	HPPVLTPPDQEVIR	1046	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=12187	66.955	3	1676.8287	1676.8287	R	N	636	650
PSM	HQASDSENEELPKPR	1047	sp|Q96ST2|IWS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=4444	23.857	3	1815.7789	1815.7789	R	I	232	247
PSM	HRPSPPATPPPK	1048	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2209	12.477	3	1440.6316	1440.6316	R	T	399	411
PSM	IEDVGSDEEDDSGKDK	1049	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=3256	17.818	3	1816.6888	1816.6888	K	K	250	266
PSM	IGHHSTSDDSSAYR	1050	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=2195	12.389	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	1051	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=2587	14.551	3	1611.6315	1611.6315	R	S	333	347
PSM	IHRASDPGLPAEEPK	1052	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=5617	30.119	2	1695.7981	1695.7981	R	E	1855	1870
PSM	IKSFDSLGSQSLHTR	1053	sp|Q14155-2|ARHG7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10658	58.115	3	1754.8353	1754.8353	R	T	101	116
PSM	ISAISEKPLSPHPIR	1054	sp|Q2KHM9-2|MOONR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=10103	55.034	2	1723.9022	1723.9022	K	I	518	533
PSM	KADTTTPTTIDPIHEPPSLPPEPK	1055	sp|O60885-2|BRD4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=13995	78.181	3	2661.2939	2661.2939	R	T	291	315
PSM	KASSPNLHR	1056	sp|P51956-2|NEK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=910	6.697	2	1088.5128	1088.5128	R	R	335	344
PSM	KDHSVDSFK	1057	sp|Q641Q2-2|WAC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=2131	12	2	1141.4805	1141.4805	K	N	906	915
PSM	KEESEESDDDMGFGLFD	1058	sp|P05386-2|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:35	ms_run[2]:scan=16049	91.579	2	1964.7469	1964.7469	K	-	73	90
PSM	KETPPPLVPPAAR	1059	sp|Q9BQA1-2|MEP50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=9621	52.366	2	1451.7538	1451.7538	R	E	3	16
PSM	KFELLPTPPLSPSR	1060	sp|P01106|MYC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=17221	99.61	2	1660.859	1660.8590	K	R	52	66
PSM	KFQEQECPPSPEPTRK	1061	sp|P62070-2|RRAS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=4458	23.939	3	2036.9027	2036.9027	R	E	100	116
PSM	KHESPLLVTK	1062	sp|Q92622-3|RUBIC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=3911	21.107	3	1230.6373	1230.6373	R	S	194	204
PSM	KHSQTDLVSR	1063	sp|O14683|P5I11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=3392	18.531	3	1249.5816	1249.5816	K	L	12	22
PSM	KIDVYLPLHSSQDR	1064	sp|Q9BPZ7-5|SIN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=13130	72.695	3	1749.8451	1749.8451	K	L	176	190
PSM	KKSDPEGPALLFPESELSIR	1065	sp|Q8N1S5-2|S39AB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=18507	108.69	3	2292.1403	2292.1403	K	I	123	143
PSM	KKSPIINESR	1066	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=1794	10.407	2	1250.6384	1250.6384	R	S	275	285
PSM	KLDKENLSDER	1067	sp|Q9BZI7-2|REN3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21	ms_run[2]:scan=3007	16.591	2	1425.6501	1425.6501	K	A	290	301
PSM	KLSLPTDLKPDLDVK	1068	sp|Q5T5C0-2|STXB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=16290	93.161	2	1760.9325	1760.9325	R	D	721	736
PSM	KLSVPTSDEEDEVPAPKPR	1069	sp|Q8NE71-2|ABCF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=10540	57.488	3	2173.0304	2173.0304	K	G	103	122
PSM	KMPQLTASAIVSPHGDESPR	1070	sp|Q9Y6J9|TAF6L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=9838	53.6	3	2216.0297	2216.0297	R	G	484	504
PSM	KPESPYGNLCDAPDSPRPVK	1071	sp|Q9UKA4|AKA11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=9340	50.774	3	2306.0402	2306.0402	R	A	419	439
PSM	KPNVSPEKR	1072	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=758	6.0942	2	1133.5594	1133.5594	R	K	8	17
PSM	KPSREDDLLAPK	1073	sp|Q9NP71-5|MLXPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=5841	31.304	2	1447.7072	1447.7072	R	Q	194	206
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1074	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=11018	60.126	3	2637.3415	2637.3415	R	R	31	56
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	1075	sp|P17096|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=11191	61.134	3	2637.3415	2637.3415	R	R	31	56
PSM	KREPEDEGEDDD	1076	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=1005	7.0661	2	1432.559	1432.5590	R	-	238	250
PSM	KRSVQEGENPDDGVR	1077	sp|P42696-2|RBM34_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=1868	10.761	2	1764.7792	1764.7792	R	G	12	27
PSM	KRTSLSPAEILEEK	1078	sp|A1A5D9-2|BICL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=12788	70.623	3	1679.8495	1679.8495	K	E	139	153
PSM	KRYSYLTEPGMSPQSPCER	1079	sp|Q12955-6|ANK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,11-UNIMOD:35,17-UNIMOD:4	ms_run[2]:scan=8723	47.454	3	2381.0181	2381.0181	R	T	592	611
PSM	KSPPGSAAPERPLAER	1080	sp|Q14526-2|HIC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:21	ms_run[2]:scan=4455	23.922	2	1741.8512	1741.8512	K	E	228	244
PSM	KTPELGIVPPPPIPR	1081	sp|Q8TEH3-7|DEN1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:21	ms_run[2]:scan=15864	90.316	2	1689.9219	1689.9219	R	P	707	722
PSM	KTSDANETEDHLESLICK	1082	sp|Q09161|NCBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:21,17-UNIMOD:4	ms_run[2]:scan=14471	81.168	3	2168.9297	2168.9297	R	V	20	38
PSM	KTSGLVSLHSR	1083	sp|Q13237-2|KGP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=5546	29.747	3	1263.6337	1263.6337	R	R	108	119
PSM	KVIQYLAHVASSPK	1084	sp|Q7Z406-4|MYH14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=10718	58.437	3	1619.8436	1619.8436	K	G	210	224
PSM	KVLSPTAAKPSPFEGK	1085	sp|Q96QC0|PP1RA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=8580	46.628	3	1735.891	1735.8910	K	T	310	326
PSM	LAAGHELQPLAIVDQRPSSR	1086	sp|P17302|CXA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	18-UNIMOD:21	ms_run[2]:scan=14539	81.579	2	2237.1318	2237.1318	K	A	347	367
PSM	LELKPIDKSPDPNPIMTDTPIPR	1087	sp|Q92859-3|NEO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=14573	81.805	3	2682.334	2682.3340	R	N	1170	1193
PSM	LFRPPSPAPAAPGAR	1088	sp|Q86U90|YRDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=9697	52.791	3	1583.7974	1583.7974	R	L	32	47
PSM	LGGLRPESPESLTSVSR	1089	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21	ms_run[2]:scan=12920	71.412	2	1863.9092	1863.9092	R	T	11	28
PSM	LGHPDTLNQGEFK	1090	sp|P06702|S10A9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=8100	43.901	3	1454.7154	1454.7154	K	E	26	39
PSM	LHYCVSCAIHSK	1091	sp|Q5JNZ5|RS26L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:4,6-UNIMOD:21,7-UNIMOD:4	ms_run[2]:scan=8681	47.224	2	1553.652	1553.6520	K	V	71	83
PSM	LKDLFDYSPPLHK	1092	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21	ms_run[2]:scan=14842	83.584	2	1651.8011	1651.8011	K	N	503	516
PSM	LLRPSLAELHDELEK	1093	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=15599	88.508	3	1841.9288	1841.9288	K	E	238	253
PSM	LRPSTSVDEEDEESERER	1094	sp|Q9UPS6-2|SET1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=4715	25.322	3	2241.9387	2241.9387	R	D	981	999
PSM	LRSKDELSQAEK	1095	sp|Q5VWQ8-3|DAB2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=2697	15.075	3	1482.7079	1482.7079	R	D	836	848
PSM	LRSSAEQMHPAPYEAR	1096	sp|Q8NFH8-3|REPS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=4074	21.923	2	1937.8455	1937.8455	K	Q	75	91
PSM	MSTSQNSIPFEHHGK	1097	sp|P48730-2|KC1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=6486	34.7	2	1794.7396	1794.7396	R	-	395	410
PSM	NAIHTFVQSGSHLAAR	1098	sp|P04040|CATA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=10413	56.771	3	1787.8468	1787.8468	K	E	507	523
PSM	NGHRDSITTVR	1099	sp|Q8TF74-2|WIPF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=2149	12.078	2	1334.6092	1334.6092	R	S	230	241
PSM	NHSPLPPPQTNHEEPSR	1100	sp|Q13094|LCP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=3635	19.729	3	2015.8851	2015.8851	R	S	205	222
PSM	NKHESMISELEVR	1101	sp|P35749|MYH11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=8005	43.312	3	1666.7386	1666.7386	K	L	1030	1043
PSM	PAGQHGSLSPAAAHTASPEPPTQSGPLTR	1102	sp|Q8NC74|RB8NL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=9426	51.246	3	2899.3614	2899.3614	K	S	458	487
PSM	PRSPPLPAVIR	1103	sp|Q9Y6X9-2|MORC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=11477	62.773	3	1281.6959	1281.6959	R	N	551	562
PSM	RAPSVANVGSHCDLSLK	1104	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=10859	59.229	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RASCRPTTAAR	1105	sp|Q96PE2|ARHGH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=704	5.8699	2	1325.6024	1325.6024	R	G	41	52
PSM	RASPSKPASAPASR	1106	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=831	6.3955	2	1461.7089	1461.7089	K	S	512	526
PSM	RDDDPLNAR	1107	sp|P12110|CO6A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3656	19.827	2	1070.5105	1070.5105	R	V	868	877
PSM	RDEELSSEESPRR	1108	sp|Q9ULG1|INO80_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=2138	12.024	2	1668.7105	1668.7105	R	H	231	244
PSM	REDSYHVR	1109	sp|P49760-2|CLK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=1509	9.138	2	1140.4713	1140.4713	R	S	47	55
PSM	RGSIGENQIK	1110	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=3419	18.657	2	1180.5602	1180.5602	K	D	194	204
PSM	RGVTIKPTVDDD	1111	sp|Q2VIR3|IF2GL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=5629	30.171	2	1314.6779	1314.6779	R	-	461	473
PSM	RHSSLIDIDSVPTYK	1112	sp|Q7LDG7|GRP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=13973	78.039	3	1809.8662	1809.8662	R	W	114	129
PSM	RIDISPSTLR	1113	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=11503	62.934	2	1236.6228	1236.6228	R	K	652	662
PSM	RKGSQITQQSTNQSR	1114	sp|P50750|CDK9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=950	6.8523	2	1797.8483	1797.8483	R	N	344	359
PSM	RKPSPEPEGEVGPPK	1115	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=3989	21.499	3	1682.8029	1682.8029	K	I	341	356
PSM	RKPSPEPEGEVGPPK	1116	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=4191	22.505	3	1682.8029	1682.8029	K	I	341	356
PSM	RKQSSSEISLAVER	1117	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=7907	42.756	3	1668.8196	1668.8196	R	A	453	467
PSM	RKSELEFETLK	1118	sp|Q5JSH3-4|WDR44_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10148	55.288	2	1458.712	1458.7120	K	T	235	246
PSM	RKSTDSVPISK	1119	sp|O95359-3|TACC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=1997	11.372	2	1296.6439	1296.6439	R	S	2070	2081
PSM	RKTITGVPDNIQK	1120	sp|Q5SYE7-2|NHSL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=6223	33.304	3	1548.8025	1548.8025	R	E	207	220
PSM	RKTVTAMDVVYALK	1121	sp|P62805|H4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=13117	72.614	2	1689.8525	1689.8525	K	R	79	93
PSM	RLSAQAHPAGK	1122	sp|Q2TAZ0|ATG2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=1102	7.4502	3	1214.5921	1214.5921	R	M	401	412
PSM	RLSSASTGKPPLSVEDDFEK	1123	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=12651	69.807	3	2242.0519	2242.0519	R	L	756	776
PSM	RLSSTSLASGHSVR	1124	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=5811	31.151	3	1536.741	1536.7410	R	L	38	52
PSM	RLSYSDSDLKR	1125	sp|A2A3K4|PTPC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=6138	32.843	3	1418.6555	1418.6555	R	A	390	401
PSM	RPAHPILATADGASQLVGME	1126	sp|Q92766-5|RREB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=13756	76.665	3	2128.9977	2128.9977	K	-	1402	1422
PSM	RPCFSALEVDETYVPK	1127	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:4	ms_run[2]:scan=15262	86.343	2	1909.9244	1909.9244	R	E	509	525
PSM	RPEGPGAQAPSSPR	1128	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:21	ms_run[2]:scan=1942	11.108	2	1485.6726	1485.6726	R	V	504	518
PSM	RPPSPEPSTK	1129	sp|Q01082-3|SPTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=1018	7.1204	2	1174.5384	1174.5384	R	V	2086	2096
PSM	RPPSPPGPEER	1130	sp|Q6ZU35|K1211_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=3763	20.377	2	1297.5816	1297.5816	R	K	1014	1025
PSM	RPSSSEIITEGKR	1131	sp|Q9BQF6-5|SENP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=4941	26.54	3	1538.7454	1538.7454	R	K	9	22
PSM	RQGSFSEDVISHK	1132	sp|Q9UPN3-4|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=7486	40.446	3	1568.6984	1568.6984	K	G	1857	1870
PSM	RSSPPGHYYQK	1133	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=2218	12.53	2	1398.6082	1398.6082	R	S	121	132
PSM	RSTVLGLPQHVQK	1134	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=8497	46.124	2	1541.8079	1541.8079	R	E	160	173
PSM	RTPSTKPTVR	1135	sp|Q765P7|MTSSL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=1048	7.2371	2	1221.6231	1221.6231	R	R	566	576
PSM	RVGDPPQPLPEEPMEVQGAERASPEPQR	1136	sp|P46379-5|BAG6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:35,23-UNIMOD:21	ms_run[2]:scan=10655	58.099	3	3191.4707	3191.4707	R	E	936	964
PSM	RVSADSQPFQHGDK	1137	sp|Q96AX9-9|MIB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=4014	21.627	2	1650.7151	1650.7151	R	V	307	321
PSM	RVSISEGDDKIEYR	1138	sp|P22087|FBRL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=9228	50.194	3	1745.7985	1745.7985	K	A	122	136
PSM	RYSDHAGPAIPSVVAYPK	1139	sp|P27448-8|MARK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:21	ms_run[2]:scan=12987	71.807	3	2006.9615	2006.9615	R	R	338	356
PSM	SEHSHSTTLPR	1140	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=1706	9.9805	2	1330.5667	1330.5667	R	D	1428	1439
PSM	SESPKEPEQLR	1141	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=4623	24.792	2	1378.613	1378.6130	K	K	4	15
PSM	SFHHEESLEELPETSGK	1142	sp|P12643|BMP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=10043	54.698	3	2034.8572	2034.8572	R	T	111	128
PSM	SHDFYSHELSSPVDSPSSLR	1143	sp|Q13233|M3K1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=12811	70.759	3	2325.9903	2325.9903	R	A	497	517
PSM	SHKDDSELDFSALCPK	1144	sp|Q9H6L5-2|RETR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21,14-UNIMOD:4	ms_run[2]:scan=13629	75.862	3	1927.8023	1927.8023	K	I	135	151
PSM	SHTLLSPSPKPK	1145	sp|P51787-2|KCNQ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21	ms_run[2]:scan=4615	24.752	2	1370.6959	1370.6959	R	K	275	287
PSM	SKQPPPASSPTKR	1146	sp|Q9Y4K1|CRBG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=615	5.5262	2	1459.7184	1459.7184	R	K	95	108
PSM	SKSERPPTILMTEEPSSPK	1147	sp|Q5VZK9-2|CARL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=8592	46.69	3	2209.0338	2209.0338	R	G	1078	1097
PSM	SKSISASGRPPLK	1148	sp|Q2LD37-6|K1109_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=3544	19.257	2	1406.7283	1406.7283	R	R	3617	3630
PSM	SKSPNNEGDVHFSR	1149	sp|Q8NAP3|ZBT38_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=4096	22.028	3	1652.6944	1652.6944	R	E	307	321
PSM	SLAPDRSDDEHDPLDNTSR	1150	sp|Q92614-5|MY18A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:21	ms_run[2]:scan=8428	45.736	3	2218.9128	2218.9128	K	P	1541	1560
PSM	SPSPPLPTHIPPEPPR	1151	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=13447	74.7	3	1797.8815	1797.8815	R	T	326	342
PSM	SQLGAHHTTPVGDGAAGTR	1152	sp|Q5BJD5-3|TM41B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=3158	17.377	3	1911.8589	1911.8589	R	G	10	29
PSM	SRESSPSHGLLK	1153	sp|Q96JH7|VCIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=4164	22.361	2	1376.6449	1376.6449	R	L	994	1006
PSM	SRPLATGPSSQSHQEK	1154	sp|Q96RL1-2|UIMC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=1453	8.8923	3	1788.8156	1788.8156	R	T	131	147
PSM	SRSEGSIQAHR	1155	sp|O94988|FA13A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=1017	7.1169	2	1306.5779	1306.5779	K	V	285	296
PSM	SRSPHEAGFCVYLK	1156	sp|Q9NTZ6|RBM12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=11969	65.647	3	1729.7647	1729.7647	R	G	422	436
PSM	SSSPEDPERDEEVLNHVLR	1157	sp|Q8TE67-2|ES8L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:21	ms_run[2]:scan=15196	85.918	3	2287.0118	2287.0118	R	D	229	248
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	1158	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:21	ms_run[2]:scan=9516	51.744	3	3112.5078	3112.5078	R	S	818	847
PSM	TEEPASDKGSEAEAHMPPPFTPYVPR	1159	sp|O94886|CSCL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=12853	71	3	2935.2736	2935.2736	K	I	730	756
PSM	THSFENVSCHLPDSR	1160	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=9454	51.394	2	1864.7564	1864.7564	R	T	1097	1112
PSM	TIDLGAAAHYTGDKASPDQNASTHTPQSSVK	1161	sp|Q14677-2|EPN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	16-UNIMOD:21	ms_run[2]:scan=10480	57.155	3	3247.4783	3247.4783	K	T	266	297
PSM	TKPPRPDSPATTPNISVK	1162	sp|P32519-2|ELF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=7550	40.826	2	1984.9983	1984.9983	K	K	156	174
PSM	TLDVSTDEEDKIHHSSESK	1163	sp|P16383-3|GCFC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	16-UNIMOD:21	ms_run[2]:scan=6193	33.145	3	2235.9533	2235.9533	R	D	92	111
PSM	TLKENLSDHLR	1164	sp|P30414|NKTR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=7599	41.072	2	1404.6762	1404.6762	R	N	860	871
PSM	TPPTAALSAPPPLISTLGGRPVSPR	1165	sp|Q8WXX7-5|AUTS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	23-UNIMOD:21	ms_run[2]:scan=18327	107.41	3	2532.3465	2532.3465	K	R	632	657
PSM	VEVKPVPASPHPK	1166	sp|Q5VV67-2|PPRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=3887	20.981	2	1463.7538	1463.7538	K	H	935	948
PSM	VKTPEMIIQKPK	1167	sp|Q09666|AHNK_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=5623	30.144	3	1506.7881	1506.7881	K	I	488	500
PSM	VRPASTGGLSLLPPPPGGK	1168	sp|Q9NVZ3-4|NECP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=14807	83.367	3	1879.9921	1879.9921	R	T	151	170
PSM	VRPASTGGLSLLPPPPGGK	1169	sp|Q9NVZ3-4|NECP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=14711	82.73	2	1879.9921	1879.9921	R	T	151	170
PSM	YHGHSMSDPGVSYR	1170	sp|P08559-4|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3818	20.653	2	1687.645	1687.6450	R	T	327	341
PSM	SEVQQPVHPKPLSPDSR	1171	sp|Q9UHB6|LIMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	13-UNIMOD:21	ms_run[1]:scan=6744	36.23377166666667	3	1980.936086	1979.946606	K	A	350	367
PSM	QDDSPPRPIIGPALPPGFIK	1172	sp|Q8IXQ4|GPAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28,4-UNIMOD:21	ms_run[1]:scan=20016	119.65281	2	2177.0909	2177.0917	K	S	102	122
PSM	RKSSENNGTLVSK	1173	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	3-UNIMOD:21	ms_run[1]:scan=2104	11.882456666666666	3	1499.6952	1498.7132	K	Q	262	275
PSM	YEPSDKDRQSPPPAK	1174	sp|Q86VM9|ZCH18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:21	ms_run[1]:scan=1404	8.694813333333332	2	1793.800492	1793.798544	R	R	833	848
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	1175	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=16620	95.45763833333334	3	3442.4014	3442.4027	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	1176	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14252	79.80549166666667	3	3460.420139	3459.429735	K	L	104	135
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	1177	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=18804	110.745695	3	3442.4017	3442.4027	K	L	104	135
PSM	KQDFDEDDILK	1178	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10915	59.56763666666667	3	1364.645052	1364.645976	K	E	50	61
PSM	KHSEEAEFTPPLKCSPK	1179	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:21,14-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=9096	49.44385833333333	3	2144.907871	2143.905074	R	R	314	331
PSM	VPSAACPPFPPHGAPVSASSSSSSPGGSR	1180	sp|Q9H7S9|ZN703_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:4,23-UNIMOD:21	ms_run[1]:scan=12741	70.37393666666667	3	2815.245552	2814.243258	R	G	194	223
PSM	YYPGGSQHLISRPSVK	1181	sp|Q9ULH0|KDIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	14-UNIMOD:21	ms_run[1]:scan=9400	51.099959999999996	2	1868.903493	1867.898199	R	T	1150	1166
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	1182	sp|Q8N122|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:21	ms_run[1]:scan=7445	40.211713333333336	3	2672.208330	2671.223903	K	Q	868	895
PSM	KKEPAITSQNSPEAR	1183	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:21	ms_run[1]:scan=2479	13.956831666666668	3	1735.813566	1734.830179	K	E	90	105
PSM	RLSSTSLASGHSVR	1184	sp|Q9BZL6|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:21	ms_run[1]:scan=6022	32.19511166666666	3	1536.739187	1536.740970	R	L	195	209
PSM	QLSSGVSEIR	1185	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=13113	72.59164333333334	2	1137.5060	1137.5062	R	H	80	90
PSM	RGGHSSVSTESESSSFHSS	1186	sp|P61073|CXCR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:21	ms_run[1]:scan=3247	17.76713833333333	3	2032.803017	2030.796707	K	-	334	353
PSM	SSSPELVTHLK	1187	sp|Q07960|RHG01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:21	ms_run[1]:scan=9029	49.07660666666666	2	1276.602155	1276.606433	K	W	49	60
PSM	KVVVSPTKK	1188	sp|P19338|NUCL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:21	ms_run[1]:scan=1115	7.499528333333334	3	1064.599169	1064.599497	K	V	63	72
PSM	ISRPGDSDDSR	1189	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=981	6.971145	2	1203.547330	1203.547993	K	S	179	190
PSM	KKSPIINESR	1190	sp|Q13523|PRP4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:21	ms_run[1]:scan=1825	10.560101666666666	2	1251.622545	1250.638402	R	S	275	285
PSM	LNHSPPQSSSR	1191	sp|Q5T8P6|RBM26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:21	ms_run[1]:scan=1074	7.335038333333333	2	1288.554589	1288.556129	R	Y	124	135
PSM	LTTYLHSQLK	1192	sp|Q6AWC2|WWC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:21,3-UNIMOD:21	ms_run[1]:scan=2627	14.747688333333333	2	1362.574140	1362.598585	K	S	419	429
PSM	KQDFDEDDILK	1193	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=10927	59.61948833333333	2	1364.647456	1364.645976	K	E	50	61
PSM	RKTDVISDTFPGK	1194	sp|Q9BY89|K1671_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:21	ms_run[1]:scan=9146	49.73686166666666	3	1541.758898	1542.744324	R	I	1177	1190
PSM	TLRDSPNVEAAHLAR	1195	sp|Q9UHF7|TRPS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:21	ms_run[1]:scan=7987	43.219053333333335	3	1728.830552	1728.830848	K	P	826	841
PSM	HAQDSDPRSPTLGIAR	1196	sp|Q99618|CDCA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:21	ms_run[1]:scan=6865	36.942903333333334	2	1798.823016	1799.831576	K	T	60	76
PSM	APTVPPPLPPTPPQPAR	1197	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:21	ms_run[1]:scan=12065	66.187475	2	1812.935887	1811.933522	R	R	616	633
PSM	ENASSNHDHDDGASGTPK	1198	sp|Q9UK53|ING1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=616	5.5297	2	1838.729152	1837.746312	R	E	303	321
PSM	RIQSSPGALSEDKCSPK	1199	sp|Q5T7B8|KIF24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	14-UNIMOD:4,15-UNIMOD:21	ms_run[1]:scan=4274	22.932841666666665	3	1938.888678	1938.887042	K	K	570	587
PSM	RTSIHDFLTK	1200	sp|Q3V6T2|GRDN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:21	ms_run[1]:scan=10008	54.502115	2	1296.623004	1296.622752	R	D	1818	1828
PSM	KIPVFHNGSTPTLGETPK	1201	sp|Q9Y6M7|S4A7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:21	ms_run[1]:scan=12929	71.460325	3	2002.976874	2001.992493	R	E	548	566
PSM	AAMGRKGIMEPLPHVNTR	1202	sp|P31629|ZEP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	17-UNIMOD:21	ms_run[1]:scan=18113	105.84997166666666	2	2056.982477	2057.006386	R	L	448	466
PSM	KLEEVLSTEGAEENGNSDKK	1203	sp|O15355|PPM1G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=7213	38.94562166666667	3	2177.031777	2176.049536	R	K	521	541
PSM	EVIGMEAEVTGVLLVAEGQR	1204	sp|Q6ZNE9|RUFY4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:21	ms_run[1]:scan=20160	120.66180166666666	2	2178.094578	2179.059587	K	T	308	328
PSM	RMEDEGGFPVPQENGQPESPRR	1205	sp|Q6ZRV2|FA83H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:35,19-UNIMOD:21	ms_run[1]:scan=9480	51.532401666666665	3	2608.101043	2607.117330	R	L	980	1002
PSM	GREEHYEEEEEEEEDGAAVAEK	1206	sp|O00461|GOLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:21	ms_run[1]:scan=9502	51.64709166666667	3	2643.003658	2643.013361	K	S	668	690
PSM	HIKEEPLSEEEPCTSTAIASPEK	1207	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:21,13-UNIMOD:4	ms_run[1]:scan=10237	55.82038333333334	3	2660.181735	2661.188095	K	K	495	518
PSM	EREEGALAEPAPVPAVAHSPPATVEAATSR	1208	sp|A6NEL2|SWAHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	19-UNIMOD:21	ms_run[1]:scan=13271	73.60055	3	3090.512362	3089.481909	R	A	240	270