MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_NT_JPST000210
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\121102_CRC_T_Fr17.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\121102_CRC_T_Fr17.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|O94823|AT10B_HUMAN	Probable phospholipid-transporting ATPase VB OS=Homo sapiens OX=9606 GN=ATP10B PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	38.0	null	1371-UNIMOD:21,1381-UNIMOD:21,1373-UNIMOD:21	0.01	38.0	4	1	0
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	963-UNIMOD:21	0.01	37.0	2	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.05	36.0	1	1	1
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null		0.15	35.0	9	3	2
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	43-UNIMOD:21	0.05	35.0	8	1	0
PRT	sp|Q9BU76|MMTA2_HUMAN	Multiple myeloma tumor-associated protein 2 OS=Homo sapiens OX=9606 GN=MMTAG2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	217-UNIMOD:21,220-UNIMOD:21,215-UNIMOD:21	0.06	35.0	3	1	0
PRT	sp|Q9BZE4-3|NOG1_HUMAN	Isoform 3 of Nucleolar GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=GTPBP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	415-UNIMOD:35	0.04	35.0	4	1	0
PRT	sp|Q86WR7|PRSR2_HUMAN	Proline and serine-rich protein 2 OS=Homo sapiens OX=9606 GN=PROSER2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	311-UNIMOD:21	0.08	34.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	34.0	null	266-UNIMOD:21,267-UNIMOD:21,268-UNIMOD:21	0.05	34.0	11	1	0
PRT	sp|Q7Z5Q1-7|CPEB2_HUMAN	Isoform 6 of Cytoplasmic polyadenylation element-binding protein 2 OS=Homo sapiens OX=9606 GN=CPEB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	67-UNIMOD:21	0.04	34.0	1	1	1
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	2048-UNIMOD:21	0.01	34.0	3	1	0
PRT	sp|Q14814-6|MEF2D_HUMAN	Isoform MEF2D00 of Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	205-UNIMOD:21	0.05	34.0	3	1	0
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	34.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	34.0	7	1	0
PRT	sp|Q32MZ4-3|LRRF1_HUMAN	Isoform 3 of Leucine-rich repeat flightless-interacting protein 1 OS=Homo sapiens OX=9606 GN=LRRFIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.02	33.0	2	1	0
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	725-UNIMOD:21,729-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	2532-UNIMOD:21,2535-UNIMOD:21	0.00	33.0	2	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	255-UNIMOD:21,226-UNIMOD:21	0.05	33.0	4	4	4
PRT	sp|P78317|RNF4_HUMAN	E3 ubiquitin-protein ligase RNF4 OS=Homo sapiens OX=9606 GN=RNF4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	33.0	null	91-UNIMOD:4,94-UNIMOD:21	0.12	33.0	2	1	0
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	33.0	null	189-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|Q9Y2I9|TBC30_HUMAN	TBC1 domain family member 30 OS=Homo sapiens OX=9606 GN=TBC1D30 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	114-UNIMOD:21,122-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|P49796-4|RGS3_HUMAN	Isoform 4 of Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	662-UNIMOD:21	0.02	33.0	2	1	0
PRT	sp|P23497-7|SP100_HUMAN	Isoform 7 of Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	375-UNIMOD:21,359-UNIMOD:21	0.09	33.0	2	2	2
PRT	sp|Q6XZF7-2|DNMBP_HUMAN	Isoform 2 of Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	599-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	3	1	0
PRT	sp|Q12955-6|ANK3_HUMAN	Isoform 4 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	922-UNIMOD:21	0.02	32.0	3	1	0
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.07	32.0	1	1	1
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	21-UNIMOD:21	0.06	32.0	1	1	1
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|Q9H0K1|SIK2_HUMAN	Serine/threonine-protein kinase SIK2 OS=Homo sapiens OX=9606 GN=SIK2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	484-UNIMOD:21,495-UNIMOD:35	0.02	32.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	234-UNIMOD:21,236-UNIMOD:21	0.07	32.0	3	1	0
PRT	sp|O43318-4|M3K7_HUMAN	Isoform 1D of Mitogen-activated protein kinase kinase kinase 7 OS=Homo sapiens OX=9606 GN=MAP3K7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	412-UNIMOD:21	0.04	32.0	1	1	1
PRT	sp|P06454|PTMA_HUMAN	Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null		0.14	32.0	2	1	0
PRT	sp|O60763|USO1_HUMAN	General vesicular transport factor p115 OS=Homo sapiens OX=9606 GN=USO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	263-UNIMOD:21,231-UNIMOD:21	0.05	31.0	3	3	3
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	31.0	null	366-UNIMOD:21	0.06	31.0	5	3	2
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1377-UNIMOD:21	0.01	31.0	6	1	0
PRT	sp|Q0ZGT2-4|NEXN_HUMAN	Isoform 4 of Nexilin OS=Homo sapiens OX=9606 GN=NEXN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	500-UNIMOD:21,502-UNIMOD:35,505-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|Q8NFZ0|FBH1_HUMAN	F-box DNA helicase 1 OS=Homo sapiens OX=9606 GN=FBH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	124-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P08138-2|TNR16_HUMAN	Isoform 2 of Tumor necrosis factor receptor superfamily member 16 OS=Homo sapiens OX=9606 GN=NGFR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	217-UNIMOD:21	0.09	31.0	1	1	1
PRT	sp|Q9NYF8-2|BCLF1_HUMAN	Isoform 2 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	510-UNIMOD:21,288-UNIMOD:21,175-UNIMOD:21,283-UNIMOD:21	0.05	31.0	10	3	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	2144-UNIMOD:21,2152-UNIMOD:4	0.01	31.0	3	1	0
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1174-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|P35568|IRS1_HUMAN	Insulin receptor substrate 1 OS=Homo sapiens OX=9606 GN=IRS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	1100-UNIMOD:21,1101-UNIMOD:21	0.01	31.0	2	1	0
PRT	sp|Q9UK76-3|JUPI1_HUMAN	Isoform 3 of Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	41-UNIMOD:21	0.15	31.0	1	1	1
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	11-UNIMOD:21,26-UNIMOD:35	0.04	31.0	1	1	1
PRT	sp|Q9Y2D5|AKAP2_HUMAN	A-kinase anchor protein 2 OS=Homo sapiens OX=9606 GN=AKAP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	778-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q9C0B5|ZDHC5_HUMAN	Palmitoyltransferase ZDHHC5 OS=Homo sapiens OX=9606 GN=ZDHHC5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31.0	null	553-UNIMOD:28,554-UNIMOD:21	0.04	31.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	240-UNIMOD:21,242-UNIMOD:21	0.08	30.0	5	1	0
PRT	sp|P08235|MCR_HUMAN	Mineralocorticoid receptor OS=Homo sapiens OX=9606 GN=NR3C2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	703-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|P10451-3|OSTP_HUMAN	Isoform C of Osteopontin OS=Homo sapiens OX=9606 GN=SPP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	197-UNIMOD:21	0.08	30.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	224-UNIMOD:21,230-UNIMOD:35,232-UNIMOD:21	0.03	30.0	15	1	0
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	623-UNIMOD:4,630-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null	1690-UNIMOD:21	0.01	30.0	2	1	0
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	502-UNIMOD:21,507-UNIMOD:4,514-UNIMOD:21	0.07	30.0	3	2	1
PRT	sp|O60341|KDM1A_HUMAN	Lysine-specific histone demethylase 1A OS=Homo sapiens OX=9606 GN=KDM1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	166-UNIMOD:21	0.04	30.0	3	1	0
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	266-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q14566|MCM6_HUMAN	DNA replication licensing factor MCM6 OS=Homo sapiens OX=9606 GN=MCM6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|P35269|T2FA_HUMAN	General transcription factor IIF subunit 1 OS=Homo sapiens OX=9606 GN=GTF2F1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	154-UNIMOD:21	0.06	30.0	3	2	1
PRT	sp|Q15020-4|SART3_HUMAN	Isoform 4 of Squamous cell carcinoma antigen recognized by T-cells 3 OS=Homo sapiens OX=9606 GN=SART3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	153-UNIMOD:21	0.11	30.0	4	1	0
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	344-UNIMOD:21,240-UNIMOD:21,242-UNIMOD:21	0.06	30.0	13	3	1
PRT	sp|Q03111|ENL_HUMAN	Protein ENL OS=Homo sapiens OX=9606 GN=MLLT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	292-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q6UUV9-3|CRTC1_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 1 OS=Homo sapiens OX=9606 GN=CRTC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	149-UNIMOD:21,160-UNIMOD:35	0.05	30.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	604-UNIMOD:21,487-UNIMOD:21,365-UNIMOD:21	0.07	30.0	3	3	3
PRT	sp|Q0ZGT2|NEXN_HUMAN	Nexilin OS=Homo sapiens OX=9606 GN=NEXN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null	564-UNIMOD:21,566-UNIMOD:35,569-UNIMOD:21	0.04	30.0	3	1	0
PRT	sp|Q9Y4C1|KDM3A_HUMAN	Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	30.0	null	445-UNIMOD:21	0.01	30.0	4	1	0
PRT	sp|O60784-3|TOM1_HUMAN	Isoform 3 of Target of Myb protein 1 OS=Homo sapiens OX=9606 GN=TOM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	417-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	58-UNIMOD:4,591-UNIMOD:4	0.11	29.0	5	5	5
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	626-UNIMOD:21	0.03	29.0	8	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	246-UNIMOD:35	0.05	29.0	1	1	1
PRT	sp|Q93009-3|UBP7_HUMAN	Isoform 3 of Ubiquitin carboxyl-terminal hydrolase 7 OS=Homo sapiens OX=9606 GN=USP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|O00204-2|ST2B1_HUMAN	Isoform 2 of Sulfotransferase family cytosolic 2B member 1 OS=Homo sapiens OX=9606 GN=SULT2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	332-UNIMOD:21	0.07	29.0	3	2	1
PRT	sp|O75400-2|PR40A_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog A OS=Homo sapiens OX=9606 GN=PRPF40A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	861-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q7Z3C6-2|ATG9A_HUMAN	Isoform 2 of Autophagy-related protein 9A OS=Homo sapiens OX=9606 GN=ATG9A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	767-UNIMOD:21	0.03	29.0	5	2	0
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	75-UNIMOD:21,79-UNIMOD:21,76-UNIMOD:21	0.06	29.0	16	1	0
PRT	sp|O60318|GANP_HUMAN	Germinal-center associated nuclear protein OS=Homo sapiens OX=9606 GN=MCM3AP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	527-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q9HC35-2|EMAL4_HUMAN	Isoform 2 of Echinoderm microtubule-associated protein-like 4 OS=Homo sapiens OX=9606 GN=EML4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	100-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	29.0	null	297-UNIMOD:35	0.04	29.0	2	1	0
PRT	sp|Q9BQI5-4|SGIP1_HUMAN	Isoform 4 of SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	294-UNIMOD:21	0.03	29.0	1	1	1
PRT	sp|O94921-3|CDK14_HUMAN	Isoform 3 of Cyclin-dependent kinase 14 OS=Homo sapiens OX=9606 GN=CDK14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	73-UNIMOD:21,49-UNIMOD:21,54-UNIMOD:4	0.06	29.0	4	2	0
PRT	sp|Q6ZU35|K1211_HUMAN	Uncharacterized protein KIAA1211 OS=Homo sapiens OX=9606 GN=KIAA1211 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	875-UNIMOD:21,1042-UNIMOD:21	0.04	29.0	2	2	2
PRT	sp|Q9NZ63|TLS1_HUMAN	Telomere length and silencing protein 1 homolog OS=Homo sapiens OX=9606 GN=C9orf78 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	15-UNIMOD:21	0.07	29.0	1	1	1
PRT	sp|Q14185|DOCK1_HUMAN	Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9UGV2-3|NDRG3_HUMAN	Isoform 3 of Protein NDRG3 OS=Homo sapiens OX=9606 GN=NDRG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	242-UNIMOD:21	0.07	29.0	1	1	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	294-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	281-UNIMOD:21	0.05	29.0	1	1	1
PRT	sp|P67936-2|TPM4_HUMAN	Isoform 2 of Tropomyosin alpha-4 chain OS=Homo sapiens OX=9606 GN=TPM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.05	29.0	1	1	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	34-UNIMOD:28,39-UNIMOD:21	0.02	29.0	1	1	1
PRT	sp|Q13243-3|SRSF5_HUMAN	Isoform SRP40-4 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.05	28.0	2	1	0
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.08	28.0	2	1	0
PRT	sp|Q7Z4V5-2|HDGR2_HUMAN	Isoform 2 of Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	625-UNIMOD:21	0.03	28.0	3	2	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	337-UNIMOD:21	0.03	28.0	7	1	0
PRT	sp|Q92766-6|RREB1_HUMAN	Isoform 6 of Ras-responsive element-binding protein 1 OS=Homo sapiens OX=9606 GN=RREB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	161-UNIMOD:21	0.06	28.0	2	1	0
PRT	sp|Q9BZI7-2|REN3B_HUMAN	Isoform 2 of Regulator of nonsense transcripts 3B OS=Homo sapiens OX=9606 GN=UPF3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	297-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q86UD0|SAPC2_HUMAN	Suppressor APC domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SAPCD2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	219-UNIMOD:21,226-UNIMOD:4	0.04	28.0	1	1	1
PRT	sp|O75151|PHF2_HUMAN	Lysine-specific demethylase PHF2 OS=Homo sapiens OX=9606 GN=PHF2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	28.0	null	899-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|P47902-2|CDX1_HUMAN	Isoform 2 of Homeobox protein CDX-1 OS=Homo sapiens OX=9606 GN=CDX1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	50-UNIMOD:21	0.12	28.0	1	1	1
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	243-UNIMOD:21	0.02	28.0	3	1	0
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	28.0	null	328-UNIMOD:21	0.02	28.0	5	1	0
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	162-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|Q9NYV4|CDK12_HUMAN	Cyclin-dependent kinase 12 OS=Homo sapiens OX=9606 GN=CDK12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1246-UNIMOD:21,1247-UNIMOD:35,1255-UNIMOD:4,1244-UNIMOD:21	0.02	28.0	7	1	0
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.11	28.0	1	1	1
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	328-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	830-UNIMOD:21	0.03	28.0	3	2	1
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	262-UNIMOD:21,263-UNIMOD:35	0.04	28.0	5	1	0
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	53-UNIMOD:21	0.23	28.0	2	2	2
PRT	sp|O94776|MTA2_HUMAN	Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	433-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q86TI0|TBCD1_HUMAN	TBC1 domain family member 1 OS=Homo sapiens OX=9606 GN=TBC1D1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	596-UNIMOD:21,604-UNIMOD:4	0.02	28.0	1	1	0
PRT	sp|P46379-2|BAG6_HUMAN	Isoform 2 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	113-UNIMOD:21,1047-UNIMOD:21,1048-UNIMOD:35	0.05	27.0	3	2	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q86VP1-3|TAXB1_HUMAN	Isoform 3 of Tax1-binding protein 1 OS=Homo sapiens OX=9606 GN=TAX1BP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q6NWY9-2|PR40B_HUMAN	Isoform 2 of Pre-mRNA-processing factor 40 homolog B OS=Homo sapiens OX=9606 GN=PRPF40B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	751-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|O14617-3|AP3D1_HUMAN	Isoform 3 of AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	489-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q13427|PPIG_HUMAN	Peptidyl-prolyl cis-trans isomerase G OS=Homo sapiens OX=9606 GN=PPIG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	753-UNIMOD:21,687-UNIMOD:21	0.04	27.0	4	2	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1261-UNIMOD:21	0.00	27.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	769-UNIMOD:21,402-UNIMOD:21,406-UNIMOD:21,450-UNIMOD:21,452-UNIMOD:21,713-UNIMOD:21,718-UNIMOD:21,560-UNIMOD:21,562-UNIMOD:21	0.08	27.0	14	5	3
PRT	sp|P17096|HMGA1_HUMAN	High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	44-UNIMOD:21	0.24	27.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P55198|AF17_HUMAN	Protein AF-17 OS=Homo sapiens OX=9606 GN=MLLT6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	382-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8NFZ5-2|TNIP2_HUMAN	Isoform 2 of TNFAIP3-interacting protein 2 OS=Homo sapiens OX=9606 GN=TNIP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	79-UNIMOD:21	0.08	27.0	1	1	1
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	151-UNIMOD:21,155-UNIMOD:21,149-UNIMOD:21	0.04	27.0	3	1	0
PRT	sp|Q01831-3|XPC_HUMAN	Isoform 3 of DNA repair protein complementing XP-C cells OS=Homo sapiens OX=9606 GN=XPC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|P81274|GPSM2_HUMAN	G-protein-signaling modulator 2 OS=Homo sapiens OX=9606 GN=GPSM2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	408-UNIMOD:21,409-UNIMOD:35,412-UNIMOD:35,415-UNIMOD:35	0.02	27.0	3	1	0
PRT	sp|Q8N271-3|PROM2_HUMAN	Isoform 3 of Prominin-2 OS=Homo sapiens OX=9606 GN=PROM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	340-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P00533|EGFR_HUMAN	Epidermal growth factor receptor OS=Homo sapiens OX=9606 GN=EGFR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1104-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q6PJG2|EMSA1_HUMAN	ELM2 and SANT domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ELMSAN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	461-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q6PD62|CTR9_HUMAN	RNA polymerase-associated protein CTR9 homolog OS=Homo sapiens OX=9606 GN=CTR9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1097-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q8IY92-2|SLX4_HUMAN	Isoform 2 of Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	272-UNIMOD:21,283-UNIMOD:4	0.01	27.0	1	1	1
PRT	sp|Q9UI08-4|EVL_HUMAN	Isoform 4 of Ena/VASP-like protein OS=Homo sapiens OX=9606 GN=EVL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	245-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q6P0Q8-2|MAST2_HUMAN	Isoform 2 of Microtubule-associated serine/threonine-protein kinase 2 OS=Homo sapiens OX=9606 GN=MAST2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1161-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q9H410|DSN1_HUMAN	Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	30-UNIMOD:21	0.05	27.0	1	1	0
PRT	sp|Q96S55|WRIP1_HUMAN	ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	153-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q8TDB6|DTX3L_HUMAN	E3 ubiquitin-protein ligase DTX3L OS=Homo sapiens OX=9606 GN=DTX3L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	2-UNIMOD:1,9-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|P04040|CATA_HUMAN	Catalase OS=Homo sapiens OX=9606 GN=CAT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	515-UNIMOD:21	0.03	27.0	1	1	1
PRT	sp|Q13586|STIM1_HUMAN	Stromal interaction molecule 1 OS=Homo sapiens OX=9606 GN=STIM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	597-UNIMOD:35,600-UNIMOD:21,595-UNIMOD:21	0.04	26.0	3	1	0
PRT	sp|P02545-5|LMNA_HUMAN	Isoform 5 of Prelamin-A/C OS=Homo sapiens OX=9606 GN=LMNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|Q3KQU3-3|MA7D1_HUMAN	Isoform 3 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	15-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q04637-6|IF4G1_HUMAN	Isoform E of Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.01	26.0	2	2	1
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	163-UNIMOD:21	0.03	26.0	2	1	0
PRT	sp|Q8NDT2-2|RB15B_HUMAN	Isoform 2 of Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	205-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|P28062-2|PSB8_HUMAN	Isoform 2 of Proteasome subunit beta type-8 OS=Homo sapiens OX=9606 GN=PSMB8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.05	26.0	1	1	1
PRT	sp|Q13636|RAB31_HUMAN	Ras-related protein Rab-31 OS=Homo sapiens OX=9606 GN=RAB31 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	35-UNIMOD:21,43-UNIMOD:35	0.11	26.0	1	1	1
PRT	sp|P42167|LAP2B_HUMAN	Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	74-UNIMOD:21	0.06	26.0	1	1	1
PRT	sp|P05771-2|KPCB_HUMAN	Isoform Beta-II of Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	641-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|Q16665-2|HIF1A_HUMAN	Isoform 2 of Hypoxia-inducible factor 1-alpha OS=Homo sapiens OX=9606 GN=HIF1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	645-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q9BZF2-2|OSBL7_HUMAN	Isoform 2 of Oxysterol-binding protein-related protein 7 OS=Homo sapiens OX=9606 GN=OSBPL7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	226-UNIMOD:21	0.06	26.0	2	1	0
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	39-UNIMOD:21,121-UNIMOD:21	0.14	26.0	2	2	2
PRT	sp|Q9UHI5|LAT2_HUMAN	Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	29-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q15691|MARE1_HUMAN	Microtubule-associated protein RP/EB family member 1 OS=Homo sapiens OX=9606 GN=MAPRE1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	154-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	644-UNIMOD:21,278-UNIMOD:35,280-UNIMOD:21,516-UNIMOD:21	0.05	26.0	4	3	2
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	214-UNIMOD:21	0.03	26.0	2	2	2
PRT	sp|A8MVS5|HIDE1_HUMAN	Protein HIDE1 OS=Homo sapiens OX=9606 GN=HIDE1 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	213-UNIMOD:21	0.09	26.0	1	1	1
PRT	sp|O15021-2|MAST4_HUMAN	Isoform 2 of Microtubule-associated serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=MAST4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	57-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q9NRM7|LATS2_HUMAN	Serine/threonine-protein kinase LATS2 OS=Homo sapiens OX=9606 GN=LATS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	380-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|P15692-18|VEGFA_HUMAN	Isoform 18 of Vascular endothelial growth factor A OS=Homo sapiens OX=9606 GN=VEGFA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	162-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	322-UNIMOD:21,377-UNIMOD:21,400-UNIMOD:21,295-UNIMOD:21,297-UNIMOD:21,2104-UNIMOD:21,2688-UNIMOD:21	0.04	26.0	5	5	5
PRT	sp|Q96FT9-3|IFT43_HUMAN	Isoform 3 of Intraflagellar transport protein 43 homolog OS=Homo sapiens OX=9606 GN=IFT43	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	78-UNIMOD:21	0.11	26.0	1	1	1
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	27-UNIMOD:21,21-UNIMOD:21	0.07	26.0	2	1	0
PRT	sp|Q5JXC2|MIIP_HUMAN	Migration and invasion-inhibitory protein OS=Homo sapiens OX=9606 GN=MIIP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	303-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q4LE39-4|ARI4B_HUMAN	Isoform 4 of AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	347-UNIMOD:21,359-UNIMOD:35	0.02	26.0	1	1	0
PRT	sp|O14578-3|CTRO_HUMAN	Isoform 3 of Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	115-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|P17544-4|ATF7_HUMAN	Isoform 4 of Cyclic AMP-dependent transcription factor ATF-7 OS=Homo sapiens OX=9606 GN=ATF7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	150-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|Q9NX40-3|OCAD1_HUMAN	Isoform 3 of OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	123-UNIMOD:21,122-UNIMOD:21	0.06	26.0	2	1	0
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	864-UNIMOD:21	0.04	26.0	1	1	1
PRT	sp|P30533|AMRP_HUMAN	Alpha-2-macroglobulin receptor-associated protein OS=Homo sapiens OX=9606 GN=LRPAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	247-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	805-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|Q86UX7-2|URP2_HUMAN	Isoform 2 of Fermitin family homolog 3 OS=Homo sapiens OX=9606 GN=FERMT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	478-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	26.0	null	369-UNIMOD:21	0.03	26.0	11	1	0
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|P08621-4|RU17_HUMAN	Isoform 4 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	130-UNIMOD:21	0.04	26.0	2	1	0
PRT	sp|Q9Y618|NCOR2_HUMAN	Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	1538-UNIMOD:28,1539-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q8TAD8|SNIP1_HUMAN	Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	31-UNIMOD:28,35-UNIMOD:21,159-UNIMOD:21	0.08	26.0	4	2	1
PRT	sp|Q9BRG2|SH23A_HUMAN	SH2 domain-containing protein 3A OS=Homo sapiens OX=9606 GN=SH2D3A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	147-UNIMOD:21,155-UNIMOD:35	0.03	26.0	1	1	1
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	1098-UNIMOD:28,1111-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	620-UNIMOD:21,619-UNIMOD:21	0.01	25.0	3	1	0
PRT	sp|Q6PJ61|FBX46_HUMAN	F-box only protein 46 OS=Homo sapiens OX=9606 GN=FBXO46 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	334-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|P52566|GDIR2_HUMAN	Rho GDP-dissociation inhibitor 2 OS=Homo sapiens OX=9606 GN=ARHGDIB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.09	25.0	1	1	1
PRT	sp|Q6P1N0-2|C2D1A_HUMAN	Isoform 2 of Coiled-coil and C2 domain-containing protein 1A OS=Homo sapiens OX=9606 GN=CC2D1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	118-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|Q9P275|UBP36_HUMAN	Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens OX=9606 GN=USP36 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	713-UNIMOD:21,722-UNIMOD:35	0.02	25.0	2	1	0
PRT	sp|Q92545|TM131_HUMAN	Transmembrane protein 131 OS=Homo sapiens OX=9606 GN=TMEM131 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1375-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q3V6T2-5|GRDN_HUMAN	Isoform 5 of Girdin OS=Homo sapiens OX=9606 GN=CCDC88A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	235-UNIMOD:4,237-UNIMOD:21,240-UNIMOD:35,1586-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|Q6UN15-3|FIP1_HUMAN	Isoform 3 of Pre-mRNA 3'-end-processing factor FIP1 OS=Homo sapiens OX=9606 GN=FIP1L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	418-UNIMOD:21,426-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	576-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	129-UNIMOD:4	0.15	25.0	1	1	1
PRT	sp|Q9BXF6|RFIP5_HUMAN	Rab11 family-interacting protein 5 OS=Homo sapiens OX=9606 GN=RAB11FIP5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	356-UNIMOD:21,357-UNIMOD:21	0.03	25.0	2	1	0
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1861-UNIMOD:4,1863-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q09028-4|RBBP4_HUMAN	Isoform 4 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	320-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	218-UNIMOD:21	0.06	25.0	1	1	1
PRT	sp|Q05084-3|ICA69_HUMAN	Isoform 3 of Islet cell autoantigen 1 OS=Homo sapiens OX=9606 GN=ICA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.04	25.0	1	1	1
PRT	sp|Q09666|AHNK_HUMAN	Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens OX=9606 GN=AHNAK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	93-UNIMOD:21,490-UNIMOD:21,493-UNIMOD:35	0.00	25.0	2	2	2
PRT	sp|Q9NP72-3|RAB18_HUMAN	Isoform 3 of Ras-related protein Rab-18 OS=Homo sapiens OX=9606 GN=RAB18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	80-UNIMOD:21	0.09	25.0	1	1	0
PRT	sp|O14497-3|ARI1A_HUMAN	Isoform 3 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1505-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	993-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q13459-2|MYO9B_HUMAN	Isoform Short of Unconventional myosin-IXb OS=Homo sapiens OX=9606 GN=MYO9B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1405-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	108-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q14596-2|NBR1_HUMAN	Isoform 2 of Next to BRCA1 gene 1 protein OS=Homo sapiens OX=9606 GN=NBR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	116-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8TAQ2-2|SMRC2_HUMAN	Isoform 2 of SWI/SNF complex subunit SMARCC2 OS=Homo sapiens OX=9606 GN=SMARCC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	304-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8WXG6-6|MADD_HUMAN	Isoform 6 of MAP kinase-activating death domain protein OS=Homo sapiens OX=9606 GN=MADD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	996-UNIMOD:21,1181-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|Q8TEH3-7|DEN1A_HUMAN	Isoform 7 of DENN domain-containing protein 1A OS=Homo sapiens OX=9606 GN=DENND1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	708-UNIMOD:21,468-UNIMOD:21	0.03	25.0	3	2	1
PRT	sp|Q15643|TRIPB_HUMAN	Thyroid receptor-interacting protein 11 OS=Homo sapiens OX=9606 GN=TRIP11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1886-UNIMOD:35,1891-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	743-UNIMOD:21	0.02	25.0	2	1	0
PRT	sp|Q86YZ3|HORN_HUMAN	Hornerin OS=Homo sapiens OX=9606 GN=HRNR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1008-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9NSI2-2|F207A_HUMAN	Isoform B of Protein FAM207A OS=Homo sapiens OX=9606 GN=FAM207A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	123-UNIMOD:21	0.07	25.0	2	1	0
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1176-UNIMOD:21,1259-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|Q08999-2|RBL2_HUMAN	Isoform 2 of Retinoblastoma-like protein 2 OS=Homo sapiens OX=9606 GN=RBL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	491-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q8N3X1|FNBP4_HUMAN	Formin-binding protein 4 OS=Homo sapiens OX=9606 GN=FNBP4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	18-UNIMOD:21	0.01	25.0	3	1	0
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	374-UNIMOD:35,382-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	2718-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1278-UNIMOD:21,690-UNIMOD:35,703-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|Q92597-3|NDRG1_HUMAN	Isoform 3 of Protein NDRG1 OS=Homo sapiens OX=9606 GN=NDRG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	285-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null	928-UNIMOD:21,939-UNIMOD:21,248-UNIMOD:21	0.05	25.0	3	3	3
PRT	sp|Q8IZ21|PHAR4_HUMAN	Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	344-UNIMOD:21,590-UNIMOD:21	0.05	25.0	2	2	1
PRT	sp|Q8ND56|LS14A_HUMAN	Protein LSM14 homolog A OS=Homo sapiens OX=9606 GN=LSM14A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	192-UNIMOD:21,195-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|Q13153|PAK1_HUMAN	Serine/threonine-protein kinase PAK 1 OS=Homo sapiens OX=9606 GN=PAK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	174-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|P33527|MRP1_HUMAN	Multidrug resistance-associated protein 1 OS=Homo sapiens OX=9606 GN=ABCC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	930-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9NP72|RAB18_HUMAN	Ras-related protein Rab-18 OS=Homo sapiens OX=9606 GN=RAB18 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	144-UNIMOD:21,145-UNIMOD:35	0.06	25.0	1	1	0
PRT	sp|Q92560|BAP1_HUMAN	Ubiquitin carboxyl-terminal hydrolase BAP1 OS=Homo sapiens OX=9606 GN=BAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	320-UNIMOD:4,327-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|Q96G74|OTUD5_HUMAN	OTU domain-containing protein 5 OS=Homo sapiens OX=9606 GN=OTUD5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	64-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	134-UNIMOD:21,157-UNIMOD:35	0.04	25.0	2	1	0
PRT	sp|O60293|ZC3H1_HUMAN	Zinc finger C3H1 domain-containing protein OS=Homo sapiens OX=9606 GN=ZFC3H1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	25.0	null	655-UNIMOD:21	0.01	25.0	3	2	1
PRT	sp|Q86WP2-4|GPBP1_HUMAN	Isoform 4 of Vasculin OS=Homo sapiens OX=9606 GN=GPBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	151-UNIMOD:21	0.08	24.0	1	1	1
PRT	sp|Q9BRD0|BUD13_HUMAN	BUD13 homolog OS=Homo sapiens OX=9606 GN=BUD13 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	271-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|O94826|TOM70_HUMAN	Mitochondrial import receptor subunit TOM70 OS=Homo sapiens OX=9606 GN=TOMM70 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	91-UNIMOD:21,108-UNIMOD:35	0.04	24.0	4	1	0
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	0
PRT	sp|P81605|DCD_HUMAN	Dermcidin OS=Homo sapiens OX=9606 GN=DCD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.11	24.0	1	1	1
PRT	sp|P09525-2|ANXA4_HUMAN	Isoform 2 of Annexin A4 OS=Homo sapiens OX=9606 GN=ANXA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|O96013|PAK4_HUMAN	Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	187-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q5JSZ5|PRC2B_HUMAN	Protein PRRC2B OS=Homo sapiens OX=9606 GN=PRRC2B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	196-UNIMOD:21	0.05	24.0	2	2	2
PRT	sp|P19105|ML12A_HUMAN	Myosin regulatory light chain 12A OS=Homo sapiens OX=9606 GN=MYL12A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|Q9Y4B5-4|MTCL1_HUMAN	Isoform 4 of Microtubule cross-linking factor 1 OS=Homo sapiens OX=9606 GN=MTCL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	94-UNIMOD:4,102-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P07910-3|HNRPC_HUMAN	Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 OS=Homo sapiens OX=9606 GN=HNRNPC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.06	24.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1419-UNIMOD:21	0.01	24.0	5	1	0
PRT	sp|Q6ZSZ5-2|ARHGI_HUMAN	Isoform 4 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	966-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	271-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|Q9UKV3-5|ACINU_HUMAN	Isoform 4 of Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens OX=9606 GN=ACIN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	125-UNIMOD:21,131-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|P46736-4|BRCC3_HUMAN	Isoform 4 of Lys-63-specific deubiquitinase BRCC36 OS=Homo sapiens OX=9606 GN=BRCC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	144-UNIMOD:21	0.06	24.0	2	1	0
PRT	sp|P26583|HMGB2_HUMAN	High mobility group protein B2 OS=Homo sapiens OX=9606 GN=HMGB2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	35-UNIMOD:21	0.21	24.0	2	2	2
PRT	sp|Q9UGP8|SEC63_HUMAN	Translocation protein SEC63 homolog OS=Homo sapiens OX=9606 GN=SEC63 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	537-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1373-UNIMOD:35,1379-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|O60832|DKC1_HUMAN	H/ACA ribonucleoprotein complex subunit DKC1 OS=Homo sapiens OX=9606 GN=DKC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	451-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	537-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P33176|KINH_HUMAN	Kinesin-1 heavy chain OS=Homo sapiens OX=9606 GN=KIF5B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	933-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9GZR2-2|REXO4_HUMAN	Isoform 2 of RNA exonuclease 4 OS=Homo sapiens OX=9606 GN=REXO4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	14-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	139-UNIMOD:21	0.02	24.0	2	2	2
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	411-UNIMOD:21,1068-UNIMOD:21	0.04	24.0	2	2	2
PRT	sp|Q07352|TISB_HUMAN	mRNA decay activator protein ZFP36L1 OS=Homo sapiens OX=9606 GN=ZFP36L1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	54-UNIMOD:21	0.03	24.0	3	1	0
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	149-UNIMOD:21	0.00	24.0	1	1	1
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	237-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q7Z4Q2-3|HEAT3_HUMAN	Isoform 3 of HEAT repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=HEATR3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	254-UNIMOD:21	0.05	24.0	2	1	0
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	132-UNIMOD:21,112-UNIMOD:21,120-UNIMOD:21	0.17	24.0	4	2	1
PRT	sp|Q8N228-3|SCML4_HUMAN	Isoform 3 of Sex comb on midleg-like protein 4 OS=Homo sapiens OX=9606 GN=SCML4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	245-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	675-UNIMOD:21,683-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	735-UNIMOD:21,741-UNIMOD:35	0.02	24.0	1	1	1
PRT	sp|Q2KJY2-2|KI26B_HUMAN	Isoform 2 of Kinesin-like protein KIF26B OS=Homo sapiens OX=9606 GN=KIF26B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	623-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P51787-2|KCNQ1_HUMAN	Isoform 2 of Potassium voltage-gated channel subfamily KQT member 1 OS=Homo sapiens OX=9606 GN=KCNQ1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	282-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	328-UNIMOD:21	0.02	24.0	10	1	0
PRT	sp|Q68EM7-7|RHG17_HUMAN	Isoform 7 of Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	207-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|O43150|ASAP2_HUMAN	Arf-GAP with SH3 domain, ANK repeat and PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ASAP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	822-UNIMOD:21,820-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q13370-2|PDE3B_HUMAN	Isoform 2 of cGMP-inhibited 3',5'-cyclic phosphodiesterase B OS=Homo sapiens OX=9606 GN=PDE3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	442-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	296-UNIMOD:21,292-UNIMOD:21	0.05	24.0	3	1	0
PRT	sp|Q9H410-4|DSN1_HUMAN	Isoform 4 of Kinetochore-associated protein DSN1 homolog OS=Homo sapiens OX=9606 GN=DSN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	14-UNIMOD:21	0.06	24.0	1	1	0
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1010-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	244-UNIMOD:21,246-UNIMOD:4	0.02	24.0	1	1	1
PRT	sp|O43513|MED7_HUMAN	Mediator of RNA polymerase II transcription subunit 7 OS=Homo sapiens OX=9606 GN=MED7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	189-UNIMOD:35,197-UNIMOD:4	0.10	24.0	1	1	1
PRT	sp|Q86X10-2|RLGPB_HUMAN	Isoform 2 of Ral GTPase-activating protein subunit beta OS=Homo sapiens OX=9606 GN=RALGAPB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	192-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P15822|ZEP1_HUMAN	Zinc finger protein 40 OS=Homo sapiens OX=9606 GN=HIVEP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	571-UNIMOD:21,1141-UNIMOD:21	0.01	24.0	2	2	2
PRT	sp|Q86X27|RGPS2_HUMAN	Ras-specific guanine nucleotide-releasing factor RalGPS2 OS=Homo sapiens OX=9606 GN=RALGPS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	341-UNIMOD:385,341-UNIMOD:4,343-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q9UMS6|SYNP2_HUMAN	Synaptopodin-2 OS=Homo sapiens OX=9606 GN=SYNPO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	753-UNIMOD:28,755-UNIMOD:21	0.01	24.0	4	1	0
PRT	sp|P51532|SMCA4_HUMAN	Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	1452-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q9Y597|KCTD3_HUMAN	BTB/POZ domain-containing protein KCTD3 OS=Homo sapiens OX=9606 GN=KCTD3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	606-UNIMOD:385,606-UNIMOD:4,608-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	251-UNIMOD:35,263-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|P21333|FLNA_HUMAN	Filamin-A OS=Homo sapiens OX=9606 GN=FLNA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|O00515|LAD1_HUMAN	Ladinin-1 OS=Homo sapiens OX=9606 GN=LAD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	38-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q8NDT2|RB15B_HUMAN	Putative RNA-binding protein 15B OS=Homo sapiens OX=9606 GN=RBM15B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	532-UNIMOD:21	0.01	24.0	1	1	0
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	158-UNIMOD:21	0.06	23.0	3	3	3
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1852-UNIMOD:21,1848-UNIMOD:21	0.01	23.0	3	1	0
PRT	sp|P48147|PPCE_HUMAN	Prolyl endopeptidase OS=Homo sapiens OX=9606 GN=PREP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q9H8M2|BRD9_HUMAN	Bromodomain-containing protein 9 OS=Homo sapiens OX=9606 GN=BRD9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	566-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P26368-2|U2AF2_HUMAN	Isoform 2 of Splicing factor U2AF 65 kDa subunit OS=Homo sapiens OX=9606 GN=U2AF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	79-UNIMOD:21	0.03	23.0	3	1	0
PRT	sp|P29375-2|KDM5A_HUMAN	Isoform 2 of Lysine-specific demethylase 5A OS=Homo sapiens OX=9606 GN=KDM5A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1484-UNIMOD:35,1488-UNIMOD:21,1489-UNIMOD:35,970-UNIMOD:21	0.02	23.0	3	2	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	575-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P98171|RHG04_HUMAN	Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	930-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q86X02|CDR2L_HUMAN	Cerebellar degeneration-related protein 2-like OS=Homo sapiens OX=9606 GN=CDR2L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	393-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q12809-5|KCNH2_HUMAN	Isoform A-USO of Potassium voltage-gated channel subfamily H member 2 OS=Homo sapiens OX=9606 GN=KCNH2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	304-UNIMOD:21,308-UNIMOD:35	0.01	23.0	1	1	1
PRT	sp|P86791|CCZ1_HUMAN	Vacuolar fusion protein CCZ1 homolog OS=Homo sapiens OX=9606 GN=CCZ1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	266-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q3B726|RPA43_HUMAN	DNA-directed RNA polymerase I subunit RPA43 OS=Homo sapiens OX=9606 GN=TWISTNB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	299-UNIMOD:21	0.08	23.0	1	1	1
PRT	sp|Q04726-2|TLE3_HUMAN	Isoform 2 of Transducin-like enhancer protein 3 OS=Homo sapiens OX=9606 GN=TLE3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	217-UNIMOD:21,222-UNIMOD:35	0.02	23.0	2	1	0
PRT	sp|Q7Z7F7|RM55_HUMAN	39S ribosomal protein L55, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL55 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.13	23.0	1	1	1
PRT	sp|O75152|ZC11A_HUMAN	Zinc finger CCCH domain-containing protein 11A OS=Homo sapiens OX=9606 GN=ZC3H11A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	290-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q99973-2|TEP1_HUMAN	Isoform 2 of Telomerase protein component 1 OS=Homo sapiens OX=9606 GN=TEP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2353-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P62753|RS6_HUMAN	40S ribosomal protein S6 OS=Homo sapiens OX=9606 GN=RPS6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	148-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|Q8NEV8-2|EXPH5_HUMAN	Isoform 2 of Exophilin-5 OS=Homo sapiens OX=9606 GN=EXPH5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	799-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q08499-5|PDE4D_HUMAN	Isoform 2 of cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	69-UNIMOD:35,73-UNIMOD:21,75-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|O00750|P3C2B_HUMAN	Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit beta OS=Homo sapiens OX=9606 GN=PIK3C2B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	155-UNIMOD:21	0.01	23.0	7	1	0
PRT	sp|Q15149-4|PLEC_HUMAN	Isoform 4 of Plectin OS=Homo sapiens OX=9606 GN=PLEC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	19-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	180-UNIMOD:21,185-UNIMOD:21	0.10	23.0	3	1	0
PRT	sp|P10636-3|TAU_HUMAN	Isoform Tau-A of Microtubule-associated protein tau OS=Homo sapiens OX=9606 GN=MAPT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	137-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	211-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|O14672-2|ADA10_HUMAN	Isoform 2 of Disintegrin and metalloproteinase domain-containing protein 10 OS=Homo sapiens OX=9606 GN=ADAM10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	418-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q8WVV4|POF1B_HUMAN	Protein POF1B OS=Homo sapiens OX=9606 GN=POF1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	539-UNIMOD:21,169-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|P41227-2|NAA10_HUMAN	Isoform 2 of N-alpha-acetyltransferase 10 OS=Homo sapiens OX=9606 GN=NAA10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	60-UNIMOD:35	0.09	23.0	1	1	1
PRT	sp|Q6R327|RICTR_HUMAN	Rapamycin-insensitive companion of mTOR OS=Homo sapiens OX=9606 GN=RICTOR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1341-UNIMOD:35,1353-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9Y3Z3-3|SAMH1_HUMAN	Isoform 3 of Deoxynucleoside triphosphate triphosphohydrolase SAMHD1 OS=Homo sapiens OX=9606 GN=SAMHD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	522-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q8IU68-2|TMC8_HUMAN	Isoform 2 of Transmembrane channel-like protein 8 OS=Homo sapiens OX=9606 GN=TMC8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	480-UNIMOD:21,482-UNIMOD:4	0.05	23.0	1	1	1
PRT	sp|P04156-2|PRIO_HUMAN	Isoform 2 of Major prion protein OS=Homo sapiens OX=9606 GN=PRNP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q96JM2|ZN462_HUMAN	Zinc finger protein 462 OS=Homo sapiens OX=9606 GN=ZNF462 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	350-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q92619|HMHA1_HUMAN	Rho GTPase-activating protein 45 OS=Homo sapiens OX=9606 GN=ARHGAP45 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	951-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9P219|DAPLE_HUMAN	Protein Daple OS=Homo sapiens OX=9606 GN=CCDC88C PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1887-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	23.0	null	526-UNIMOD:21,527-UNIMOD:35	0.02	23.0	8	1	0
PRT	sp|Q9P227-2|RHG23_HUMAN	Isoform 2 of Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	677-UNIMOD:21	0.01	23.0	2	1	0
PRT	sp|P85299-2|PRR5_HUMAN	Isoform 2 of Proline-rich protein 5 OS=Homo sapiens OX=9606 GN=PRR5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	185-UNIMOD:35,186-UNIMOD:21,188-UNIMOD:4,181-UNIMOD:21	0.10	23.0	2	1	0
PRT	sp|O75791-2|GRAP2_HUMAN	Isoform 2 of GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	149-UNIMOD:21	0.06	23.0	1	1	0
PRT	sp|P10412|H14_HUMAN	Histone H1.4 OS=Homo sapiens OX=9606 GN=HIST1H1E PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	36-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q13428-2|TCOF_HUMAN	Isoform 2 of Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1273-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9BZL6-2|KPCD2_HUMAN	Isoform 2 of Serine/threonine-protein kinase D2 OS=Homo sapiens OX=9606 GN=PRKD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	40-UNIMOD:21,41-UNIMOD:21,49-UNIMOD:21	0.02	23.0	3	1	0
PRT	sp|Q9H3N1|TMX1_HUMAN	Thioredoxin-related transmembrane protein 1 OS=Homo sapiens OX=9606 GN=TMX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	221-UNIMOD:21,247-UNIMOD:21	0.12	23.0	3	2	1
PRT	sp|Q86UU0-3|BCL9L_HUMAN	Isoform 3 of B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	915-UNIMOD:21,924-UNIMOD:35,929-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q8N1G1|REXO1_HUMAN	RNA exonuclease 1 homolog OS=Homo sapiens OX=9606 GN=REXO1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	462-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q5VTL8|PR38B_HUMAN	Pre-mRNA-splicing factor 38B OS=Homo sapiens OX=9606 GN=PRPF38B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	527-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|O15297-2|PPM1D_HUMAN	Isoform 2 of Protein phosphatase 1D OS=Homo sapiens OX=9606 GN=PPM1D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	97-UNIMOD:21,104-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|Q07960|RHG01_HUMAN	Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=ARHGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	50-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9BQL6-3|FERM1_HUMAN	Isoform 3 of Fermitin family homolog 1 OS=Homo sapiens OX=9606 GN=FERMT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.07	23.0	1	1	1
PRT	sp|P27448-6|MARK3_HUMAN	Isoform 5 of MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	384-UNIMOD:21,402-UNIMOD:21	0.06	23.0	2	2	2
PRT	sp|Q5T0Z8|CF132_HUMAN	Uncharacterized protein C6orf132 OS=Homo sapiens OX=9606 GN=C6orf132 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	449-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q8TE67-2|ES8L3_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	229-UNIMOD:21,214-UNIMOD:21	0.07	23.0	2	2	2
PRT	sp|P32519-2|ELF1_HUMAN	Isoform 2 of ETS-related transcription factor Elf-1 OS=Homo sapiens OX=9606 GN=ELF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	166-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q8WUI4-10|HDAC7_HUMAN	Isoform 10 of Histone deacetylase 7 OS=Homo sapiens OX=9606 GN=HDAC7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	20-UNIMOD:21,36-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q9UEW8-2|STK39_HUMAN	Isoform 2 of STE20/SPS1-related proline-alanine-rich protein kinase OS=Homo sapiens OX=9606 GN=STK39	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	351-UNIMOD:21,352-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q96JQ2|CLMN_HUMAN	Calmin OS=Homo sapiens OX=9606 GN=CLMN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	585-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9NYT0|PLEK2_HUMAN	Pleckstrin-2 OS=Homo sapiens OX=9606 GN=PLEK2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	120-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P23193|TCEA1_HUMAN	Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	100-UNIMOD:21	0.05	23.0	3	1	0
PRT	sp|O75791|GRAP2_HUMAN	GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	262-UNIMOD:21	0.04	23.0	1	1	0
PRT	sp|P05787|K2C8_HUMAN	Keratin, type II cytoskeletal 8 OS=Homo sapiens OX=9606 GN=KRT8 PE=1 SV=7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	205-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q9NX40|OCAD1_HUMAN	OCIA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=OCIAD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	123-UNIMOD:21	0.05	23.0	1	1	0
PRT	sp|P16383|GCFC2_HUMAN	GC-rich sequence DNA-binding factor 2 OS=Homo sapiens OX=9606 GN=GCFC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	97-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	289-UNIMOD:28,291-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|Q02818|NUCB1_HUMAN	Nucleobindin-1 OS=Homo sapiens OX=9606 GN=NUCB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	137-UNIMOD:28,148-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q9Y6M7|S4A7_HUMAN	Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	556-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q8IW41|MAPK5_HUMAN	MAP kinase-activated protein kinase 5 OS=Homo sapiens OX=9606 GN=MAPKAPK5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	354-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|O75382|TRIM3_HUMAN	Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	427-UNIMOD:21	0.02	23.0	1	1	0
PRT	sp|Q13547|HDAC1_HUMAN	Histone deacetylase 1 OS=Homo sapiens OX=9606 GN=HDAC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	406-UNIMOD:21,408-UNIMOD:4,372-UNIMOD:35,381-UNIMOD:35,393-UNIMOD:21	0.09	23.0	2	2	2
PRT	sp|O75122|CLAP2_HUMAN	CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1008-UNIMOD:35,1013-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O75179-4|ANR17_HUMAN	Isoform 4 of Ankyrin repeat domain-containing protein 17 OS=Homo sapiens OX=9606 GN=ANKRD17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1347-UNIMOD:21,1352-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q96BS2-2|CHP3_HUMAN	Isoform 2 of Calcineurin B homologous protein 3 OS=Homo sapiens OX=9606 GN=TESC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	121-UNIMOD:35	0.09	22.0	1	1	1
PRT	sp|O75367-2|H2AY_HUMAN	Isoform 1 of Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=H2AFY	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	129-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q92738|US6NL_HUMAN	USP6 N-terminal-like protein OS=Homo sapiens OX=9606 GN=USP6NL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	642-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q96HA1-2|P121A_HUMAN	Isoform 2 of Nuclear envelope pore membrane protein POM 121 OS=Homo sapiens OX=9606 GN=POM121	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	116-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P32418-2|NAC1_HUMAN	Isoform 3 of Sodium/calcium exchanger 1 OS=Homo sapiens OX=9606 GN=SLC8A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	274-UNIMOD:35,284-UNIMOD:21,291-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q02040|AK17A_HUMAN	A-kinase anchor protein 17A OS=Homo sapiens OX=9606 GN=AKAP17A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	633-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q03989-5|ARI5A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	229-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P18669|PGAM1_HUMAN	Phosphoglycerate mutase 1 OS=Homo sapiens OX=9606 GN=PGAM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	118-UNIMOD:21,126-UNIMOD:35	0.14	22.0	3	2	1
PRT	sp|Q96PX6|CC85A_HUMAN	Coiled-coil domain-containing protein 85A OS=Homo sapiens OX=9606 GN=CCDC85A PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	311-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P27361-2|MK03_HUMAN	Isoform 2 of Mitogen-activated protein kinase 3 OS=Homo sapiens OX=9606 GN=MAPK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	202-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q02952-3|AKA12_HUMAN	Isoform 3 of A-kinase anchor protein 12 OS=Homo sapiens OX=9606 GN=AKAP12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	114-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q13426-2|XRCC4_HUMAN	Isoform 2 of DNA repair protein XRCC4 OS=Homo sapiens OX=9606 GN=XRCC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	313-UNIMOD:21,317-UNIMOD:35,318-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|P49916-4|DNLI3_HUMAN	Isoform 4 of DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	155-UNIMOD:21	0.03	22.0	1	1	0
PRT	sp|Q9Y271|CLTR1_HUMAN	Cysteinyl leukotriene receptor 1 OS=Homo sapiens OX=9606 GN=CYSLTR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	313-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|O14683|P5I11_HUMAN	Tumor protein p53-inducible protein 11 OS=Homo sapiens OX=9606 GN=TP53I11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	14-UNIMOD:21,16-UNIMOD:21	0.06	22.0	3	1	0
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	21-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q5VZL5-3|ZMYM4_HUMAN	Isoform 3 of Zinc finger MYM-type protein 4 OS=Homo sapiens OX=9606 GN=ZMYM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	857-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	114-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	163-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9Y6J9|TAF6L_HUMAN	TAF6-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 6L OS=Homo sapiens OX=9606 GN=TAF6L PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	485-UNIMOD:35,501-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|O75182-2|SIN3B_HUMAN	Isoform 2 of Paired amphipathic helix protein Sin3b OS=Homo sapiens OX=9606 GN=SIN3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	707-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O00712-6|NFIB_HUMAN	Isoform 6 of Nuclear factor 1 B-type OS=Homo sapiens OX=9606 GN=NFIB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	76-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	251-UNIMOD:21,257-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|P17096-2|HMGA1_HUMAN	Isoform HMG-Y of High mobility group protein HMG-I/HMG-Y OS=Homo sapiens OX=9606 GN=HMGA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	42-UNIMOD:21	0.16	22.0	2	1	0
PRT	sp|Q6W2J9-4|BCOR_HUMAN	Isoform 4 of BCL-6 corepressor OS=Homo sapiens OX=9606 GN=BCOR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1358-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q9Y3S1-2|WNK2_HUMAN	Isoform 2 of Serine/threonine-protein kinase WNK2 OS=Homo sapiens OX=9606 GN=WNK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1740-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9UMR2-3|DD19B_HUMAN	Isoform 3 of ATP-dependent RNA helicase DDX19B OS=Homo sapiens OX=9606 GN=DDX19B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	22.0	null	37-UNIMOD:21	0.06	22.0	4	1	0
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	18-UNIMOD:21	0.05	22.0	2	1	0
PRT	sp|O75385|ULK1_HUMAN	Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	556-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q13425|SNTB2_HUMAN	Beta-2-syntrophin OS=Homo sapiens OX=9606 GN=SNTB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	391-UNIMOD:4,393-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q9UI36-2|DACH1_HUMAN	Isoform 2 of Dachshund homolog 1 OS=Homo sapiens OX=9606 GN=DACH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	519-UNIMOD:35,526-UNIMOD:21,530-UNIMOD:21	0.02	22.0	3	1	0
PRT	sp|Q8NC74|RB8NL_HUMAN	RBBP8 N-terminal-like protein OS=Homo sapiens OX=9606 GN=RBBP8NL PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	464-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q7Z6E9-4|RBBP6_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	785-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q96I25|SPF45_HUMAN	Splicing factor 45 OS=Homo sapiens OX=9606 GN=RBM17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	222-UNIMOD:21,234-UNIMOD:35	0.06	22.0	2	1	0
PRT	sp|P49792|RBP2_HUMAN	E3 SUMO-protein ligase RanBP2 OS=Homo sapiens OX=9606 GN=RANBP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1819-UNIMOD:21,1827-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	168-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	87-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|Q9Y4G8|RPGF2_HUMAN	Rap guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=RAPGEF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1176-UNIMOD:21,1186-UNIMOD:35	0.01	22.0	1	1	1
PRT	sp|Q86V15-2|CASZ1_HUMAN	Isoform 2 of Zinc finger protein castor homolog 1 OS=Homo sapiens OX=9606 GN=CASZ1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	54-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q86TI0-2|TBCD1_HUMAN	Isoform 2 of TBC1 domain family member 1 OS=Homo sapiens OX=9606 GN=TBC1D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	596-UNIMOD:21,604-UNIMOD:4	0.02	22.0	1	1	0
PRT	sp|Q9BZ95-3|NSD3_HUMAN	Isoform 3 of Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens OX=9606 GN=NSD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	457-UNIMOD:21,456-UNIMOD:21	0.02	22.0	2	1	0
PRT	sp|P0CAP2-3|GRL1A_HUMAN	Isoform 3 of DNA-directed RNA polymerase II subunit GRINL1A OS=Homo sapiens OX=9606 GN=POLR2M	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	72-UNIMOD:21,82-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|Q13905-2|RPGF1_HUMAN	Isoform Short of Rap guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=RAPGEF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	296-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q8TEW8-5|PAR3L_HUMAN	Isoform 5 of Partitioning defective 3 homolog B OS=Homo sapiens OX=9606 GN=PARD3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	634-UNIMOD:4,635-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P27540-2|ARNT_HUMAN	Isoform 2 of Aryl hydrocarbon receptor nuclear translocator OS=Homo sapiens OX=9606 GN=ARNT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q99856|ARI3A_HUMAN	AT-rich interactive domain-containing protein 3A OS=Homo sapiens OX=9606 GN=ARID3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	353-UNIMOD:21,369-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	431-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q8WWA1-3|TMM40_HUMAN	Isoform 3 of Transmembrane protein 40 OS=Homo sapiens OX=9606 GN=TMEM40	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	61-UNIMOD:21	0.11	22.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1167-UNIMOD:21,1161-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q86Y91-2|KI18B_HUMAN	Isoform 2 of Kinesin-like protein KIF18B OS=Homo sapiens OX=9606 GN=KIF18B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	654-UNIMOD:21,662-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	641-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q5VUA4-2|ZN318_HUMAN	Isoform 2 of Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	527-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O43290|SNUT1_HUMAN	U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	448-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9Y2R2-6|PTN22_HUMAN	Isoform 6 of Tyrosine-protein phosphatase non-receptor type 22 OS=Homo sapiens OX=9606 GN=PTPN22	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	565-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9UJM3|ERRFI_HUMAN	ERBB receptor feedback inhibitor 1 OS=Homo sapiens OX=9606 GN=ERRFI1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	251-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|Q9BWH6-2|RPAP1_HUMAN	Isoform 2 of RNA polymerase II-associated protein 1 OS=Homo sapiens OX=9606 GN=RPAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	264-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q12767|TMM94_HUMAN	Transmembrane protein 94 OS=Homo sapiens OX=9606 GN=TMEM94 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	515-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q86X29-6|LSR_HUMAN	Isoform 6 of Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.03	22.0	1	1	1
PRT	sp|Q8N4S9-2|MALD2_HUMAN	Isoform 2 of MARVEL domain-containing protein 2 OS=Homo sapiens OX=9606 GN=MARVELD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	37-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q15418-3|KS6A1_HUMAN	Isoform 3 of Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	271-UNIMOD:21	0.03	22.0	1	1	0
PRT	sp|Q5T5U3|RHG21_HUMAN	Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	316-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P55795|HNRH2_HUMAN	Heterogeneous nuclear ribonucleoprotein H2 OS=Homo sapiens OX=9606 GN=HNRNPH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|Q9H6S0|YTDC2_HUMAN	3'-5' RNA helicase YTHDC2 OS=Homo sapiens OX=9606 GN=YTHDC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1219-UNIMOD:35,1221-UNIMOD:21	0.01	22.0	2	1	0
PRT	sp|Q9NVE7|PANK4_HUMAN	Pantothenate kinase 4 OS=Homo sapiens OX=9606 GN=PANK4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	63-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q15418|KS6A1_HUMAN	Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	363-UNIMOD:21	0.03	22.0	1	1	0
PRT	sp|Q96Q42|ALS2_HUMAN	Alsin OS=Homo sapiens OX=9606 GN=ALS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	1331-UNIMOD:28,1335-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q4LE39|ARI4B_HUMAN	AT-rich interactive domain-containing protein 4B OS=Homo sapiens OX=9606 GN=ARID4B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	666-UNIMOD:21	0.01	22.0	1	1	0
PRT	sp|Q8IWB9|TEX2_HUMAN	Testis-expressed protein 2 OS=Homo sapiens OX=9606 GN=TEX2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	732-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q8IYH5|ZZZ3_HUMAN	ZZ-type zinc finger-containing protein 3 OS=Homo sapiens OX=9606 GN=ZZZ3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	113-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O14617|AP3D1_HUMAN	AP-3 complex subunit delta-1 OS=Homo sapiens OX=9606 GN=AP3D1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	658-UNIMOD:21	0.01	22.0	1	1	0
PRT	sp|P35609|ACTN2_HUMAN	Alpha-actinin-2 OS=Homo sapiens OX=9606 GN=ACTN2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	355-UNIMOD:21,361-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|O75382-4|TRIM3_HUMAN	Isoform 4 of Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	308-UNIMOD:21	0.03	21.0	3	1	0
PRT	sp|Q5T6F0|DCA12_HUMAN	DDB1- and CUL4-associated factor 12 OS=Homo sapiens OX=9606 GN=DCAF12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	15-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	461-UNIMOD:21,463-UNIMOD:35	0.05	21.0	1	1	1
PRT	sp|Q9ULK2-3|AT7L1_HUMAN	Isoform 3 of Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	489-UNIMOD:21,491-UNIMOD:21	0.03	21.0	2	1	0
PRT	sp|Q9BZF1-3|OSBL8_HUMAN	Isoform 3 of Oxysterol-binding protein-related protein 8 OS=Homo sapiens OX=9606 GN=OSBPL8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	23-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P27708|PYR1_HUMAN	CAD protein OS=Homo sapiens OX=9606 GN=CAD PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1937-UNIMOD:35,1938-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9BUH8|BEGIN_HUMAN	Brain-enriched guanylate kinase-associated protein OS=Homo sapiens OX=9606 GN=BEGAIN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	246-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P61224-4|RAP1B_HUMAN	Isoform 4 of Ras-related protein Rap-1b OS=Homo sapiens OX=9606 GN=RAP1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	69-UNIMOD:35	0.10	21.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q99590-2|SCAFB_HUMAN	Isoform 2 of Protein SCAF11 OS=Homo sapiens OX=9606 GN=SCAF11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q6P996-3|PDXD1_HUMAN	Isoform 3 of Pyridoxal-dependent decarboxylase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PDXDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	333-UNIMOD:21,334-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|Q9H2U2-6|IPYR2_HUMAN	Isoform 5 of Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9Y5K6|CD2AP_HUMAN	CD2-associated protein OS=Homo sapiens OX=9606 GN=CD2AP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	514-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9HCH5-15|SYTL2_HUMAN	Isoform 12 of Synaptotagmin-like protein 2 OS=Homo sapiens OX=9606 GN=SYTL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	202-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q93074-3|MED12_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 12 OS=Homo sapiens OX=9606 GN=MED12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	635-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9BW71-3|HIRP3_HUMAN	Isoform 3 of HIRA-interacting protein 3 OS=Homo sapiens OX=9606 GN=HIRIP3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	27-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|Q15366-6|PCBP2_HUMAN	Isoform 6 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	183-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|O95470|SGPL1_HUMAN	Sphingosine-1-phosphate lyase 1 OS=Homo sapiens OX=9606 GN=SGPL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q96JN0-3|LCOR_HUMAN	Isoform 3 of Ligand-dependent corepressor OS=Homo sapiens OX=9606 GN=LCOR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1048-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9BXP5-5|SRRT_HUMAN	Isoform 5 of Serrate RNA effector molecule homolog OS=Homo sapiens OX=9606 GN=SRRT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	74-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q5HYW2|NHSL2_HUMAN	NHS-like protein 2 OS=Homo sapiens OX=9606 GN=NHSL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	435-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P47712|PA24A_HUMAN	Cytosolic phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q8IVT2|MISP_HUMAN	Mitotic interactor and substrate of PLK1 OS=Homo sapiens OX=9606 GN=MISP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	471-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|O75427|LRCH4_HUMAN	Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRCH4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	432-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P62070-2|RRAS2_HUMAN	Isoform 2 of Ras-related protein R-Ras2 OS=Homo sapiens OX=9606 GN=RRAS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	106-UNIMOD:4,109-UNIMOD:21	0.13	21.0	1	1	1
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	223-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	373-UNIMOD:21	0.02	21.0	2	1	0
PRT	sp|Q5T0W9|FA83B_HUMAN	Protein FAM83B OS=Homo sapiens OX=9606 GN=FAM83B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	542-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9NS91|RAD18_HUMAN	E3 ubiquitin-protein ligase RAD18 OS=Homo sapiens OX=9606 GN=RAD18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	103-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q15813|TBCE_HUMAN	Tubulin-specific chaperone E OS=Homo sapiens OX=9606 GN=TBCE PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	408-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9ULD5|ZN777_HUMAN	Zinc finger protein 777 OS=Homo sapiens OX=9606 GN=ZNF777 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	21.0	null	623-UNIMOD:21,628-UNIMOD:21	0.02	21.0	2	2	2
PRT	sp|Q6UX71-3|PXDC2_HUMAN	Isoform 3 of Plexin domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PLXDC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	128-UNIMOD:21	0.12	21.0	1	1	1
PRT	sp|O43847|NRDC_HUMAN	Nardilysin OS=Homo sapiens OX=9606 GN=NRDC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	94-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q8TEW0-9|PARD3_HUMAN	Isoform 9 of Partitioning defective 3 homolog OS=Homo sapiens OX=9606 GN=PARD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	706-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9H3Y6|SRMS_HUMAN	Tyrosine-protein kinase Srms OS=Homo sapiens OX=9606 GN=SRMS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	94-UNIMOD:21	0.04	21.0	2	1	0
PRT	sp|Q2PPJ7-3|RGPA2_HUMAN	Isoform 3 of Ral GTPase-activating protein subunit alpha-2 OS=Homo sapiens OX=9606 GN=RALGAPA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	373-UNIMOD:21,378-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q96S55-2|WRIP1_HUMAN	Isoform 2 of ATPase WRNIP1 OS=Homo sapiens OX=9606 GN=WRNIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	153-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|O43294-2|TGFI1_HUMAN	Isoform 2 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	123-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P31629|ZEP2_HUMAN	Transcription factor HIVEP2 OS=Homo sapiens OX=9606 GN=HIVEP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	2118-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1054-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q8IXQ3|CI040_HUMAN	Uncharacterized protein C9orf40 OS=Homo sapiens OX=9606 GN=C9orf40 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	80-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|P57081-3|WDR4_HUMAN	Isoform 3 of tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit WDR4 OS=Homo sapiens OX=9606 GN=WDR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	245-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|Q717R9|CYS1_HUMAN	Cystin-1 OS=Homo sapiens OX=9606 GN=CYS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	59-UNIMOD:21	0.20	21.0	1	1	1
PRT	sp|Q9H334-6|FOXP1_HUMAN	Isoform 6 of Forkhead box protein P1 OS=Homo sapiens OX=9606 GN=FOXP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	549-UNIMOD:21,551-UNIMOD:35	0.02	21.0	1	1	1
PRT	sp|O94913|PCF11_HUMAN	Pre-mRNA cleavage complex 2 protein Pcf11 OS=Homo sapiens OX=9606 GN=PCF11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	487-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q8WV28-3|BLNK_HUMAN	Isoform 3 of B-cell linker protein OS=Homo sapiens OX=9606 GN=BLNK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	129-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9Y2U8|MAN1_HUMAN	Inner nuclear membrane protein Man1 OS=Homo sapiens OX=9606 GN=LEMD3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	291-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P15880|RS2_HUMAN	40S ribosomal protein S2 OS=Homo sapiens OX=9606 GN=RPS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	281-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P51790-4|CLCN3_HUMAN	Isoform 3 of H(+)/Cl(-) exchange transporter 3 OS=Homo sapiens OX=9606 GN=CLCN3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	706-UNIMOD:4,718-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q96EV2|RBM33_HUMAN	RNA-binding protein 33 OS=Homo sapiens OX=9606 GN=RBM33 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	765-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q68DK7-3|MSL1_HUMAN	Isoform 3 of Male-specific lethal 1 homolog OS=Homo sapiens OX=9606 GN=MSL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	179-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|P10244-2|MYBB_HUMAN	Isoform 2 of Myb-related protein B OS=Homo sapiens OX=9606 GN=MYBL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	514-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q04637|IF4G1_HUMAN	Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens OX=9606 GN=EIF4G1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.01	21.0	1	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=HIST1H1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	2-UNIMOD:1,18-UNIMOD:21	0.09	21.0	1	1	1
PRT	sp|Q8WWI1|LMO7_HUMAN	LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	1491-UNIMOD:21,1505-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|O75376|NCOR1_HUMAN	Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	2151-UNIMOD:21	0.01	21.0	1	1	0
PRT	sp|O43159|RRP8_HUMAN	Ribosomal RNA-processing protein 8 OS=Homo sapiens OX=9606 GN=RRP8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	170-UNIMOD:28,176-UNIMOD:21	0.04	21.0	1	1	1
PRT	sp|Q63HR2|TNS2_HUMAN	Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	1096-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	98-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q14814|MEF2D_HUMAN	Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	251-UNIMOD:21	0.04	21.0	1	1	0
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	97-UNIMOD:4	0.05	21.0	1	1	1
PRT	sp|Q6GQQ9|OTU7B_HUMAN	OTU domain-containing protein 7B OS=Homo sapiens OX=9606 GN=OTUD7B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	733-UNIMOD:28,734-UNIMOD:4,745-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q14315|FLNC_HUMAN	Filamin-C OS=Homo sapiens OX=9606 GN=FLNC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	2233-UNIMOD:21	0.00	21.0	1	1	1
PRT	sp|Q9UKM9|RALY_HUMAN	RNA-binding protein Raly OS=Homo sapiens OX=9606 GN=RALY PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	160-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P55285|CADH6_HUMAN	Cadherin-6 OS=Homo sapiens OX=9606 GN=CDH6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	648-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P29803|ODPAT_HUMAN	Pyruvate dehydrogenase E1 component subunit alpha, testis-specific form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	291-UNIMOD:21	0.04	21.0	1	1	0
PRT	sp|Q6ZV29|PLPL7_HUMAN	Patatin-like phospholipase domain-containing protein 7 OS=Homo sapiens OX=9606 GN=PNPLA7 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	232-UNIMOD:21,241-UNIMOD:21,242-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9NXV2|KCTD5_HUMAN	BTB/POZ domain-containing protein KCTD5 OS=Homo sapiens OX=9606 GN=KCTD5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	28-UNIMOD:4,29-UNIMOD:21	0.08	21.0	1	1	1
PRT	sp|Q9Y2J4-3|AMOL2_HUMAN	Isoform 3 of Angiomotin-like protein 2 OS=Homo sapiens OX=9606 GN=AMOTL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	178-UNIMOD:35,183-UNIMOD:21,604-UNIMOD:21	0.05	20.0	2	2	2
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	104-UNIMOD:4,125-UNIMOD:21	0.12	20.0	1	1	0
PRT	sp|Q14152-2|EIF3A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q9UNH7-2|SNX6_HUMAN	Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	50-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q2M1Z3|RHG31_HUMAN	Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1054-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P49450-2|CENPA_HUMAN	Isoform 2 of Histone H3-like centromeric protein A OS=Homo sapiens OX=9606 GN=CENPA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	32-UNIMOD:21	0.12	20.0	1	1	1
PRT	sp|Q9NYF3|FA53C_HUMAN	Protein FAM53C OS=Homo sapiens OX=9606 GN=FAM53C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	162-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	253-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q15125|EBP_HUMAN	3-beta-hydroxysteroid-Delta(8),Delta(7)-isomerase OS=Homo sapiens OX=9606 GN=EBP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	216-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q8TDN6|BRX1_HUMAN	Ribosome biogenesis protein BRX1 homolog OS=Homo sapiens OX=9606 GN=BRIX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	261-UNIMOD:21,264-UNIMOD:35	0.07	20.0	1	1	1
PRT	sp|Q9BZ71-2|PITM3_HUMAN	Isoform 2 of Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens OX=9606 GN=PITPNM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	498-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q0IIM8|TBC8B_HUMAN	TBC1 domain family member 8B OS=Homo sapiens OX=9606 GN=TBC1D8B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1035-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9H7D7-3|WDR26_HUMAN	Isoform 3 of WD repeat-containing protein 26 OS=Homo sapiens OX=9606 GN=WDR26	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	121-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|P49815-7|TSC2_HUMAN	Isoform 7 of Tuberin OS=Homo sapiens OX=9606 GN=TSC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	615-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9BZF9-2|UACA_HUMAN	Isoform 2 of Uveal autoantigen with coiled-coil domains and ankyrin repeats OS=Homo sapiens OX=9606 GN=UACA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1245-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P01023|A2MG_HUMAN	Alpha-2-macroglobulin OS=Homo sapiens OX=9606 GN=A2M PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	278-UNIMOD:4,287-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P48634-4|PRC2A_HUMAN	Isoform 4 of Protein PRRC2A OS=Homo sapiens OX=9606 GN=PRRC2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	517-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|O14647-2|CHD2_HUMAN	Isoform 2 of Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens OX=9606 GN=CHD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1364-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	618-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9C0A6-2|SETD5_HUMAN	Isoform 2 of SET domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SETD5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	744-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P48730-2|KC1D_HUMAN	Isoform 2 of Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	337-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|Q96PU5-4|NED4L_HUMAN	Isoform 4 of E3 ubiquitin-protein ligase NEDD4-like OS=Homo sapiens OX=9606 GN=NEDD4L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	219-UNIMOD:21,220-UNIMOD:4	0.03	20.0	1	1	1
PRT	sp|Q9C0G0-3|ZN407_HUMAN	Isoform 3 of Zinc finger protein 407 OS=Homo sapiens OX=9606 GN=ZNF407	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	941-UNIMOD:35,952-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1441-UNIMOD:21,1451-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|P28799-3|GRN_HUMAN	Isoform 3 of Granulins OS=Homo sapiens OX=9606 GN=GRN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	255-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|O15047|SET1A_HUMAN	Histone-lysine N-methyltransferase SETD1A OS=Homo sapiens OX=9606 GN=SETD1A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	388-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P49760-2|CLK2_HUMAN	Isoform 2 of Dual specificity protein kinase CLK2 OS=Homo sapiens OX=9606 GN=CLK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	50-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|Q6PGN9-2|PSRC1_HUMAN	Isoform A of Proline/serine-rich coiled-coil protein 1 OS=Homo sapiens OX=9606 GN=PSRC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	122-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P18627|LAG3_HUMAN	Lymphocyte activation gene 3 protein OS=Homo sapiens OX=9606 GN=LAG3 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	484-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9P0L2-2|MARK1_HUMAN	Isoform 2 of Serine/threonine-protein kinase MARK1 OS=Homo sapiens OX=9606 GN=MARK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	288-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|O43719|HTSF1_HUMAN	HIV Tat-specific factor 1 OS=Homo sapiens OX=9606 GN=HTATSF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	480-UNIMOD:4,485-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1255-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P38398-8|BRCA1_HUMAN	Isoform 8 of Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	647-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q7Z7G8-2|VP13B_HUMAN	Isoform 2 of Vacuolar protein sorting-associated protein 13B OS=Homo sapiens OX=9606 GN=VPS13B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	999-UNIMOD:21	0.00	20.0	1	1	1
PRT	sp|Q96N96-6|SPT13_HUMAN	Isoform 6 of Spermatogenesis-associated protein 13 OS=Homo sapiens OX=9606 GN=SPATA13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	272-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q96PK6|RBM14_HUMAN	RNA-binding protein 14 OS=Homo sapiens OX=9606 GN=RBM14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	643-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9UM11-3|FZR1_HUMAN	Isoform 3 of Fizzy-related protein homolog OS=Homo sapiens OX=9606 GN=FZR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	121-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9UBF8-3|PI4KB_HUMAN	Isoform 3 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	179-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q5JSL3|DOC11_HUMAN	Dedicator of cytokinesis protein 11 OS=Homo sapiens OX=9606 GN=DOCK11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	12-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q16825|PTN21_HUMAN	Tyrosine-protein phosphatase non-receptor type 21 OS=Homo sapiens OX=9606 GN=PTPN21 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	637-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P61313|RL15_HUMAN	60S ribosomal protein L15 OS=Homo sapiens OX=9606 GN=RPL15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	197-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	284-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|A1L390-2|PKHG3_HUMAN	Isoform 2 of Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	274-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q96JP5-2|ZFP91_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase ZFP91 OS=Homo sapiens OX=9606 GN=ZFP91	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	83-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q10570|CPSF1_HUMAN	Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens OX=9606 GN=CPSF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	766-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9UIF8-4|BAZ2B_HUMAN	Isoform 4 of Bromodomain adjacent to zinc finger domain protein 2B OS=Homo sapiens OX=9606 GN=BAZ2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	356-UNIMOD:35,360-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	6-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q14802|FXYD3_HUMAN	FXYD domain-containing ion transport regulator 3 OS=Homo sapiens OX=9606 GN=FXYD3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	76-UNIMOD:21	0.23	20.0	1	1	1
PRT	sp|Q8WXE1-2|ATRIP_HUMAN	Isoform 2 of ATR-interacting protein OS=Homo sapiens OX=9606 GN=ATRIP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	518-UNIMOD:21,522-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|P35611-2|ADDA_HUMAN	Isoform 2 of Alpha-adducin OS=Homo sapiens OX=9606 GN=ADD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	614-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q13480|GAB1_HUMAN	GRB2-associated-binding protein 1 OS=Homo sapiens OX=9606 GN=GAB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	417-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q08495-3|DEMA_HUMAN	Isoform 3 of Dematin OS=Homo sapiens OX=9606 GN=DMTN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	254-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q96S82|UBL7_HUMAN	Ubiquitin-like protein 7 OS=Homo sapiens OX=9606 GN=UBL7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	123-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9UDT6-2|CLIP2_HUMAN	Isoform 2 of CAP-Gly domain-containing linker protein 2 OS=Homo sapiens OX=9606 GN=CLIP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	888-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q14839|CHD4_HUMAN	Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens OX=9606 GN=CHD4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	529-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q7Z5L9|I2BP2_HUMAN	Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	360-UNIMOD:21	0.03	20.0	1	1	0
PRT	sp|Q00613|HSF1_HUMAN	Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	363-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	860-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P49916|DNLI3_HUMAN	DNA ligase 3 OS=Homo sapiens OX=9606 GN=LIG3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	242-UNIMOD:21	0.02	20.0	1	1	0
PRT	sp|Q9NZJ0|DTL_HUMAN	Denticleless protein homolog OS=Homo sapiens OX=9606 GN=DTL PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	181-UNIMOD:28,198-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q14789|GOGB1_HUMAN	Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	560-UNIMOD:21,566-UNIMOD:35	0.00	20.0	1	1	1
PRT	sp|Q96S95|CK2N2_HUMAN	Calcium/calmodulin-dependent protein kinase II inhibitor 2 OS=Homo sapiens OX=9606 GN=CAMK2N2 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	33-UNIMOD:21	0.20	20.0	1	1	1
PRT	sp|Q15208|STK38_HUMAN	Serine/threonine-protein kinase 38 OS=Homo sapiens OX=9606 GN=STK38 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	52-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q08170|SRSF4_HUMAN	Serine/arginine-rich splicing factor 4 OS=Homo sapiens OX=9606 GN=SRSF4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	0
PRT	sp|Q9C0C2|TB182_HUMAN	182 kDa tankyrase-1-binding protein OS=Homo sapiens OX=9606 GN=TNKS1BP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	421-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9P2B7|CFA97_HUMAN	Cilia- and flagella-associated protein 97 OS=Homo sapiens OX=9606 GN=CFAP97 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	514-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P51531|SMCA2_HUMAN	Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	1377-UNIMOD:21	0.01	20.0	1	1	0
PRT	sp|Q7Z3K3|POGZ_HUMAN	Pogo transposable element with ZNF domain OS=Homo sapiens OX=9606 GN=POGZ PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	1364-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q6DT37|MRCKG_HUMAN	Serine/threonine-protein kinase MRCK gamma OS=Homo sapiens OX=9606 GN=CDC42BPG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	1484-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q9NYF8|BCLF1_HUMAN	Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	287-UNIMOD:21	0.02	20.0	1	1	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	104-UNIMOD:21,108-UNIMOD:35	0.16	20.0	1	1	1
PRT	sp|Q86X29|LSR_HUMAN	Lipolysis-stimulated lipoprotein receptor OS=Homo sapiens OX=9606 GN=LSR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	453-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P48651|PTSS1_HUMAN	Phosphatidylserine synthase 1 OS=Homo sapiens OX=9606 GN=PTDSS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	442-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9BQG0|MBB1A_HUMAN	Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	1269-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	226-UNIMOD:21	0.03	20.0	1	1	0
PRT	sp|O60885|BRD4_HUMAN	Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	296-UNIMOD:21	0.02	20.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	PTHHPVSSITGQDFSASTPK	1	sp|O94823|AT10B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	8-UNIMOD:21	ms_run[2]:scan=9436	51.913	3	2172.9841	2172.9841	R	S	1364	1384
PSM	RHSVVAGGGGGEGR	2	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	3-UNIMOD:21	ms_run[2]:scan=838	6.3377	2	1374.6154	1374.6154	K	K	961	975
PSM	DASDDLDDLNFFNQK	3	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=18496	113.6	2	1755.7588	1755.7588	K	K	65	80
PSM	AAEDDEDDDVDTKK	4	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35		ms_run[2]:scan=1251	7.9511	2	1564.6377	1564.6377	R	Q	90	104
PSM	PGAEGAPLLPPPLPPPSPPGSGR	5	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	17-UNIMOD:21	ms_run[2]:scan=16168	95.532	2	2237.1246	2237.1246	R	G	27	50
PSM	RPAEATSSPTSPERPR	6	sp|Q9BU76|MMTA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:21	ms_run[2]:scan=1992	11.388	2	1817.8421	1817.8421	R	H	210	226
PSM	SLGVDMDDKDDAHYAVQAR	7	sp|Q9BZE4-3|NOG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	6-UNIMOD:35	ms_run[2]:scan=7806	42.663	2	2120.9433	2120.9433	R	R	410	429
PSM	AQVLATIHGHAGAFPAAGDAGEGAPGGGSSPER	8	sp|Q86WR7|PRSR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	29-UNIMOD:21	ms_run[2]:scan=12280	69.065	3	3092.4101	3092.4101	R	V	283	316
PSM	RLSTSPDVIQGHQPR	9	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21	ms_run[2]:scan=7344	40.133	2	1769.8574	1769.8574	R	D	264	279
PSM	RSPVSPQLQQQHQAAAAAFLQQR	10	sp|Q7Z5Q1-7|CPEB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	2-UNIMOD:21	ms_run[2]:scan=12534	70.739	3	2639.3082	2639.3082	R	N	66	89
PSM	SHVSSEPYEPISPPQVPVVHEK	11	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	12-UNIMOD:21	ms_run[2]:scan=13787	78.84	3	2521.189	2521.1890	R	Q	2037	2059
PSM	VIPAKSPPPPTHSTQLGAPSR	12	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:21	ms_run[2]:scan=6947	37.94	3	2217.1307	2217.1307	K	K	200	221
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	13	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15185	88.28762333333333	3	3442.4033	3442.4027	K	L	104	135
PSM	DHNEEEGEETGLRDEK	14	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=3141	17.416	2	1885.7926	1885.7926	R	P	441	457
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	15	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	16-UNIMOD:21	ms_run[2]:scan=8358	45.818	3	2671.2239	2671.2239	K	Q	710	737
PSM	HADHSSLTLGSGSSTTR	16	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	11-UNIMOD:21	ms_run[2]:scan=4632	25.139	2	1792.7741	1792.7741	R	L	2522	2539
PSM	IEDVGSDEEDDSGKDK	17	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=3286	18.077	2	1816.6888	1816.6888	K	K	250	266
PSM	PGAEGAPLLPPPLPPPSPPGSGR	18	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	17-UNIMOD:21	ms_run[2]:scan=16300	96.547	2	2237.1246	2237.1246	R	G	27	50
PSM	RAAEDDEDDDVDTKK	19	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=911	6.594	2	1720.7388	1720.7388	K	Q	89	104
PSM	RLPQDHADSCVVSSDDEELSR	20	sp|P78317|RNF4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:4,13-UNIMOD:21	ms_run[2]:scan=8827	48.52	3	2494.0432	2494.0432	R	D	82	103
PSM	RPSQNAISFFNVGHSK	21	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=13877	79.438	3	1867.873	1867.8730	R	L	187	203
PSM	RRDSLDSSTEASGSDVVLGGR	22	sp|Q9Y2I9|TBC30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:21	ms_run[2]:scan=9288	51.082	3	2243.0179	2243.0179	R	S	111	132
PSM	RTHSEGSLLQEPR	23	sp|P49796-4|RGS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:21	ms_run[2]:scan=6242	33.857	2	1588.7359	1588.7359	R	G	659	672
PSM	RVIGQDHDFSESSEEEAPAEASSGALR	24	sp|P23497-7|SP100_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	13-UNIMOD:21	ms_run[2]:scan=11008	61.229	3	2953.2727	2953.2727	K	S	363	390
PSM	SHSDASVGSHSSTESEHGSSSPR	25	sp|Q6XZF7-2|DNMBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=876	6.4679	3	2390.9361	2390.9361	R	F	597	620
PSM	FADQDDIGNVSFDR	26	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=13279	75.502	2	1597.7009	1597.7009	K	V	489	503
PSM	GVVDSDDLPLNVSR	27	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=13520	77.079	2	1484.7471	1484.7471	K	E	435	449
PSM	IHGSGHVEEPASPLAAYQK	28	sp|Q12955-6|ANK3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:21	ms_run[2]:scan=8697	47.782	2	2069.9572	2069.9572	K	S	911	930
PSM	KEEEEEEEEYDEGSNLKK	29	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=5209	28.234	3	2212.9495	2212.9495	K	Q	230	248
PSM	KQSLGELIGTLNAAK	30	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=17053	102.44	2	1621.844	1621.8440	R	V	19	34
PSM	RENPPVEDSSDEDDKR	31	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1586	9.4872	3	1886.8242	1886.8242	K	N	490	506
PSM	RHTLSEVTNQLVVMPGAGK	32	sp|Q9H0K1|SIK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=12349	69.466	3	2132.0449	2132.0449	R	I	482	501
PSM	RLSTSPDVIQGHQPR	33	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=7159	39.11	2	1769.8574	1769.8574	R	D	264	279
PSM	RPASPSSPEHLPATPAESPAQR	34	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	4-UNIMOD:21	ms_run[2]:scan=7942	43.487	2	2362.1067	2362.1067	K	F	231	253
PSM	RRDSLDSSTEASGSDVVLGGR	35	sp|Q9Y2I9|TBC30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	12-UNIMOD:21	ms_run[2]:scan=9255	50.901	2	2243.0179	2243.0179	R	S	111	132
PSM	RRSIQDLTVTGTEPGQVSSR	36	sp|O43318-4|M3K7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	3-UNIMOD:21	ms_run[2]:scan=9445	51.963	3	2266.1067	2266.1067	R	S	410	430
PSM	RAAEDDEDDDVDTKK	37	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1165	7.609398333333334	2	1719.735710	1720.738767	K	Q	90	105
PSM	LKDLGHPVEEEDELESGDQEDEDDESEDPGK	38	sp|O60763|USO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=10432	57.76262	3	3483.444881	3483.444502	K	D	927	958
PSM	ESEDKPEIEDVGSDEEEEKK	39	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21	ms_run[2]:scan=7002	38.265	3	2399.9741	2399.9741	K	D	251	271
PSM	FASDDEHDEHDENGATGPVK	40	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3649	19.865	3	2168.8883	2168.8883	K	R	364	384
PSM	GRPPAEKLSPNPPK	41	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	9-UNIMOD:21	ms_run[2]:scan=4415	24.023	2	1566.7919	1566.7919	R	L	1369	1383
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	42	sp|Q0ZGT2-4|NEXN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=5257	28.444	3	3007.1874	3007.1874	K	S	490	515
PSM	KRSWSSEEESNQATGTSR	43	sp|Q8NFZ0|FBH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=3666	19.966	3	2118.8968	2118.8968	R	W	122	140
PSM	LHSDSGISVDSQSLHDQQPHTQTASGQALK	44	sp|P08138-2|TNR16_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	11-UNIMOD:21	ms_run[2]:scan=8674	47.651	3	3251.4844	3251.4844	K	G	207	237
PSM	LKDLFDYSPPLHK	45	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:21	ms_run[2]:scan=15283	88.944	2	1651.8011	1651.8011	K	N	503	516
PSM	RAAEDDEDDDVDTKK	46	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1069	7.2225	3	1720.7388	1720.7388	K	Q	89	104
PSM	RAPSVANVGSHCDLSLK	47	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9846	54.282	2	1889.8819	1889.8819	R	I	2141	2158
PSM	RHNSASVENVSLR	48	sp|Q9Y4H2|IRS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=5624	30.416	2	1547.7206	1547.7206	K	K	1171	1184
PSM	RHSSETFSSTPSATR	49	sp|P35568|IRS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=3344	18.336	2	1729.7421	1729.7421	R	V	1098	1113
PSM	RNSSEASSGDFLDLK	50	sp|Q9UK76-3|JUPI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=13180	74.845	2	1704.7356	1704.7356	R	G	39	54
PSM	SLSSSLQAPVVSTVGMQR	51	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=14928	86.536	2	1941.9231	1941.9231	R	L	11	29
PSM	VKPPPSPTTEGPSLQPDLAPEEAAGTQRPK	52	sp|Q9Y2D5|AKAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	6-UNIMOD:21	ms_run[2]:scan=12166	68.339	3	3174.5598	3174.5598	K	N	773	803
PSM	QSPPLPGREEEPGLGDSGIQSTPGSGHAPR	53	sp|Q9C0B5|ZDHC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=12693	71.74486666666667	3	3072.3943	3072.3933	R	T	553	583
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	54	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	26-UNIMOD:21	ms_run[2]:scan=10197	56.379	3	3407.6452	3407.6452	R	N	215	246
PSM	GIHEEQPQQQQPPPPPPPPQSPEEGTTYIAPAK	55	sp|P08235|MCR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	21-UNIMOD:21	ms_run[2]:scan=10897	60.57	3	3649.709	3649.7090	K	E	683	716
PSM	GKDSYETSQLDDQSAETHSHK	56	sp|P10451-3|OSTP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=4816	26.162	3	2441.9973	2441.9973	R	Q	194	215
PSM	GPPSPPAPVMHSPSR	57	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=8032	44.017	2	1592.7171	1592.7171	R	K	221	236
PSM	GVVDSDDLPLNVSR	58	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=13688	78.16	2	1484.7471	1484.7471	K	E	435	449
PSM	HCAPSPDRSPELSSSR	59	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=3209	17.718	2	1861.7778	1861.7778	R	D	622	638
PSM	HSTPSNSSNPSGPPSPNSPHR	60	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:21	ms_run[2]:scan=1877	10.837	3	2219.9345	2219.9345	K	S	1676	1697
PSM	IEDVGSDEEDDSGKDKK	61	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=2337	13.199	2	1944.7837	1944.7837	K	K	250	267
PSM	KIEQVDKEDEITEK	62	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=4761	25.879	2	1702.8625	1702.8625	R	K	444	458
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	63	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:21	ms_run[2]:scan=12871	72.864	3	3605.6199	3605.6199	K	L	150	183
PSM	KTPSKPPAQLSPSVPK	64	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	11-UNIMOD:21	ms_run[2]:scan=6663	36.332	2	1740.9175	1740.9175	K	R	256	272
PSM	KVEEEEDESALKR	65	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=3072	17.066	2	1560.7631	1560.7631	R	S	733	746
PSM	LKDQDQDEDEEEKEK	66	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=959	6.7869	2	1876.8174	1876.8174	R	R	182	197
PSM	PGAEGAPLLPPPLPPPSPPGSGR	67	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:21	ms_run[2]:scan=16030	94.52	2	2237.1246	2237.1246	R	G	27	50
PSM	RAAEDDEDDDVDTKK	68	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=797	6.1831	3	1720.7388	1720.7388	K	Q	89	104
PSM	RGADEDDEKEWGDDEEEQPSK	69	sp|Q15020-4|SART3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=5621	30.4	3	2462.9946	2462.9946	K	R	587	608
PSM	RKPEDVLDDDDAGSAPLK	70	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:21	ms_run[2]:scan=10157	56.153	2	2019.915	2019.9150	R	S	140	158
PSM	RKPSPEPEGEVGPPK	71	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	4-UNIMOD:21	ms_run[2]:scan=3761	20.494	2	1682.8029	1682.8029	K	I	341	356
PSM	RPATADSPKPSAK	72	sp|Q03111|ENL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	7-UNIMOD:21	ms_run[2]:scan=665	5.6862	2	1404.6762	1404.6762	K	K	286	299
PSM	RTNSDSALHQSTMTPTQPESFSSGSQDVHQK	73	sp|Q6UUV9-3|CRTC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	2-UNIMOD:21,13-UNIMOD:35	ms_run[2]:scan=7777	42.501	3	3483.4998	3483.4998	R	R	148	179
PSM	SRPFTVAASFQSTSVKSPK	74	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	17-UNIMOD:21	ms_run[2]:scan=11432	63.793	3	2104.0354	2104.0354	R	T	588	607
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	75	sp|Q0ZGT2|NEXN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=5956	32.26182333333333	3	3008.171154	3007.187379	K	S	554	579
PSM	HLEHAPSPSDVSNAPEVK	76	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	7-UNIMOD:21	ms_run[1]:scan=8127	44.51394833333333	3	1995.923411	1992.894236	K	A	439	457
PSM	AADRLPNLSSPSAEGPPGPPSGPAPR	77	sp|O60784-3|TOM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=12442	70.083	3	2574.2228	2574.2228	K	K	408	434
PSM	ALVLIAFAQYLQQCPFEDHVK	78	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	14-UNIMOD:4	ms_run[2]:scan=23071	151.56	3	2489.2777	2489.2777	K	L	45	66
PSM	APTVPPPLPPTPPQPAR	79	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:21	ms_run[2]:scan=12331	69.371	2	1811.9335	1811.9335	R	R	616	633
PSM	DPDAQPGGELMLGGTDSK	80	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:35	ms_run[2]:scan=9802	54.033	2	1802.7993	1802.7993	R	Y	236	254
PSM	EEAIEHNYGGHDDDLSVR	81	sp|Q93009-3|UBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=7970	43.641	2	2054.893	2054.8930	K	H	475	493
PSM	EPRPNSSPSPSPGQASETPHPRPS	82	sp|O00204-2|ST2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=4711	25.614	3	2575.1453	2575.1453	R	-	327	351
PSM	GPPSPPAPVMHSPSR	83	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5022	27.234	2	1608.712	1608.7120	R	K	221	236
PSM	HKSDSPESDAER	84	sp|O75400-2|PR40A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:21	ms_run[2]:scan=957	6.7798	2	1436.5569	1436.5569	R	E	854	866
PSM	HLEHAPSPSDVSNAPEVK	85	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=7954	43.547	2	1992.8942	1992.8942	K	A	439	457
PSM	HPEPVPEEGSEDELPPQVHK	86	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=9305	51.168	3	2329.0264	2329.0264	R	V	758	778
PSM	KKEPAITSQNSPEAR	87	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=2218	12.559	2	1734.8302	1734.8302	K	E	69	84
PSM	KPGDGEVSPSTEDAPFQHSPLGK	88	sp|O60318|GANP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	8-UNIMOD:21	ms_run[2]:scan=11789	65.975	3	2459.1006	2459.1006	K	A	520	543
PSM	KPSHTSAVSIAGK	89	sp|Q9HC35-2|EMAL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	9-UNIMOD:21	ms_run[2]:scan=2700	15.185	2	1361.6704	1361.6704	R	E	92	105
PSM	KVEEEEDESALKR	90	sp|Q14566|MCM6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3077	17.087	3	1560.7631	1560.7631	R	S	733	746
PSM	MGHAGAIIAGGK	91	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	1-UNIMOD:35	ms_run[2]:scan=2541	14.363	2	1097.5652	1097.5652	R	G	297	309
PSM	PFSPPIHSSSPPPIAPLAR	92	sp|Q9BQI5-4|SGIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=15105	87.78	3	2047.0292	2047.0292	R	A	285	304
PSM	RHSSPSSPTSPK	93	sp|O94921-3|CDK14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=744	5.9884	2	1346.598	1346.5980	R	F	71	83
PSM	RHSSTGDSADAGPPAAGSAR	94	sp|Q6ZU35|K1211_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=1504	9.1037	3	1946.8232	1946.8232	K	G	871	891
PSM	RHSVVAGGGGGEGR	95	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=839	6.3402	3	1374.6154	1374.6154	K	K	961	975
PSM	RKPSPEPEGEVGPPK	96	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=3945	21.499	2	1682.8029	1682.8029	K	I	341	356
PSM	RPASPSSPEHLPATPAESPAQR	97	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=7766	42.439	2	2362.1067	2362.1067	K	F	231	253
PSM	RRGDSESEEDEQDSEEVR	98	sp|Q9NZ63|TLS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=2560	14.461	3	2230.8612	2230.8612	R	L	11	29
PSM	SQDKLDKDDLEK	99	sp|Q14185|DOCK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3320	18.23	2	1432.7046	1432.7046	R	E	1681	1693
PSM	SRTHSTSSSLGSGESPFSR	100	sp|Q9UGV2-3|NDRG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	5-UNIMOD:21	ms_run[2]:scan=7892	43.196	3	2045.8804	2045.8804	R	S	238	257
PSM	SSWHQSSFHSTR	101	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=4469	24.309	2	1525.61	1525.6100	R	T	288	300
PSM	TIDLGAAAHYTGDKASPDQNASTHTPQSSVK	102	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	16-UNIMOD:21	ms_run[2]:scan=10360	57.318	3	3247.4783	3247.4783	K	T	266	297
PSM	YSEKEDKYEEEIK	103	sp|P67936-2|TPM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=5419	29.335	2	1688.7781	1688.7781	K	L	214	227
PSM	QPLLLSEDEEDTKR	104	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:28,6-UNIMOD:21	ms_run[1]:scan=13366	76.04225666666666	2	1734.7715	1734.7708	K	V	34	48
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	105	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	28-UNIMOD:21	ms_run[2]:scan=10025	55.368	3	3407.6452	3407.6452	R	N	215	246
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	106	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	28-UNIMOD:21	ms_run[2]:scan=10374	57.393	3	3407.6452	3407.6452	R	N	215	246
PSM	DADDAVYELDGK	107	sp|Q13243-3|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9469	52.095	2	1309.5674	1309.5674	R	E	46	58
PSM	DADDAVYELDGK	108	sp|Q13243-3|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10943	60.828	2	1309.5674	1309.5674	R	E	46	58
PSM	FHQLDIDDLQSIR	109	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=15659	91.706	2	1598.8053	1598.8053	R	A	59	72
PSM	GESAEDKEHEEGR	110	sp|Q7Z4V5-2|HDGR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=593	5.3959	2	1471.6175	1471.6175	K	D	611	624
PSM	GPPSPPAPVMHSPSR	111	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=8219	45.031	2	1592.7171	1592.7171	R	K	221	236
PSM	HIKEEPLSEEEPCTSTAIASPEK	112	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10322	57.095	3	2661.1881	2661.1881	K	K	495	518
PSM	HRTLTAEEAEEEWER	113	sp|P35269|T2FA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=11065	61.567	3	1964.8265	1964.8265	R	R	152	167
PSM	IGHHSTSDDSSAYR	114	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=1527	9.2152	3	1611.6315	1611.6315	R	S	333	347
PSM	IHEKDPNSATATAPPSPLK	115	sp|Q92766-6|RREB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	16-UNIMOD:21	ms_run[2]:scan=6285	34.091	3	2052.9881	2052.9881	K	R	146	165
PSM	KKEPAITSQNSPEAR	116	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	7-UNIMOD:21	ms_run[2]:scan=2024	11.55	2	1734.8302	1734.8302	K	E	69	84
PSM	KLDKENLSDER	117	sp|Q9BZI7-2|REN3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	8-UNIMOD:21	ms_run[2]:scan=3035	16.887	2	1425.6501	1425.6501	K	A	290	301
PSM	PTHHPVSSITGQDFSASTPK	118	sp|O94823|AT10B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	18-UNIMOD:21	ms_run[2]:scan=8470	46.458	3	2172.9841	2172.9841	R	S	1364	1384
PSM	RAAEDDEDDDVDTKK	119	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1553	9.3181	3	1720.7388	1720.7388	K	Q	89	104
PSM	RHTIASGVDCGLLK	120	sp|Q86UD0|SAPC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=9927	54.771	2	1605.7698	1605.7698	R	Q	217	231
PSM	RKGSDDAPYSPTAR	121	sp|O75151|PHF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=2853	15.92	2	1599.7042	1599.7042	K	V	896	910
PSM	RKSELAANLGLTER	122	sp|P47902-2|CDX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=10100	55.815	3	1636.8298	1636.8298	R	Q	48	62
PSM	RLSTSPDVIQGHQPR	123	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=6405	34.819	3	1769.8574	1769.8574	R	D	264	279
PSM	RPASVSSSAAVEHEQR	124	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21	ms_run[2]:scan=3146	17.439	3	1789.8108	1789.8108	K	E	237	253
PSM	RPDDVPLSLSPSKR	125	sp|Q9UFC0|LRWD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:21	ms_run[2]:scan=9380	51.604	3	1645.8189	1645.8189	K	A	234	248
PSM	RPTLGVQLDDKR	126	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=8592	47.204	3	1476.745	1476.7450	R	K	326	338
PSM	RSTVLGLPQHVQK	127	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=8457	46.386	3	1541.8079	1541.8079	R	E	160	173
PSM	RTPTMPQEEAAACPPHILPPEK	128	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=11018	61.29	3	2565.1757	2565.1757	R	R	1243	1265
PSM	RTPTMPQEEAAACPPHILPPEK	129	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12469	70.267	3	2549.1808	2549.1808	R	R	1243	1265
PSM	SIQEIQELDKDDESLRK	130	sp|P52565-2|GDIR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11522	64.339	2	2045.0277	2045.0277	K	Y	34	51
PSM	SLNSTPPPPPAPAPAPPPALAR	131	sp|Q8TE68-4|ES8L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	1-UNIMOD:21	ms_run[2]:scan=12374	69.638	2	2195.114	2195.1140	R	P	328	350
PSM	STAQQELDGKPASPTPVIVASHTANK	132	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:21	ms_run[2]:scan=9928	54.774	3	2726.3276	2726.3276	R	E	818	844
PSM	YHGHSMSDPGVSYR	133	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3561	19.444	2	1687.645	1687.6450	R	T	258	272
PSM	TYFPHFDLSHGSAQVK	134	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	12-UNIMOD:21	ms_run[1]:scan=14569	84.132355	2	1912.851528	1912.850914	K	G	42	58
PSM	GHLSRPEAQSLSPYTTSANR	135	sp|O94776|MTA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	10-UNIMOD:21	ms_run[1]:scan=8703	47.80805833333333	3	2251.044368	2251.038274	R	A	424	444
PSM	RANTLSHFPIECQEPPQPAR	136	sp|Q86TI0|TBCD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:21,12-UNIMOD:4	ms_run[1]:scan=11944	66.953275	3	2428.111804	2427.115479	R	G	593	613
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	137	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	26-UNIMOD:21	ms_run[2]:scan=6154	33.369	3	2864.2839	2864.2839	R	G	88	119
PSM	DLDDIEDENEQLK	138	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11617	64.911	2	1574.6948	1574.6948	R	Q	313	326
PSM	DQDKTDTLEHELR	139	sp|Q86VP1-3|TAXB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=7638	41.726	3	1598.7536	1598.7536	K	R	236	249
PSM	GESAEDKEHEEGRDSEEGPR	140	sp|Q7Z4V5-2|HDGR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:21	ms_run[2]:scan=1106	7.3653	3	2321.9034	2321.9034	K	C	611	631
PSM	GESAEDKEHEEGRDSEEGPR	141	sp|Q7Z4V5-2|HDGR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:21	ms_run[2]:scan=1127	7.4472	2	2321.9034	2321.9034	K	C	611	631
PSM	GSPSSHLLGADHGLR	142	sp|Q6NWY9-2|PR40B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21	ms_run[2]:scan=8467	46.443	3	1582.7253	1582.7253	R	K	750	765
PSM	HRPSEADEEELAR	143	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=4113	22.399	3	1617.6784	1617.6784	K	R	486	499
PSM	IGHHSTSDDSSAYR	144	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=1585	9.4848	2	1611.6315	1611.6315	R	S	333	347
PSM	IHEKDPNSATATAPPSPLK	145	sp|Q92766-6|RREB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:21	ms_run[2]:scan=6175	33.493	2	2052.9881	2052.9881	K	R	146	165
PSM	KFDHESSPGTDEDKSG	146	sp|Q13427|PPIG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	15-UNIMOD:21	ms_run[2]:scan=1615	9.6085	2	1814.6996	1814.6996	K	-	739	755
PSM	KKEPAITSQNSPEAR	147	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=1894	10.93	3	1734.8302	1734.8302	K	E	69	84
PSM	KLHVSTINLQK	148	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=9213	50.673	2	1359.7276	1359.7276	K	A	1257	1268
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	149	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	7-UNIMOD:21	ms_run[2]:scan=13066	74.1	3	2662.3156	2662.3156	K	K	763	788
PSM	KQPPVSPGTALVGSQKEPSEVPTPK	150	sp|P17096|HMGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:21	ms_run[2]:scan=10947	60.852	3	2637.3415	2637.3415	R	R	31	56
PSM	KREPEDEGEDDD	151	sp|P39687|AN32A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=759	6.0442	2	1432.559	1432.5590	R	-	238	250
PSM	LEQPEEDKYSKPTAPAPSAPPSPSAPEPPK	152	sp|P55198|AF17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	22-UNIMOD:21	ms_run[2]:scan=9454	52.01	3	3221.517	3221.5170	K	A	361	391
PSM	LKDLFDYSPPLHK	153	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=15129	87.929	2	1651.8011	1651.8011	K	N	503	516
PSM	LKDLFDYSPPLHK	154	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=15437	89.952	2	1651.8011	1651.8011	K	N	503	516
PSM	LKDQDQDEDEEEKEK	155	sp|P35269|T2FA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=954	6.7687	3	1876.8174	1876.8174	R	R	182	197
PSM	NQTAEKEEFEHQQK	156	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2036	11.608	2	1744.8016	1744.8016	K	E	584	598
PSM	NVGERSPDQSEHTDGHTSVQSVIEK	157	sp|Q8NFZ5-2|TNIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=7214	39.42	3	2815.241	2815.2410	R	L	74	99
PSM	PGAEGAPLLPPPLPPPSPPGSGR	158	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	17-UNIMOD:21	ms_run[2]:scan=16445	97.644	2	2237.1246	2237.1246	R	G	27	50
PSM	PRPPQSSTGSTASPPVSTPVTGHK	159	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:21	ms_run[2]:scan=6827	37.293	3	2452.1748	2452.1748	K	R	139	163
PSM	RAAEDDEDDDVDTK	160	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1405	8.6573	2	1592.6438	1592.6438	K	K	89	103
PSM	REEEEEDAFEDEKPPK	161	sp|Q01831-3|XPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6790	37.098	3	1975.8647	1975.8647	R	K	29	45
PSM	RHNSASVENVSLR	162	sp|Q9Y4H2|IRS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=5632	30.455	3	1547.7206	1547.7206	K	K	1171	1184
PSM	RHSMENMELMK	163	sp|P81274|GPSM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,4-UNIMOD:35,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=1072	7.2332	2	1532.5823	1532.5823	R	L	406	417
PSM	RKPEDVLDDDDAGSAPLK	164	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:21	ms_run[2]:scan=9963	54.978	3	2019.915	2019.9150	R	S	140	158
PSM	RKPSPEPEGEVGPPK	165	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=4137	22.51	2	1682.8029	1682.8029	K	I	341	356
PSM	RLSSTSSEETQLFHIPR	166	sp|Q8N271-3|PROM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=14703	85.057	3	2066.9786	2066.9786	K	V	338	355
PSM	RPAGSVQNPVYHNQPLNPAPSR	167	sp|P00533|EGFR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=9043	49.73	3	2478.1918	2478.1918	K	D	1100	1122
PSM	RRASQEANLLTLAQK	168	sp|Q6PJG2|EMSA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=11535	64.411	3	1777.92	1777.9200	R	A	458	473
PSM	RRPSGSEQSDNESVQSGR	169	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=970	6.8322	3	2054.8767	2054.8767	K	S	1094	1112
PSM	RSPALHGTPTAGCGSR	170	sp|Q8IY92-2|SLX4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=2834	15.841	2	1703.7563	1703.7563	R	G	271	287
PSM	RVQRPEDASGGSSPSGTSK	171	sp|Q9UI08-4|EVL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=1040	7.1062	2	1981.8855	1981.8855	R	S	234	253
PSM	SHVSSEPYEPISPPQVPVVHEK	172	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	12-UNIMOD:21	ms_run[2]:scan=13481	76.826	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SLSSGESGPGSPTHSHSLSPR	173	sp|Q6P0Q8-2|MAST2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=5714	30.926	2	2142.9331	2142.9331	R	S	1161	1182
PSM	VIPAKSPPPPTHSTQLGAPSR	174	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:21	ms_run[2]:scan=6728	36.755	2	2217.1307	2217.1307	K	K	200	221
PSM	RAAEDDEDDDVDTKK	175	sp|P06454|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1633	9.687735	3	1723.731329	1720.738767	K	Q	90	105
PSM	THDHQLESSLSPVEVFAK	176	sp|Q9H410|DSN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	11-UNIMOD:21	ms_run[1]:scan=14654	84.70693	3	2103.971028	2102.967401	K	T	20	38
PSM	GSGKRPAAAAAAGSASPR	177	sp|Q96S55|WRIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	16-UNIMOD:21	ms_run[1]:scan=1191	7.713351666666666	3	1661.800610	1661.799882	K	S	138	156
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	178	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=15035	87.27555	3	3442.4043	3442.4027	K	L	104	135
PSM	ASHLRPPSPLLVR	179	sp|Q8TDB6|DTX3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,8-UNIMOD:21	ms_run[1]:scan=14162	81.35622	2	1563.8286	1563.8281	M	V	2	15
PSM	NAIHTFVQSGSHLAAR	180	sp|P04040|CATA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	9-UNIMOD:21	ms_run[1]:scan=10323	57.098305	2	1787.859425	1787.846832	K	E	507	523
PSM	AHSLMELSPSAPPGGSPHLDSSR	181	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=10109	55.877	3	2425.0733	2425.0733	K	S	593	616
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	182	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	28-UNIMOD:21	ms_run[2]:scan=10544	58.404	3	3407.6452	3407.6452	R	N	215	246
PSM	AQHEDQVEQYKK	183	sp|P02545-5|LMNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=1509	9.1225	2	1501.7161	1501.7161	R	E	151	163
PSM	ARPSSPSTSWHR	184	sp|Q3KQU3-3|MA7D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=3505	19.088	2	1447.6358	1447.6358	K	P	11	23
PSM	DKDDDEVFEKK	185	sp|Q04637-6|IF4G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3353	18.371	2	1366.6252	1366.6252	K	Q	658	669
PSM	DKEVSDDEAEEK	186	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=1241	7.9098	2	1472.5556	1472.5556	R	E	227	239
PSM	DRSSPPPGYIPDELHQVAR	187	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=12977	73.539	3	2213.0266	2213.0266	R	N	161	180
PSM	DRTPPHLLYSDR	188	sp|Q8NDT2-2|RB15B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=8837	48.583	3	1548.7086	1548.7086	R	D	203	215
PSM	FQHGVIAAVDSR	189	sp|P28062-2|PSB8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=8019	43.938	2	1298.6731	1298.6731	K	A	76	88
PSM	FVQDHFDHNISPTIGASFMTK	190	sp|Q13636|RAB31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=14376	82.806	3	2487.093	2487.0930	R	T	25	46
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	191	sp|P42167|LAP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=12302	69.197	3	2649.1708	2649.1708	K	S	61	87
PSM	GPPSPPAPVMHSPSR	192	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5405	29.262	2	1608.712	1608.7120	R	K	221	236
PSM	GPPSPPAPVMHSPSR	193	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5526	29.905	3	1608.712	1608.7120	R	K	221	236
PSM	GPPSPPAPVMHSPSR	194	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=7859	43.001	2	1592.7171	1592.7171	R	K	221	236
PSM	HPPVLTPPDQEVIR	195	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=12274	69.025	3	1676.8287	1676.8287	R	N	636	650
PSM	HRPSPPATPPPK	196	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1829	10.61	2	1440.6316	1440.6316	R	T	399	411
PSM	IGHHSTSDDSSAYR	197	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=1756	10.269	3	1611.6315	1611.6315	R	S	333	347
PSM	ILIASPSPTHIHK	198	sp|Q16665-2|HIF1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=9003	49.529	2	1492.7803	1492.7803	K	E	637	650
PSM	IPSAPVIPTHQASVTTERPK	199	sp|Q9BZF2-2|OSBL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=10724	59.495	3	2208.1304	2208.1304	R	K	224	244
PSM	KADRDQSPFSK	200	sp|Q13427|PPIG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=1588	9.4944	2	1357.6027	1357.6027	K	I	681	692
PSM	KADRDQSPFSK	201	sp|Q13427|PPIG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=1803	10.49	2	1357.6027	1357.6027	K	I	681	692
PSM	KHPDASVNFSEFSK	202	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:21	ms_run[2]:scan=10922	60.705	2	1671.7294	1671.7294	K	K	30	44
PSM	KHPGGGESDASPEAGSGGGGVALK	203	sp|Q9UHI5|LAT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:21	ms_run[2]:scan=4721	25.666	3	2200.975	2200.9750	K	K	14	38
PSM	KKEPAITSQNSPEAR	204	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=2102	11.944	3	1734.8302	1734.8302	K	E	69	84
PSM	KPLTSSSAAPQRPISTQR	205	sp|Q15691|MARE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=5142	27.871	2	2004.0154	2004.0154	K	T	151	169
PSM	KPTSAKPSSTTPR	206	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=635	5.5659	2	1436.7025	1436.7025	K	L	634	647
PSM	KQDFDEDDILK	207	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10703	59.366	2	1364.646	1364.6460	K	E	50	61
PSM	KRPTSTSSSPETPEFSTFR	208	sp|A8MVS5|HIDE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=10994	61.144	3	2221.0052	2221.0052	R	A	209	228
PSM	NKPGPNIESGNEDDDASFK	209	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21	ms_run[2]:scan=8307	45.511	2	2112.8637	2112.8637	K	I	206	225
PSM	PHSPLSAHAGNSPQDSPR	210	sp|O15021-2|MAST4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=3300	18.143	2	1933.8432	1933.8432	R	N	52	70
PSM	RAPSVANVGSHCDLSLK	211	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9822	54.16	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RDSLQKPGLEAPPR	212	sp|Q9NRM7|LATS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=7038	38.467	3	1642.8192	1642.8192	R	A	378	392
PSM	RESPSPAPKPR	213	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=1108	7.3722	2	1300.6289	1300.6289	K	K	448	459
PSM	RGAEESGPPHSPSR	214	sp|P15692-18|VEGFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=955	6.7725	3	1542.6576	1542.6576	R	R	152	166
PSM	RGEGDAPFSEPGTTSTQRPSSPETATK	215	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	20-UNIMOD:21	ms_run[2]:scan=7793	42.586	3	2870.272	2870.2720	R	Q	303	330
PSM	RKASEEIEDFR	216	sp|Q96FT9-3|IFT43_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=7672	41.881	2	1458.6504	1458.6504	R	L	75	86
PSM	RKPEDVLDDDDAGSAPLK	217	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=10327	57.118	3	2019.915	2019.9150	R	S	140	158
PSM	RKPSVPDSASPADDSFVDPGER	218	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:21	ms_run[2]:scan=10336	57.169	3	2408.0645	2408.0645	K	L	18	40
PSM	RKSFDASDTLALPR	219	sp|Q5JXC2|MIIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=11519	64.319	3	1655.8032	1655.8032	R	H	301	315
PSM	RLSKPPFQTNPSPEMVSK	220	sp|Q4LE39-4|ARI4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=9227	50.745	3	2138.0231	2138.0231	R	L	345	363
PSM	RLSTSPDVIQGHQPR	221	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=7347	40.149	3	1769.8574	1769.8574	R	D	264	279
PSM	RPASVSSSAAVEHEQR	222	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=3188	17.621	2	1789.8108	1789.8108	K	E	237	253
PSM	RPDDVPLSLSPSKR	223	sp|Q9UFC0|LRWD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:21	ms_run[2]:scan=9198	50.595	3	1645.8189	1645.8189	K	A	234	248
PSM	RRPSGSEQSDNESVQSGR	224	sp|Q6PD62|CTR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=980	6.868	2	2054.8767	2054.8767	K	S	1094	1112
PSM	RRSDLYESELR	225	sp|O14578-3|CTRO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=7292	39.857	3	1502.6879	1502.6879	R	E	113	124
PSM	RRTVDEDPDER	226	sp|P17544-4|ATF7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=1250	7.9475	3	1466.6151	1466.6151	R	R	148	159
PSM	RSSPPGHYYQK	227	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=2000	11.425	2	1398.6082	1398.6082	R	S	121	132
PSM	RTPTMPQEEAAACPPHILPPEK	228	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=10847	60.278	3	2565.1757	2565.1757	R	R	1243	1265
PSM	RVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR	229	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=13241	75.265	3	3354.647	3354.6470	R	-	861	894
PSM	RVSHQGYSTEAEFEEPR	230	sp|P30533|AMRP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=8458	46.389	3	2100.8902	2100.8902	R	V	240	257
PSM	SAPTAPTPPPPPPPATPR	231	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=8545	46.931	2	1827.892	1827.8921	R	K	799	817
PSM	SHVSSEPYEPISPPQVPVVHEK	232	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:21	ms_run[2]:scan=13640	77.831	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SLGVDMDDKDDAHYAVQAR	233	sp|Q9BZE4-3|NOG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10021	55.349	3	2104.9484	2104.9484	R	R	410	429
PSM	TGSGGPGNHPHGPDASAEGLNPYGLVAPR	234	sp|Q86UX7-2|URP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:21	ms_run[2]:scan=14124	81.096	3	2861.2882	2861.2882	R	F	478	507
PSM	TPKDSPGIPPSANAHQLFR	235	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=11948	66.982	3	2112.0154	2112.0154	K	G	365	384
PSM	VNVDEVGGEALGR	236	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10858	60.347	2	1313.6575	1313.6575	K	L	19	32
PSM	YDERPGPSPLPHR	237	sp|P08621-4|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:21	ms_run[2]:scan=5585	30.223	3	1599.7195	1599.7195	R	D	123	136
PSM	QSPLTYEDHGAPFAGHLPR	238	sp|Q9Y618|NCOR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,2-UNIMOD:21	ms_run[1]:scan=15241	88.67768333333333	3	2154.9524	2154.9519	R	G	1538	1557
PSM	QERLSPEVAPPAHR	239	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=8220	45.03404666666667	2	1648.7716	1648.7717	K	R	31	45
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	240	sp|Q0ZGT2|NEXN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	11-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=5719	30.953595	3	3008.1702	3007.1872	K	S	554	579
PSM	KWSNSQPADLAHMGR	241	sp|Q9BRG2|SH23A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	5-UNIMOD:21,13-UNIMOD:35	ms_run[1]:scan=7267	39.728415000000005	3	1792.768053	1792.771618	R	S	143	158
PSM	QPYPSRPPFDNQHSQDLDSR	242	sp|Q07157|ZO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=11778	65.90479166666667	3	2446.0342	2446.0334	K	Q	1098	1118
PSM	RKGSDDAPYSPTAR	243	sp|O75151|PHF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:21	ms_run[1]:scan=2928	16.301021666666667	2	1599.704589	1599.704250	K	V	896	910
PSM	RLSTSPDVIQGHQPR	244	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:21	ms_run[1]:scan=8105	44.39597333333333	2	1770.840432	1769.857397	R	D	264	279
PSM	AAPPPPPPPPPLESSPR	245	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:21	ms_run[2]:scan=10059	55.547	3	1782.8706	1782.8706	K	V	606	623
PSM	ADEASEGDSPAPARPEDTPPAPPPPPAR	246	sp|Q6PJ61|FBX46_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=8838	48.585	3	2871.2712	2871.2712	R	D	330	358
PSM	APEPHVEEDDDDELDSK	247	sp|P52566|GDIR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=6858	37.459	3	1938.7967	1938.7967	K	L	5	22
PSM	APTVPPPLPPTPPQPAR	248	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=12638	71.385	2	1811.9335	1811.9335	R	R	616	633
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	249	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=11474	64.036	3	2956.4332	2956.4332	K	L	117	144
PSM	ATGNDLRPPPPSPSSDLTHPMK	250	sp|Q9P275|UBP36_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	12-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=8793	48.311	3	2410.0988	2410.0988	R	T	702	724
PSM	DFDHHDSPALEVFTEQPPSPLPK	251	sp|Q92545|TM131_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	19-UNIMOD:21	ms_run[2]:scan=17031	102.25	3	2682.2003	2682.2003	K	S	1357	1380
PSM	DGLHFLPHASSSAQSPCGSPGMK	252	sp|Q3V6T2-5|GRDN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:4,19-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=11306	62.99	3	2463.0348	2463.0348	R	R	219	242
PSM	DMESPTKLDVTLAK	253	sp|P27816-5|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=11027	61.347	2	1642.7525	1642.7525	K	D	277	291
PSM	DRDDFPVVLVGNK	254	sp|P10301|RRAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13909	79.621	2	1472.7623	1472.7623	K	A	131	144
PSM	EKEISDDEAEEEKGEK	255	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=2943	16.361	2	1943.7885	1943.7885	R	E	222	238
PSM	ERDHSPTPSVFNSDEER	256	sp|Q6UN15-3|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=7264	39.713	2	2080.8487	2080.8487	R	Y	414	431
PSM	GPPSPPAPVMHSPSR	257	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5141	27.869	3	1608.712	1608.7120	R	K	221	236
PSM	HLTPPQGNSPHSNER	258	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=2589	14.606	3	1749.7584	1749.7584	R	K	574	589
PSM	HPEPVPEEGSEDELPPQVHKV	259	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=11123	61.919	3	2428.0948	2428.0948	R	-	758	779
PSM	HPEPVPEEGSEDELPPQVHKV	260	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=11583	64.712	3	2428.0948	2428.0948	R	-	758	779
PSM	HPHDIIDDINSGAVECPAS	261	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:4	ms_run[2]:scan=13500	76.95	2	2045.9113	2045.9113	R	-	114	133
PSM	HRSSISGSLPSSGSLQAVSSR	262	sp|Q9BXF6|RFIP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=10667	59.156	2	2179.0383	2179.0383	R	F	354	375
PSM	IACRSPQPDPVGTPTIFKPQSK	263	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:4,5-UNIMOD:21	ms_run[2]:scan=12070	67.733	3	2503.2294	2503.2294	K	R	1859	1881
PSM	IGEEQSPEDAEDGPPELLFIHGGHTAK	264	sp|Q09028-4|RBBP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=16280	96.382	3	2952.3179	2952.3179	K	I	315	342
PSM	IYHLPDAESDEDEDFKEQTR	265	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=12306	69.217	3	2516.0381	2516.0381	K	L	210	230
PSM	KEDEHVVASDADLDAK	266	sp|Q05084-3|ICA69_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=5365	29.028	3	1740.8166	1740.8166	K	L	43	59
PSM	KGDRSPEPGQTWTR	267	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=4560	24.791	3	1693.7573	1693.7573	R	E	89	103
PSM	KHSMLFIEASAK	268	sp|Q9NP72-3|RAB18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=10398	57.556	2	1440.6836	1440.6836	R	T	78	90
PSM	KHVTTAEGTPGTTDQEGPPPDGPPEK	269	sp|O14497-3|ARI1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=5043	27.365	3	2722.2123	2722.2123	R	R	1497	1523
PSM	KKDELSDYAEK	270	sp|P46100-6|ATRX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=4614	25.052	2	1404.6174	1404.6174	K	S	988	999
PSM	KKEPAITSQNSPEAR	271	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=1817	10.551	2	1734.8302	1734.8302	K	E	69	84
PSM	KKEPAITSQNSPEAR	272	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=2804	15.697	3	1734.8302	1734.8302	K	E	69	84
PSM	KKPGDASSLPDAGLSPGSQVDSK	273	sp|Q13459-2|MYO9B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:21	ms_run[2]:scan=9192	50.558	3	2320.0948	2320.0948	K	S	1391	1414
PSM	KLSVPTSDEEDEVPAPKPR	274	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=10005	55.25	3	2173.0304	2173.0304	K	G	103	122
PSM	KPLAHYSSLVR	275	sp|Q14596-2|NBR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=8270	45.311	2	1349.6857	1349.6857	K	V	109	120
PSM	KPSPEPEGEVGPPK	276	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=5075	27.534	2	1526.7018	1526.7018	R	I	342	356
PSM	KRSPSPSPTPEAK	277	sp|Q8TAQ2-2|SMRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=984	6.8876	2	1460.7025	1460.7025	R	K	300	313
PSM	KRSPTESVNTPVGK	278	sp|Q8WXG6-6|MADD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=2921	16.27	2	1578.7767	1578.7767	R	D	994	1008
PSM	KTPELGIVPPPPIPR	279	sp|Q8TEH3-7|DEN1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=15452	90.059	2	1689.9219	1689.9219	R	P	707	722
PSM	LKDLFDYSPPLHK	280	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:21	ms_run[2]:scan=14986	86.925	2	1651.8011	1651.8011	K	N	503	516
PSM	LSVHDMKPLDSPGR	281	sp|Q15643|TRIPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=5634	30.462	2	1646.7488	1646.7488	K	R	1881	1895
PSM	PLPTLEVKPPDRPSSK	282	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:21	ms_run[2]:scan=11775	65.885	2	1839.9496	1839.9496	R	S	729	745
PSM	PRPPQSSTGSTASPPVSTPVTGHK	283	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=5322	28.774	3	2452.1748	2452.1748	K	R	139	163
PSM	QSLGHGQHGSGSGQSPSPSR	284	sp|Q86YZ3|HORN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=927	6.6543	2	2026.8606	2026.8606	R	G	992	1012
PSM	RAAEDDEDDDVDTKK	285	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1321	8.2575	3	1720.7388	1720.7388	K	Q	89	104
PSM	RASPSKPASAPASR	286	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=809	6.2286	2	1461.7089	1461.7089	K	S	512	526
PSM	RATVVVGDLHPLR	287	sp|Q9NSI2-2|F207A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=11203	62.398	2	1511.7974	1511.7974	R	D	121	134
PSM	RGESLDNLDSPR	288	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=7345	40.136	2	1437.6249	1437.6249	R	S	1173	1185
PSM	RGILLEDGSESPAKR	289	sp|Q08999-2|RBL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=7713	42.129	3	1706.8353	1706.8353	K	I	481	496
PSM	RKPSPEPEGEVGPPK	290	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=4326	23.515	2	1682.8029	1682.8029	K	I	341	356
PSM	RKPSPEPEGEVGPPK	291	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=4554	24.759	2	1682.8029	1682.8029	K	I	341	356
PSM	RLSTSPDVIQGHQPR	292	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=8025	43.972	3	1769.8574	1769.8574	R	D	264	279
PSM	RPAEATSSPTSPERPR	293	sp|Q9BU76|MMTA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	11-UNIMOD:21	ms_run[2]:scan=1976	11.313	3	1817.8421	1817.8421	R	H	210	226
PSM	RPDDVPLSLSPSKR	294	sp|Q9UFC0|LRWD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=9231	50.763	2	1645.8189	1645.8189	K	A	234	248
PSM	RPILQLSPPGPR	295	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=13040	73.932	2	1409.7544	1409.7544	R	G	12	24
PSM	RPMEEDGEEKSPSK	296	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=656	5.6472	2	1713.6917	1713.6917	K	K	372	386
PSM	RQVSASELHTSGILGPETLR	297	sp|P58107|EPIPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=13883	79.469	3	2230.1107	2230.1107	R	D	2715	2735
PSM	RSSLPLDHGSPAQENPESEK	298	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=7462	40.764	3	2257.0012	2257.0012	R	S	1276	1296
PSM	RTPTMPQEEAAACPPHILPPEK	299	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=11188	62.3	3	2565.1757	2565.1757	R	R	1243	1265
PSM	SHTSEGAHLDITPNSGAAGNSAGPK	300	sp|Q92597-3|NDRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=7762	42.416	3	2455.0765	2455.0765	R	S	283	308
PSM	SLGVDMDDKDDAHYAVQAR	301	sp|Q9BZE4-3|NOG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:35	ms_run[2]:scan=7950	43.528	3	2120.9433	2120.9433	R	R	410	429
PSM	TPKDSPGIPPSANAHQLFR	302	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=11450	63.888	2	2112.0154	2112.0154	K	G	365	384
PSM	VIPAKSPPPPTHSTQLGAPSR	303	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=6757	36.926	3	2217.1307	2217.1307	K	K	200	221
PSM	WAHDKFSGEEGEIEDDESGTENR	304	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=11121	61.907	3	2716.0562	2716.0562	K	E	922	945
PSM	YSPSQNSPIHHIPSR	305	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=6910	37.724	2	1798.8152	1798.8152	R	R	282	297
PSM	SPSPPLPTHIPPEPPR	306	sp|Q8IZ21|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21	ms_run[1]:scan=12152	68.24919833333333	3	1797.882174	1797.881486	R	T	342	358
PSM	KSPTMEQAVQTASAHLPAPAAVGR	307	sp|Q8ND56|LS14A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:21,5-UNIMOD:35	ms_run[1]:scan=12055	67.651315	3	2513.213192	2513.209774	R	R	191	215
PSM	AVSETPAVPPVSEDEDDDDDDATPPPVIAPRPEHTK	308	sp|Q13153|PAK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	12-UNIMOD:21	ms_run[1]:scan=12821	72.56877833333333	3	3887.725429	3887.726234	K	S	163	199
PSM	QPYPSRPPFDNQHSQDLDSR	309	sp|Q07157|ZO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=11938	66.917	3	2446.0339	2446.0334	K	Q	1098	1118
PSM	HHNSTAELQK	310	sp|P33527|MRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	4-UNIMOD:21	ms_run[1]:scan=942	6.721351666666666	2	1243.5351	1243.5341	R	A	927	937
PSM	KHSMLFIEASAK	311	sp|Q9NP72|RAB18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=7501	40.97294333333333	2	1456.675539	1456.678553	R	T	142	154
PSM	APAASEGNHTDGAEEAAGSCAQAPSHSPPNKPK	312	sp|Q92560|BAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	20-UNIMOD:4,27-UNIMOD:21	ms_run[1]:scan=4795	26.051375	3	3320.415714	3320.415362	R	L	301	334
PSM	ASPPPQGPLPGPPGALHR	313	sp|Q96G74|OTUD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	2-UNIMOD:21	ms_run[1]:scan=10972	60.999318333333335	2	1824.907549	1824.903619	R	W	63	81
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	314	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=10880	60.474333333333334	3	2911.296259	2908.307590	R	P	132	161
PSM	AFKPEETSSNSDPPSPPVLNNSHPVPR	315	sp|O60293|ZC3H1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	15-UNIMOD:21	ms_run[1]:scan=11428	63.76860166666667	3	2980.361189	2979.376381	R	S	641	668
PSM	AGSEKDDDSFNLHNSNSTHQER	316	sp|Q86WP2-4|GPBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=4771	25.927	3	2567.031	2567.0310	R	D	149	171
PSM	ARHDSPDLAPNVTYSLPR	317	sp|Q9BRD0|BUD13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=12909	73.102	3	2087.979	2087.9790	R	T	267	285
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	318	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=7963	43.599	3	2465.0431	2465.0431	R	A	90	114
PSM	DADDAVYELNGK	319	sp|Q13247-2|SRSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9703	53.466	2	1308.5834	1308.5834	R	E	47	59
PSM	DAVEDLESVGK	320	sp|P81605|DCD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12422	69.958	2	1160.5561	1160.5561	K	G	86	97
PSM	DEGNYLDDALVR	321	sp|P09525-2|ANXA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=14526	83.845	2	1378.6365	1378.6365	R	Q	79	91
PSM	DKRPLSGPDVGTPQPAGLASGAK	322	sp|O96013|PAK4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=9744	53.708	3	2298.1369	2298.1369	R	L	176	199
PSM	EATKFEEEEKPDK	323	sp|Q5JSZ5|PRC2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2605	14.682	2	1578.7413	1578.7413	R	A	1016	1029
PSM	EKEEEEEEKPK	324	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=598	5.4137	2	1402.6464	1402.6464	K	R	183	194
PSM	EKEISDDEAEEEK	325	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=3003	16.707	2	1629.6295	1629.6295	R	G	222	235
PSM	ERDHSPTPSVFNSDEER	326	sp|Q6UN15-3|FIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=7756	42.37	3	2080.8487	2080.8487	R	Y	414	431
PSM	ESEDKPEIEDVGSDEEEEK	327	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=8135	44.547	2	2271.8792	2271.8792	K	K	251	270
PSM	FTDEEVDELYR	328	sp|P19105|ML12A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=13305	75.656	2	1414.6252	1414.6252	R	E	133	144
PSM	GCGFPVGEHSPHSR	329	sp|Q9Y4B5-4|MTCL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=5036	27.325	2	1602.6399	1602.6399	R	V	93	107
PSM	GDDQLELIKDDEK	330	sp|P07910-3|HNRPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10066	55.588	2	1516.7257	1516.7257	R	E	196	209
PSM	GRPPAEKLSPNPPK	331	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=4234	23.009	2	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPNLTK	332	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=8048	44.109	3	1894.9666	1894.9666	R	K	1411	1428
PSM	HGGSPQPLATTPLSQEPVNPPSEASPTR	333	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,27-UNIMOD:21	ms_run[2]:scan=13361	76.015	3	3011.3427	3011.3427	R	D	374	402
PSM	HLEHAPSPSDVSNAPEVK	334	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=8080	44.27	3	1992.8942	1992.8942	K	A	439	457
PSM	HPEPVPEEGSEDELPPQVHKV	335	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=11405	63.619	3	2428.0948	2428.0948	R	-	758	779
PSM	HRPSEADEEELAR	336	sp|O14617-3|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=4139	22.517	2	1617.6784	1617.6784	K	R	486	499
PSM	HSPAPPPDPGFPAPSPPPADSPSEGFSLK	337	sp|Q6ZSZ5-2|ARHGI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=15784	92.603	3	2959.343	2959.3430	R	A	952	981
PSM	HSPQHTTTLSLSTLATPK	338	sp|P52799|EFNB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=11722	65.569	3	1998.9776	1998.9776	K	R	259	277
PSM	HSTPHAAFQPNSQIGEEMSQNSFIK	339	sp|Q9UKV3-5|ACINU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21,18-UNIMOD:35	ms_run[2]:scan=12547	70.828	3	2880.2538	2880.2538	K	Q	114	139
PSM	IHSLTHLDSVTK	340	sp|P46736-4|BRCC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=8738	47.999	2	1429.6966	1429.6966	R	I	136	148
PSM	KAEGEPQEESPLK	341	sp|Q9NYF8-2|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=3597	19.614	2	1520.676	1520.6760	K	S	166	179
PSM	KHPDSSVNFAEFSK	342	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=10453	57.867	2	1671.7294	1671.7294	K	K	30	44
PSM	KKEPAITSQNSPEAR	343	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=2771	15.555	2	1734.8302	1734.8302	K	E	69	84
PSM	KKPTPVLLPQSK	344	sp|Q9UGP8|SEC63_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=5874	31.826	2	1414.7949	1414.7949	K	Q	534	546
PSM	KMEDSVGCLETAEEVKR	345	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:35,8-UNIMOD:4	ms_run[2]:scan=8127	44.514	3	1995.9241	1995.9241	K	K	1372	1389
PSM	KRESESESDETPPAAPQLIK	346	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=9591	52.819	2	2291.0682	2291.0682	R	K	448	468
PSM	KSTPKEETVNDPEEAGHR	347	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21	ms_run[2]:scan=2437	13.775	3	2102.927	2102.9270	K	S	536	554
PSM	LKDLFDYSPPLHK	348	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=15568	90.96	2	1651.8011	1651.8011	K	N	503	516
PSM	PGQHPAASPTHPSAIR	349	sp|P33176|KINH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=3184	17.602	2	1702.7941	1702.7941	R	G	926	942
PSM	RAAEDDEDDDVDTKK	350	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1399	8.6292	2	1720.7388	1720.7388	K	Q	89	104
PSM	RAAEDDEDDDVDTKK	351	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2123	12.046	3	1720.7388	1720.7388	K	Q	89	104
PSM	RAPSSPVAKPGPVK	352	sp|Q9GZR2-2|REXO4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=2608	14.699	2	1469.7756	1469.7756	K	T	11	25
PSM	RESPSPAPKPR	353	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=836	6.3335	2	1300.6289	1300.6289	K	K	448	459
PSM	RGLLYDSDEEDEERPAR	354	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=9186	50.526	2	2128.9063	2128.9063	R	K	133	150
PSM	RHSFATEGAGAVENFAAAR	355	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=13302	75.641	3	2040.9167	2040.9167	K	Q	409	428
PSM	RHSMENMELMK	356	sp|P81274|GPSM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,4-UNIMOD:35,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=1071	7.2297	3	1532.5823	1532.5823	R	L	406	417
PSM	RHSMENMELMK	357	sp|P81274|GPSM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,4-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=2786	15.619	2	1516.5874	1516.5874	R	L	406	417
PSM	RHSVTLPSSK	358	sp|Q07352|TISB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=3032	16.877	2	1190.5809	1190.5809	R	F	52	62
PSM	RKELEEVSPETPVVPATTQR	359	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=9996	55.188	3	2345.1628	2345.1628	R	T	142	162
PSM	RKPEDVLDDDDAGSAPLK	360	sp|P35613-3|BASI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=10132	56.007	3	2019.915	2019.9150	R	S	140	158
PSM	RKPSPEPEGEVGPPK	361	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=4172	22.675	3	1682.8029	1682.8029	K	I	341	356
PSM	RKPSVPDSASPADDSFVDPGER	362	sp|P16333-2|NCK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=10570	58.563	3	2408.0645	2408.0645	K	L	18	40
PSM	RKSELEFETLK	363	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=9843	54.267	2	1458.712	1458.7120	K	T	235	246
PSM	RKTFVSDLLPPTDK	364	sp|Q7Z4Q2-3|HEAT3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=13021	73.81	3	1695.8597	1695.8597	R	E	252	266
PSM	RLSTSPDVIQGHQPR	365	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=7164	39.141	3	1769.8574	1769.8574	R	D	264	279
PSM	RLSTSPDVIQGHQPR	366	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=7534	41.155	3	1769.8574	1769.8574	R	D	264	279
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	367	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=8855	48.692	3	2602.1925	2602.1925	R	F	118	143
PSM	RQNSGDSHLGGGPAATAGGPR	368	sp|Q8N228-3|SCML4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=3760	20.49	3	2041.9079	2041.9079	K	T	242	263
PSM	RRTTQIINITMTK	369	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=8431	46.244	3	1670.8539	1670.8539	R	K	673	686
PSM	RSSKEEAEMAYK	370	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1348	8.3887	2	1523.6327	1523.6327	K	D	733	745
PSM	RTPTMPQEEAAACPPHILPPEK	371	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12623	71.297	3	2549.1808	2549.1808	R	R	1243	1265
PSM	SHSPVPAAAPAHSPSPASPR	372	sp|Q2KJY2-2|KI26B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=4804	26.1	3	1999.9265	1999.9265	R	S	621	641
PSM	SHTLLSPSPKPK	373	sp|P51787-2|KCNQ1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=4633	25.142	2	1370.6959	1370.6959	R	K	275	287
PSM	SHTLLSPSPKPK	374	sp|P51787-2|KCNQ1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=4655	25.272	3	1370.6959	1370.6959	R	K	275	287
PSM	SPSPPLPTHIPPEPPR	375	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=12618	71.269	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPTQHTGQPPGQPSAPSQLSAPR	376	sp|Q68EM7-7|RHG17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=9144	50.303	3	2686.2501	2686.2501	R	R	207	233
PSM	SSSDPPAVHPPLPPLR	377	sp|O43150|ASAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=13144	74.607	2	1745.8502	1745.8502	R	V	820	836
PSM	SSSVSLTHHVGLR	378	sp|Q13370-2|PDE3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=7916	43.334	2	1458.698	1458.6980	R	R	442	455
PSM	SSVVSPSHPPPAPPLGSPPGPK	379	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=11447	63.874	3	2168.0667	2168.0667	R	P	292	314
PSM	SSVVSPSHPPPAPPLGSPPGPK	380	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=11612	64.889	3	2168.0667	2168.0667	R	P	292	314
PSM	SSVVSPSHPPPAPPLGSPPGPK	381	sp|Q9Y6W5|WASF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:21	ms_run[2]:scan=11524	64.351	2	2168.0667	2168.0667	R	P	292	314
PSM	THDHQLESSLSPVEVFAK	382	sp|Q9H410-4|DSN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=14688	84.947	2	2102.9674	2102.9674	K	T	4	22
PSM	TPKDSPGIPPSANAHQLFR	383	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=11128	61.945	3	2112.0154	2112.0154	K	G	365	384
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	384	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	22-UNIMOD:21	ms_run[2]:scan=16625	99.016	3	2618.3622	2618.3622	R	S	989	1017
PSM	VDSTTCLFPVEEK	385	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=14650	84.684	2	1603.6841	1603.6841	R	A	241	254
PSM	VKTEPMDADDSNNCTGQNEHQR	386	sp|O43513|MED7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35,14-UNIMOD:4	ms_run[2]:scan=1134	7.4796	3	2561.0507	2561.0507	R	E	184	206
PSM	VQHQTSSTSPLSSPNQTSSEPRPLPAPR	387	sp|Q86X10-2|RLGPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=9483	52.182	3	3065.4568	3065.4568	K	R	187	215
PSM	VREEEIEVDSR	388	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=5270	28.509	2	1359.663	1359.6630	R	V	628	639
PSM	VVVHHVTVSPLR	389	sp|P15822|ZEP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=8234	45.109	2	1421.7544	1421.7544	K	T	563	575
PSM	YHGHSMSDPGVSYR	390	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=2793	15.65	3	1687.645	1687.6450	R	T	258	272
PSM	VGAHAGEYGAEALER	391	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7678	41.915306666666666	3	1528.726776	1528.727020	K	M	18	33
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	392	sp|Q0ZGT2|NEXN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	13-UNIMOD:35,16-UNIMOD:21	ms_run[1]:scan=6828	37.29577666666667	3	3008.170970	3007.187379	K	S	554	579
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	393	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14847	86.01789166666666	3	3442.4026	3442.4027	K	L	104	135
PSM	CHSLGYNFIHK	394	sp|Q86X27|RGPS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=13526	77.10623833333334	3	1437.5892	1437.5895	K	M	341	352
PSM	CHSLGYNFIHK	395	sp|Q86X27|RGPS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=13519	77.07559666666667	2	1437.5898	1437.5895	K	M	341	352
PSM	QKTPPPVAPKPAVK	396	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=3335	18.298701666666666	3	1519.8145	1519.8158	K	S	753	767
PSM	GRPPAEKLSPNPPNLTK	397	sp|P51532|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	9-UNIMOD:21	ms_run[1]:scan=8621	47.365341666666666	3	1894.961784	1894.966613	R	K	1444	1461
PSM	TPKDSPGIPPSANAHQLFR	398	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:21	ms_run[1]:scan=12721	71.91589	3	2112.011012	2112.015354	K	G	365	384
PSM	CATPNISPATSVVQHSHLR	399	sp|Q9Y597|KCTD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=14003	80.2697	3	2136.9772	2136.9771	R	E	606	625
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	400	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	8-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=12224	68.69206666666666	3	2700.099158	2701.130203	R	G	244	269
PSM	DVDIIDHHDNTYTVK	401	sp|P21333|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=9755	53.773558333333334	2	1784.825357	1783.837693	R	Y	922	937
PSM	HRNLSSTTDDEAPR	402	sp|O00515|LAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	5-UNIMOD:21	ms_run[1]:scan=3596	19.610429999999997	3	1678.696404	1677.710792	R	L	34	48
PSM	RESPSPAPKPR	403	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=820	6.271795	3	1300.629418	1300.628900	K	K	448	459
PSM	PTHHPVSSITGQDFSASTPK	404	sp|O94823|AT10B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	10-UNIMOD:21	ms_run[1]:scan=8659	47.576526666666666	3	2173.987578	2172.984113	R	S	1364	1384
PSM	DRTPPHLLYSDR	405	sp|Q8NDT2|RB15B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=8956	49.24062166666667	2	1548.708984	1548.708607	R	D	530	542
PSM	WAHDKFSGEEGEIEDDESGTENREEK	406	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	7-UNIMOD:21,18-UNIMOD:21	ms_run[1]:scan=10266	56.785598333333326	3	3183.205946	3182.202709	K	D	922	948
PSM	FASDDEHDEHDENGATGPVKR	407	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:21	ms_run[1]:scan=4165	22.64179	3	2405.940964	2404.955726	K	A	364	385
PSM	ADDKETCFAEEGKK	408	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4	ms_run[2]:scan=2758	15.5	2	1626.7196	1626.7196	K	L	585	599
PSM	AGDLLEDSPKRPK	409	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=5420	29.339	2	1504.7287	1504.7287	R	E	151	164
PSM	AHSLMELSPSAPPGGSPHLDSSR	410	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=9937	54.835	3	2425.0733	2425.0733	K	S	593	616
PSM	ARHDSPDLAPNVTYSLPR	411	sp|Q9BRD0|BUD13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=12749	72.097	3	2087.979	2087.9790	R	T	267	285
PSM	ASETPPPVAQPKPEAPHPGLETTLQER	412	sp|Q6P1N0-2|C2D1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=11640	65.045	3	2956.4332	2956.4332	K	L	117	144
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	413	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=8146	44.609	3	2465.0431	2465.0431	R	A	90	114
PSM	ASPGHSPHYFAASSPTSPNALPPAR	414	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=10805	60.009	3	2596.186	2596.1860	R	K	1847	1872
PSM	ASPGHSPHYFAASSPTSPNALPPAR	415	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=11215	62.478	3	2596.186	2596.1860	R	K	1847	1872
PSM	ATGNDLRPPPPSPSSDLTHPMK	416	sp|Q9P275|UBP36_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21,21-UNIMOD:35	ms_run[2]:scan=8610	47.305	3	2410.0988	2410.0988	R	T	702	724
PSM	DETAVQDYHGHK	417	sp|P48147|PPCE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1790	10.427	2	1398.6164	1398.6164	R	I	12	24
PSM	DGDDVIIIGVFK	418	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=18658	115.01	2	1289.6867	1289.6867	K	G	302	314
PSM	DQHHLGSPSR	419	sp|Q9H8M2|BRD9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=1064	7.1969	2	1212.5037	1212.5037	R	L	560	570
PSM	DRSSPPPGYIPDELHQVAR	420	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=13138	74.568	3	2213.0266	2213.0266	R	N	161	180
PSM	EEHGGLIRSPR	421	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=3723	20.312	2	1329.6191	1329.6191	K	H	71	82
PSM	FLHIMEDDSMEEKPLK	422	sp|P29375-2|KDM5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35,9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=10810	60.038	2	2072.8836	2072.8836	R	V	1480	1496
PSM	FLHIMEDDSMEEKPLK	423	sp|P29375-2|KDM5A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:35,9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=10879	60.471	3	2072.8836	2072.8836	R	V	1480	1496
PSM	FPPEDFRHSPEDFR	424	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=12339	69.42	3	1854.7727	1854.7727	R	R	567	581
PSM	GLLYDSDEEDEERPAR	425	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=10449	57.843	2	1972.8051	1972.8051	R	K	134	150
PSM	GPGAPASPSASHPQGLDTTPKPH	426	sp|P98171|RHG04_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=6222	33.759	3	2286.043	2286.0430	R	-	924	947
PSM	GPPSPPAPVMHSPSR	427	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5341	28.889	3	1608.712	1608.7120	R	K	221	236
PSM	GPPSPPAPVMHSPSR	428	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=7667	41.859	3	1592.7171	1592.7171	R	K	221	236
PSM	GPPSPPAPVMHSPSR	429	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=8263	45.276	3	1592.7171	1592.7171	R	K	221	236
PSM	GRPPAEKLSPNPPK	430	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=4381	23.837	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPK	431	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=4778	25.965	3	1566.7919	1566.7919	R	L	1369	1383
PSM	HAGVQTSRPISR	432	sp|Q86X02|CDR2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=1787	10.416	2	1387.6722	1387.6722	R	D	383	395
PSM	HASTGAMHPLR	433	sp|Q12809-5|KCNH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,7-UNIMOD:35	ms_run[2]:scan=1203	7.7611	2	1272.5435	1272.5435	R	S	302	313
PSM	HIEPELAGRDSPIR	434	sp|P86791|CCZ1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=7993	43.769	3	1668.7985	1668.7985	R	A	256	270
PSM	HLEHAPSPSDVSNAPEVK	435	sp|Q9Y4C1|KDM3A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=7905	43.261	3	1992.8942	1992.8942	K	A	439	457
PSM	HQEVQDQDPVFQGSDSSGYQSDHKK	436	sp|Q3B726|RPA43_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:21	ms_run[2]:scan=7014	38.321	3	2925.2203	2925.2203	K	K	284	309
PSM	HRGSADYSMEAK	437	sp|Q04726-2|TLE3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=969	6.8287	2	1446.5599	1446.5599	K	K	214	226
PSM	IHGSGHVEEPASPLAAYQK	438	sp|Q12955-6|ANK3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=8846	48.631	3	2069.9572	2069.9572	K	S	911	930
PSM	IPSAPVIPTHQASVTTERPK	439	sp|Q9BZF2-2|OSBL7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=10558	58.484	3	2208.1304	2208.1304	R	K	224	244
PSM	KEYEQELSDDLHVER	440	sp|Q7Z7F7|RM55_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11509	64.255	3	1888.8803	1888.8803	R	Y	104	119
PSM	KFSAGGDSDPPLKR	441	sp|O75152|ZC11A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=5629	30.44	3	1553.7239	1553.7239	R	S	288	302
PSM	KGSAPGNLSLHLNR	442	sp|Q99973-2|TEP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9416	51.806	3	1542.7668	1542.7668	R	I	2351	2365
PSM	KKEPAITSQNSPEAR	443	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=2564	14.487	2	1734.8302	1734.8302	K	E	69	84
PSM	KKEPAITSQNSPEAR	444	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=3024	16.837	2	1734.8302	1734.8302	K	E	69	84
PSM	KLFNLSKEDDVR	445	sp|P62753|RS6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=11166	62.174	2	1542.7443	1542.7443	R	Q	143	155
PSM	KLGSTASLPFIQEHR	446	sp|Q8NEV8-2|EXPH5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=14067	80.709	3	1762.8767	1762.8767	R	T	796	811
PSM	KLMHSSSLTNSSIPR	447	sp|Q08499-5|PDE4D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=6333	34.382	3	1752.823	1752.8230	K	F	67	82
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	448	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:21	ms_run[2]:scan=12706	71.819	3	3605.6199	3605.6199	K	L	150	183
PSM	KLSPPPLPPR	449	sp|O00750|P3C2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=10941	60.817	2	1180.6369	1180.6369	K	A	153	163
PSM	KLSPPPLPPR	450	sp|O00750|P3C2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9922	54.74	2	1180.6369	1180.6369	K	A	153	163
PSM	KLSTFRESFK	451	sp|P23497-7|SP100_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=8002	43.825	2	1321.6432	1321.6432	R	K	352	362
PSM	KPASPPLPATQQEKPSQTPEAGR	452	sp|Q6ZU35|K1211_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=6510	35.416	3	2494.2217	2494.2217	R	K	1039	1062
PSM	KREEEEEEEGSIMNGSTAEDEEQTR	453	sp|Q0ZGT2-4|NEXN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:35,16-UNIMOD:21	ms_run[2]:scan=5572	30.158	3	3007.1874	3007.1874	K	S	490	515
PSM	KRTSSEDNLYLAVLR	454	sp|Q15149-4|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=14926	86.524	3	1843.9193	1843.9193	R	A	17	32
PSM	KSPSGPVKSPPLSPVGTTPVK	455	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=9518	52.397	2	2139.1341	2139.1341	R	L	177	198
PSM	KVAVVRTPPK	456	sp|P10636-3|TAU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=2850	15.909	2	1173.6635	1173.6635	K	S	131	141
PSM	LLKPGEEPSEYTDEEDTK	457	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=8686	47.719	3	2158.9195	2158.9195	R	D	200	218
PSM	LPPPKPLPGTLK	458	sp|O14672-2|ADA10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=9858	54.336	2	1336.752	1336.7520	K	R	409	421
PSM	LRQEIYSSHNQPSTGGR	459	sp|Q8WVV4|POF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=4712	25.617	2	2008.9116	2008.9116	K	T	527	544
PSM	MEEDPDDVPHGHITSLAVK	460	sp|P41227-2|NAA10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35	ms_run[2]:scan=9792	53.981	2	2104.9735	2104.9735	K	R	60	79
PSM	MHPSLSHSEALASPAK	461	sp|Q6R327|RICTR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=5252	28.421	2	1757.7808	1757.7808	R	D	1341	1357
PSM	NFTKPQDGDVIAPLITPQKK	462	sp|Q9Y3Z3-3|SAMH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:21	ms_run[2]:scan=13110	74.39	3	2289.177	2289.1770	R	E	507	527
PSM	PGPSVVDAAGLRSPCPGQHGAPASAR	463	sp|Q8IU68-2|TMC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21,15-UNIMOD:4	ms_run[2]:scan=9851	54.306	3	2591.2064	2591.2064	R	R	468	494
PSM	PIIHFGSDYEDR	464	sp|P04156-2|PRIO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=11512	64.276	3	1447.6732	1447.6732	R	Y	130	142
PSM	PKSPHNSGLVNLTER	465	sp|Q96JM2|ZN462_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=8123	44.494	3	1727.8356	1727.8356	K	S	348	363
PSM	PRPPQSSTGSTASPPVSTPVTGHK	466	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=6657	36.284	3	2452.1748	2452.1748	K	R	139	163
PSM	PRPTEATVSLSSLVDYPHQAR	467	sp|Q92619|HMHA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=16481	97.921	3	2403.1584	2403.1584	R	V	941	962
PSM	RATVVVGDLHPLR	468	sp|Q9NSI2-2|F207A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=11197	62.359	3	1511.7974	1511.7974	R	D	121	134
PSM	RFSLAPPKEER	469	sp|Q9P219|DAPLE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=8645	47.499	3	1408.6864	1408.6864	R	L	1885	1896
PSM	RGSMEQAPAVALPPTHK	470	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7287	39.825	2	1884.8917	1884.8917	R	K	524	541
PSM	RGSMEQAPAVALPPTHK	471	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=8258	45.242	3	1884.8917	1884.8917	R	K	524	541
PSM	RHPDYSVVLLLR	472	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=14957	86.735	3	1466.8358	1466.8358	R	L	361	373
PSM	RHSTSDLSDATFSDIR	473	sp|Q9P227-2|RHG23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=11287	62.871	3	1886.816	1886.8160	K	R	675	691
PSM	RHSVSEMTSCPEPQGFSDPPGQGPTGTFR	474	sp|P85299-2|PRR5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:35,8-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=11269	62.763	3	3241.3594	3241.3594	R	S	179	208
PSM	RHTDPVQLQAAGR	475	sp|O75791-2|GRAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=5018	27.216	3	1527.7307	1527.7307	R	V	147	160
PSM	RKASGPPVSELITK	476	sp|P10412|H14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=9238	50.804	2	1561.8229	1561.8229	K	A	33	47
PSM	RKLSGDQPAAR	477	sp|Q13428-2|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=994	6.9305	2	1277.6241	1277.6241	K	T	1270	1281
PSM	RKTMQGEGPQLLLSEAVSR	478	sp|P46379-2|BAG6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=14910	86.431	3	2195.077	2195.0770	R	A	1045	1064
PSM	RLSSTSLASGHSVR	479	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=5446	29.474	2	1536.741	1536.7410	R	L	38	52
PSM	RPASPSSPEHLPATPAESPAQR	480	sp|Q9H7L9|SDS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=7619	41.637	3	2362.1067	2362.1067	K	F	231	253
PSM	RPQPYPYPSKK	481	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=4033	21.997	2	1439.6963	1439.6963	R	L	213	224
PSM	RPSDLTISINQMGSPGMGHLK	482	sp|Q86UU0-3|BCL9L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,12-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=11069	61.587	3	2350.0811	2350.0811	R	S	913	934
PSM	RPSPTSGDSRPAAGR	483	sp|Q8N1G1|REXO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=1059	7.1794	2	1590.7264	1590.7264	R	G	457	472
PSM	RRSQSIEQESQEK	484	sp|Q5VTL8|PR38B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=1470	8.9627	2	1683.7577	1683.7577	R	Q	525	538
PSM	RSSPPGHYYQK	485	sp|Q9NX40-3|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21	ms_run[2]:scan=1993	11.391	3	1398.6082	1398.6082	R	S	121	132
PSM	RSSVAFFAVCDGHGGR	486	sp|O15297-2|PPM1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=11675	65.27	3	1801.772	1801.7720	R	E	95	111
PSM	RTHSEGSLLQEPR	487	sp|P49796-4|RGS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=6235	33.82	3	1588.7359	1588.7359	R	G	659	672
PSM	RTPTMPQEEAAACPPHILPPEK	488	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=10686	59.266	3	2565.1757	2565.1757	R	R	1243	1265
PSM	SDDSKSSSPELVTHLK	489	sp|Q07960|RHG01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=7941	43.483	3	1808.8193	1808.8193	K	W	44	60
PSM	SHSPSASQSGSQLR	490	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=1822	10.574	2	1507.6416	1507.6416	R	N	1257	1271
PSM	SKDQNETLDEDLFHK	491	sp|Q9BQL6-3|FERM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10899	60.577	3	1817.8432	1817.8432	R	L	210	225
PSM	SSEVRPSSDLNNSTGQSPHHK	492	sp|P27448-6|MARK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:21	ms_run[2]:scan=2482	14.047	3	2343.0241	2343.0241	K	V	368	389
PSM	SSSPALKPKPNPPSPENTASSAPVDWR	493	sp|Q5T0Z8|CF132_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	14-UNIMOD:21	ms_run[2]:scan=11185	62.284	3	2896.3757	2896.3757	K	D	436	463
PSM	SSSPEDPERDEEVLNHVLR	494	sp|Q8TE67-2|ES8L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=14862	86.113	3	2287.0118	2287.0118	R	D	229	248
PSM	TKPPRPDSPATTPNISVK	495	sp|P32519-2|ELF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=7455	40.734	2	1984.9983	1984.9983	K	K	156	174
PSM	TPKDSPGIPPSANAHQLFR	496	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=12108	67.988	3	2112.0154	2112.0154	K	G	365	384
PSM	TPKDSPGIPPSANAHQLFR	497	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=12269	68.993	3	2112.0154	2112.0154	K	G	365	384
PSM	TPKDSPGIPPSANAHQLFR	498	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=12575	71.014	3	2112.0154	2112.0154	K	G	365	384
PSM	TRSEPLPPSATAPPPPGPMQPR	499	sp|Q8WUI4-10|HDAC7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=8830	48.538	3	2376.1297	2376.1297	R	L	18	40
PSM	VPGSSGHLHK	500	sp|Q9UEW8-2|STK39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=1087	7.2923	2	1097.5019	1097.5019	R	T	348	358
PSM	VPSPHETKPDEDAEAFENHAEK	501	sp|Q96JQ2|CLMN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=8583	47.161	3	2556.0806	2556.0806	K	L	583	605
PSM	VQQLHSLRNSFK	502	sp|Q9NYT0|PLEK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=6874	37.534	2	1535.761	1535.7610	K	L	111	123
PSM	YHGHSMSDPGVSYR	503	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3724	20.315	3	1687.645	1687.6450	R	T	258	272
PSM	KKNEPEDEEEEEEEEDEDEEEEDEDEE	504	sp|P26583|HMGB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7123	38.943778333333334	3	3384.201824	3383.197574	K	-	183	210
PSM	RLSTSPDVIQGHQPR	505	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=8053	44.13343166666667	3	1770.842740	1769.857397	R	D	264	279
PSM	KKEPAITSQNSPEAR	506	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:21	ms_run[1]:scan=2384	13.48976	3	1735.821375	1734.830179	K	E	90	105
PSM	KKEPAITSQNSPEAR	507	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:21	ms_run[1]:scan=2291	12.950136666666667	3	1735.825448	1734.830179	K	E	90	105
PSM	PLPTLEVKPPDRPSSK	508	sp|Q12872|SFSWA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	15-UNIMOD:21	ms_run[1]:scan=11610	64.87686333333333	2	1840.952811	1839.949566	R	S	729	745
PSM	QKTPPPVAPKPAVK	509	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5470	29.610834999999998	2	1519.8165	1519.8158	K	S	753	767
PSM	GRPPAEKLSPNPPNLTK	510	sp|P51532|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:21	ms_run[1]:scan=8580	47.145876666666666	3	1894.961784	1894.966613	R	K	1444	1461
PSM	HRSSISGSLPSSGSLQAVSSR	511	sp|Q9BXF6|RFIP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:21	ms_run[1]:scan=10573	58.578155	3	2179.040709	2179.038274	R	F	354	375
PSM	RHTDPVQLQAAGR	512	sp|O75791|GRAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=5287	28.59350333333333	3	1528.715146	1527.730740	R	V	260	273
PSM	TPKDSPGIPPSANAHQLFR	513	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:21	ms_run[1]:scan=11620	64.92687166666667	2	2113.018418	2112.015354	K	G	365	384
PSM	KDVDEAYMNKVELESR	514	sp|P05787|K2C8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:35	ms_run[1]:scan=7426	40.58532833333333	3	1940.914708	1940.914957	K	L	198	214
PSM	RSSPPGHYYQK	515	sp|Q9NX40|OCAD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=2191	12.393145	3	1398.607994	1398.608165	R	S	121	132
PSM	TLDVSTDEEDKIHHSSESK	516	sp|P16383|GCFC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:21	ms_run[1]:scan=6493	35.319625	3	2236.956903	2235.953267	R	D	92	111
PSM	QLTQPETHFGR	517	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=11765	65.82685500000001	2	1375.5920	1375.5917	K	E	289	300
PSM	QFEHLDPQNQHTFEAR	518	sp|Q02818|NUCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,12-UNIMOD:21	ms_run[1]:scan=13247	75.2998	3	2058.8591	2058.8580	K	D	137	153
PSM	KIPVFHNGSTPTLGETPK	519	sp|Q9Y6M7|S4A7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:21	ms_run[1]:scan=12111	68.003005	3	2002.977366	2001.992493	R	E	548	566
PSM	VSLKPLHSVNNPILR	520	sp|Q8IW41|MAPK5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:21	ms_run[1]:scan=13459	76.67061666666666	3	1765.960675	1765.960405	K	K	347	362
PSM	ALRPGDLPPSPDDVKR	521	sp|O75382|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	10-UNIMOD:21	ms_run[1]:scan=9671	53.28370166666667	3	1811.890706	1811.893113	R	R	418	434
PSM	RISICSSDKR	522	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21,5-UNIMOD:4	ms_run[1]:scan=3129	17.36355	3	1300.595405	1300.595886	K	I	404	414
PSM	FASDDEHDEHDENGATGPVKR	523	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=4565	24.813085	3	2405.942194	2404.955726	K	A	364	385
PSM	AAPPPPPPPPPLESSPR	524	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21	ms_run[2]:scan=9930	54.787	2	1782.8706	1782.8706	K	V	606	623
PSM	AHSLMELSPSAPPGGSPHLDSSR	525	sp|Q13586|STIM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=10465	57.927	3	2425.0733	2425.0733	K	S	593	616
PSM	APPQTHLPSGASSGTGSASATHGGGSPPGTR	526	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	26-UNIMOD:21	ms_run[2]:scan=6334	34.386	3	2864.2839	2864.2839	R	G	88	119
PSM	ASLLHSMPTHSSPR	527	sp|O75122|CLAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=3841	20.932	2	1615.7178	1615.7178	K	S	1002	1016
PSM	ATNSPKPHMVPR	528	sp|O75179-4|ANR17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1182	7.6756	2	1429.6537	1429.6537	R	H	1344	1356
PSM	AVPAPSPGPTHNSPELGRPPAAGVLAPDMSDK	529	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=13662	77.986	3	3212.5326	3212.5326	R	D	1056	1088
PSM	DKDDDEVFEK	530	sp|Q04637-6|IF4G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=4838	26.276	2	1238.5303	1238.5303	K	K	658	668
PSM	DMESPTKLDVTLAK	531	sp|P27816-5|MAP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=11012	61.254	3	1642.7525	1642.7525	K	D	277	291
PSM	DRTPPHLLYSDR	532	sp|Q8NDT2-2|RB15B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8657	47.57	3	1548.7086	1548.7086	R	D	203	215
PSM	EPRPNSSPSPSPGQASETPHPR	533	sp|O00204-2|ST2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=4085	22.263	3	2391.0605	2391.0605	R	P	327	349
PSM	EPRPNSSPSPSPGQASETPHPRPS	534	sp|O00204-2|ST2B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=4522	24.599	3	2575.1453	2575.1453	R	-	327	351
PSM	FLFHMYDSDSDGR	535	sp|Q96BS2-2|CHP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:35	ms_run[2]:scan=11178	62.244	2	1604.6566	1604.6566	R	I	117	130
PSM	GKLEAIITPPPAKK	536	sp|O75367-2|H2AY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=8883	48.837	2	1541.8582	1541.8582	K	A	122	136
PSM	GLAHPPSYSNPPVYHGNSPK	537	sp|Q92738|US6NL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	18-UNIMOD:21	ms_run[2]:scan=8887	48.856	3	2197.9946	2197.9946	R	H	625	645
PSM	GLNSQSSDDHLNKR	538	sp|Q96HA1-2|P121A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=2151	12.198	2	1649.7159	1649.7159	R	S	110	124
PSM	GMIIEHEGDRPSSKTEIEMDGK	539	sp|P32418-2|NAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35,12-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=5763	31.226	3	2570.103	2570.1030	R	V	273	295
PSM	GPPSPPAPVMHSPSR	540	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=4829	26.228	2	1608.712	1608.7120	R	K	221	236
PSM	GPPSPPAPVMHSPSR	541	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5595	30.27	2	1608.712	1608.7120	R	K	221	236
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	542	sp|Q8N122-3|RPTOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	20-UNIMOD:21	ms_run[2]:scan=8181	44.812	3	2671.2239	2671.2239	K	Q	710	737
PSM	GVVDSDDLPLNVSR	543	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=13546	77.233	3	1484.7471	1484.7471	K	E	435	449
PSM	HAYKDDSPR	544	sp|Q02040|AK17A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=634	5.5625	2	1167.471	1167.4710	K	R	627	636
PSM	HGAEPQASPAVHLPESPQSPK	545	sp|Q03989-5|ARI5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=9099	50.059	3	2243.0372	2243.0372	R	G	214	235
PSM	HGESAWNLENR	546	sp|P18669|PGAM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7669	41.866	2	1311.5956	1311.5956	R	F	11	22
PSM	HRPSPPATPPPK	547	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2040	11.629	2	1440.6316	1440.6316	R	T	399	411
PSM	HVLSGSPEHFQK	548	sp|Q96PX6|CC85A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=5435	29.42	2	1444.65	1444.6500	K	H	308	320
PSM	IADPEHDHTGFLTEYVATR	549	sp|P27361-2|MK03_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=15327	89.206	3	2250.9947	2250.9947	R	W	190	209
PSM	IGHHSTSDDSSAYR	550	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=2033	11.592	2	1611.6315	1611.6315	R	S	333	347
PSM	IHIDPEIQDGSPTTSR	551	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=10057	55.535	2	1844.8306	1844.8306	R	R	102	118
PSM	KDEGEGAAGAGDHKDPSLGAGEAASK	552	sp|Q02952-3|AKA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=4080	22.239	3	2504.0817	2504.0817	K	E	98	124
PSM	KEHISAENMSLETLR	553	sp|Q13426-2|XRCC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=8045	44.094	2	1852.839	1852.8390	K	N	309	324
PSM	KFSGFSAKPNNSGEAPSSPTPK	554	sp|P49916-4|DNLI3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	18-UNIMOD:21	ms_run[2]:scan=7128	38.971	3	2314.0631	2314.0631	R	R	138	160
PSM	KHSLSSVTYVPR	555	sp|Q9Y271|CLTR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=7642	41.744	2	1452.7126	1452.7126	R	K	311	323
PSM	KHSQTDLVSR	556	sp|O14683|P5I11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1962	11.252	2	1249.5816	1249.5816	K	L	12	22
PSM	KKEEPSQNDISPK	557	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=1516	9.1563	2	1578.7291	1578.7291	K	T	11	24
PSM	KKEPAITSQNSPEAR	558	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=2599	14.652	3	1734.8302	1734.8302	K	E	69	84
PSM	KKSIVAVEPR	559	sp|Q5VZL5-3|ZMYM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=3364	18.42	2	1205.6533	1205.6533	R	S	855	865
PSM	KKSPNELVDDLFK	560	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=15697	91.96	3	1611.7909	1611.7909	R	G	112	125
PSM	KLDYGQHVVAGTPGR	561	sp|P38919|IF4A3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=6881	37.562	2	1676.8036	1676.8036	R	V	152	167
PSM	KMPQLTASAIVSPHGDESPR	562	sp|Q9Y6J9|TAF6L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=9968	55.006	3	2216.0297	2216.0297	R	G	484	504
PSM	KPAPGPHSSPPEEK	563	sp|O75182-2|SIN3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=1173	7.638	2	1536.6974	1536.6974	K	G	700	714
PSM	KPEKPLFSSASPQDSSPR	564	sp|O00712-6|NFIB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=7149	39.064	3	2036.9568	2036.9568	K	L	66	84
PSM	KPRPSEGDEDCLPASK	565	sp|P78346|RPP30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3754	20.461	3	1864.8026	1864.8026	K	K	247	263
PSM	KQPPKEPSEVPTPK	566	sp|P17096-2|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=3824	20.83	2	1640.8175	1640.8175	R	R	31	45
PSM	KRESESESDETPPAAPQLIK	567	sp|O60832|DKC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=9613	52.949	3	2291.0682	2291.0682	R	K	448	468
PSM	KRPEPSSDYDLSPAK	568	sp|Q6W2J9-4|BCOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=5705	30.873	2	1768.8033	1768.8033	R	Q	1347	1362
PSM	KRPEQQDVSSPAK	569	sp|Q9Y3S1-2|WNK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=883	6.4884	2	1548.7297	1548.7297	R	T	1731	1744
PSM	KTPELGIVPPPPIPR	570	sp|Q8TEH3-7|DEN1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=15584	91.07	2	1689.9219	1689.9219	R	P	707	722
PSM	KVEEEQEADEEDVSEEEAESK	571	sp|Q9H3N1|TMX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:21	ms_run[2]:scan=6417	34.889	3	2516.9803	2516.9803	K	E	234	255
PSM	LDTDDLDEIEK	572	sp|Q9UMR2-3|DD19B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11905	66.698	2	1304.5984	1304.5984	R	I	357	368
PSM	LFRPPSPAPAAPGAR	573	sp|Q86U90|YRDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=9774	53.881	3	1583.7974	1583.7974	R	L	32	47
PSM	LGGLRPESPESLTSVSR	574	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=12682	71.668	2	1863.9092	1863.9092	R	T	11	28
PSM	LHSAPNLSDLHVVR	575	sp|O75385|ULK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12727	71.956	3	1636.8087	1636.8087	R	P	554	568
PSM	LKDLFDYSPPLHK	576	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=15737	92.246	2	1651.8011	1651.8011	K	N	503	516
PSM	LVHSGSGCRSPSLGSDLTFATR	577	sp|Q13425|SNTB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=12846	72.724	3	2384.0944	2384.0944	R	T	384	406
PSM	LVNEVTEFAK	578	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11491	64.141	2	1148.6077	1148.6077	K	T	66	76
PSM	MHIEKDETPLSTPTAR	579	sp|Q9UI36-2|DACH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=5103	27.681	3	1920.8652	1920.8652	R	D	519	535
PSM	PAGQHGSLSPAAAHTASPEPPTQSGPLTR	580	sp|Q8NC74|RB8NL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=9306	51.171	3	2899.3614	2899.3614	K	S	458	487
PSM	PGAEGAPLLPPPLPPPSPPGSGR	581	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=16190	95.694	3	2237.1246	2237.1246	R	G	27	50
PSM	PGAEGAPLLPPPLPPPSPPGSGR	582	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=16592	98.753	3	2237.1246	2237.1246	R	G	27	50
PSM	PQLSHSSRLSSDLTR	583	sp|Q7Z6E9-4|RBBP6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=7523	41.098	2	1762.8363	1762.8363	K	E	776	791
PSM	PRSPTGPSNSFLANMGGTVAHK	584	sp|Q96I25|SPF45_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,15-UNIMOD:35	ms_run[2]:scan=9048	49.761	3	2321.0624	2321.0624	R	I	220	242
PSM	PRSPTGPSNSFLANMGGTVAHK	585	sp|Q96I25|SPF45_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13621	77.705	3	2305.0675	2305.0675	R	I	220	242
PSM	PTHHPVSSITGQDFSASTPK	586	sp|O94823|AT10B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=9420	51.826	2	2172.9841	2172.9841	R	S	1364	1384
PSM	PTHKPIAEAPSAFTLGSEMK	587	sp|P49792|RBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=11959	67.043	3	2207.0334	2207.0334	K	L	1809	1829
PSM	PYHPPPLFPPSPQPPDSTPR	588	sp|P54259|ATN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=14278	82.133	3	2303.0776	2303.0776	R	Q	158	178
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	589	sp|P54727-2|RD23B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21	ms_run[2]:scan=5033	27.309	3	3024.3561	3024.3561	K	S	73	102
PSM	QRHSVSIVETNLGMGR	590	sp|Q9Y4G8|RPGF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=8936	49.129	3	1878.8771	1878.8771	R	M	1173	1189
PSM	RADAGSHTEGSPSQPR	591	sp|Q86V15-2|CASZ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=716	5.8791	2	1731.7326	1731.7326	K	D	47	63
PSM	RANTLSHFPIECQEPPQPAR	592	sp|Q86TI0-2|TBCD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=11773	65.873	3	2427.1155	2427.1155	R	G	593	613
PSM	RGSIGENQIKDEK	593	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=3576	19.515	2	1552.7247	1552.7247	K	I	194	207
PSM	RHSSETFSSTPSATR	594	sp|P35568|IRS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=3319	18.226	3	1729.7421	1729.7421	R	V	1098	1113
PSM	RHTSAEEEEPPPVK	595	sp|Q9BZ95-3|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=2684	15.1	2	1684.7458	1684.7458	R	I	454	468
PSM	RKSELFNPVSLDCK	596	sp|P0CAP2-3|GRL1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=12625	71.309	3	1771.8328	1771.8328	R	L	70	84
PSM	RKSFDASDTLALPR	597	sp|Q5JXC2|MIIP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=11572	64.644	2	1655.8032	1655.8032	R	H	301	315
PSM	RLSGGSHSYGGESPR	598	sp|Q13905-2|RPGF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2854	15.923	2	1625.6947	1625.6947	R	L	294	309
PSM	RLSSTSLASGHSVR	599	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=5561	30.098	3	1536.741	1536.7410	R	L	38	52
PSM	RLSTSPDVIQGHQPR	600	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=7535	41.158	2	1769.8574	1769.8574	R	D	264	279
PSM	RNDNSILHPLGTCSPQDK	601	sp|Q8TEW8-5|PAR3L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=10272	56.822	3	2130.9518	2130.9518	R	Q	622	640
PSM	RPGLDFDDDGEGNSK	602	sp|P27540-2|ARNT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7778	42.505	2	1620.7016	1620.7016	R	F	44	59
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	603	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=9223	50.722	3	2602.1925	2602.1925	R	F	118	143
PSM	RPTLGVQLDDKR	604	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8483	46.532	2	1476.745	1476.7450	R	K	326	338
PSM	RQSFGGSLFAYSPGGAHGMLSSPK	605	sp|Q99856|ARI3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=14973	86.838	3	2534.1414	2534.1414	R	L	351	375
PSM	RQSPSPSTRPIR	606	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2215	12.542	2	1540.6913	1540.6913	R	R	711	723
PSM	RQSVSGLHR	607	sp|Q8N1G4|LRC47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1627	9.6665	2	1118.5346	1118.5346	K	Y	429	438
PSM	RRGSDPASGEVEASQLR	608	sp|Q8WWA1-3|TMM40_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=6133	33.252	3	1893.8694	1893.8694	R	R	58	75
PSM	RRPESAPAESSPSK	609	sp|Q07889|SOS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=1058	7.1758	2	1577.7199	1577.7199	R	I	1157	1171
PSM	RRPSALEADSPMAPK	610	sp|Q86Y91-2|KI18B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=5070	27.511	3	1720.7968	1720.7968	R	R	651	666
PSM	RRPSDENTIAPSEVQK	611	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=4747	25.804	3	1905.8946	1905.8946	R	W	638	654
PSM	RRSFPDIEDEEK	612	sp|Q5VUA4-2|ZN318_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8440	46.3	3	1599.693	1599.6930	R	F	525	537
PSM	RRVSEVEEEK	613	sp|O43290|SNUT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=1697	9.9895	2	1339.6133	1339.6133	R	E	445	455
PSM	RTSNERPGSGQGQGR	614	sp|Q8TAD8|SNIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=568	5.2797	2	1665.7333	1665.7333	R	D	151	166
PSM	SAPTAPTPPPPPPPATPR	615	sp|Q14202-2|ZMYM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=8377	45.927	2	1827.892	1827.8921	R	K	799	817
PSM	SEHTVFIMPPEPPPDDGKDLSPK	616	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:35,21-UNIMOD:21	ms_run[2]:scan=12875	72.888	3	2628.1819	2628.1819	K	Y	683	706
PSM	SELHQDRSSPPPPLPER	617	sp|Q9Y2R2-6|PTN22_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=6447	35.063	3	2020.9368	2020.9368	K	T	557	574
PSM	SHSGPAGSFNKPAIR	618	sp|Q9UJM3|ERRFI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=6547	35.651	2	1604.7461	1604.7461	R	I	249	264
PSM	SHSHTQEQTGETASEEQRPGGPSANVTK	619	sp|Q9BWH6-2|RPAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=3804	20.719	3	3029.3112	3029.3112	R	E	264	292
PSM	SKHPSGSNVSFSR	620	sp|Q12767|TMM94_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=3203	17.688	3	1468.646	1468.6460	R	D	509	522
PSM	SPSPPLPTHIPPEPPR	621	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=12742	72.057	2	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	622	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13246	75.296	3	1797.8815	1797.8815	R	T	326	342
PSM	SRDDLYDQDDSR	623	sp|Q86X29-6|LSR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3791	20.642	2	1483.6175	1483.6175	R	D	374	386
PSM	THPTLHDSER	624	sp|Q8N4S9-2|MALD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=1552	9.3146	2	1271.5296	1271.5296	R	A	30	40
PSM	THTTALAGRSPSPASGR	625	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21,12-UNIMOD:21	ms_run[2]:scan=2924	16.281	2	1825.7873	1825.7873	K	R	286	303
PSM	TKFASDDEHDEHDENGATGPVK	626	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=4255	23.126	3	2477.9973	2477.9973	K	R	362	384
PSM	TPKDSPGIPPSAGAHQLFR	627	sp|Q15418-3|KS6A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=11067	61.58	3	2054.9939	2054.9939	R	G	267	286
PSM	TPKDSPGIPPSANAHQLFR	628	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=11300	62.955	3	2112.0154	2112.0154	K	G	365	384
PSM	TTSPPLSIPTTHLIHQPAGSR	629	sp|Q5T5U3|RHG21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=13755	78.617	3	2290.1471	2290.1471	R	S	316	337
PSM	VHIEIGPDGR	630	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7775	42.494	2	1091.5724	1091.5724	R	V	317	327
PSM	VKTPEMIIQKPK	631	sp|Q09666|AHNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=5754	31.174	3	1506.7881	1506.7881	K	I	488	500
PSM	VLMKSPSPALHPPQK	632	sp|Q9H6S0|YTDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=5636	30.474	3	1724.8685	1724.8685	R	Y	1217	1232
PSM	VRSFDHSGK	633	sp|Q9NVE7|PANK4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1266	8.0174	2	1111.4812	1111.4812	K	D	61	70
PSM	YDERPGPSPLPHR	634	sp|P08621-4|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=5767	31.244	3	1599.7195	1599.7195	R	D	123	136
PSM	YSPSQNSPIHHIPSR	635	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=6723	36.718	2	1798.8152	1798.8152	R	R	282	297
PSM	QERLSPEVAPPAHR	636	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=8205	44.952236666666664	3	1648.7697	1648.7717	K	R	31	45
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	637	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=13171	74.78716999999999	3	3459.430308	3459.429735	K	L	104	135
PSM	HSTPSNSSNPSGPPSPNSPHR	638	sp|Q9Y5S2|MRCKB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	15-UNIMOD:21	ms_run[1]:scan=2355	13.321520000000001	3	2220.919476	2219.934537	K	S	1676	1697
PSM	TPKDSPGIPPSAGAHQLFR	639	sp|Q15418|KS6A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	5-UNIMOD:21	ms_run[1]:scan=11238	62.58965666666666	3	2054.995721	2054.993890	R	G	359	378
PSM	QHRDSPEILSR	640	sp|Q96Q42|ALS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=4513	24.543870000000002	3	1399.6210	1399.6240	R	S	1331	1342
PSM	RLSKPPFQTNPSPEMVSK	641	sp|Q4LE39|ARI4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=10997	61.162905	3	2123.040003	2122.028227	R	L	664	682
PSM	SSGVSGGKPGLLPAHSR	642	sp|Q8IWB9|TEX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	16-UNIMOD:21	ms_run[1]:scan=5882	31.862405	3	1685.8213	1685.8245	K	H	717	734
PSM	RQTEPVSPVLKR	643	sp|Q8IYH5|ZZZ3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	7-UNIMOD:21	ms_run[1]:scan=5502	29.785733333333333	3	1489.7832	1488.7812	R	I	107	119
PSM	HRPSEADEEELAR	644	sp|O14617|AP3D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:21	ms_run[1]:scan=4093	22.296166666666664	3	1619.703639	1617.678429	K	R	655	668
PSM	LRISNRPAFMPSEGK	645	sp|P35609|ACTN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	4-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=9106	50.09432833333333	2	1797.858819	1797.859705	K	M	352	367
PSM	FASDDEHDEHDENGATGPVKR	646	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=4370	23.769971666666667	3	2405.941409	2404.955726	K	A	364	385
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	647	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=11058	61.52676166666667	3	2909.292192	2908.307590	R	P	132	161
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	648	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=13696	78.21216	3	3460.417710	3459.429735	K	L	104	135
PSM	ALRPGDLPPSPDDVKR	649	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=9006	49.544	3	1811.8931	1811.8931	R	R	299	315
PSM	APASPGAGSDAQGPQFGWDHSLHK	650	sp|Q5T6F0|DCA12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=11913	66.75	3	2497.0812	2497.0812	K	R	12	36
PSM	APKPDGPGGGPGGSHMGGNYGDDR	651	sp|P35637-2|FUS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=3281	18.053	3	2347.9277	2347.9277	K	R	448	472
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	652	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	28-UNIMOD:21	ms_run[2]:scan=10710	59.413	3	3407.6452	3407.6452	R	N	215	246
PSM	APSAVSPIPAVIPSPSHKPSK	653	sp|Q9ULK2-3|AT7L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:21	ms_run[2]:scan=12307	69.22	3	2146.1188	2146.1188	K	T	476	497
PSM	APSAVSPIPAVIPSPSHKPSK	654	sp|Q9ULK2-3|AT7L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	16-UNIMOD:21	ms_run[2]:scan=12465	70.244	3	2146.1188	2146.1188	K	T	476	497
PSM	APTVPPPLPPTPPQPAR	655	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=12352	69.482	3	1811.9335	1811.9335	R	R	616	633
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	656	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21,19-UNIMOD:35	ms_run[2]:scan=7579	41.404	3	2465.0431	2465.0431	R	A	90	114
PSM	ASPGHSPHYFAASSPTSPNALPPAR	657	sp|Q8TEM1|PO210_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21	ms_run[2]:scan=10975	61.019	3	2596.186	2596.1860	R	K	1847	1872
PSM	DLHQPSLSPASPHSQGFER	658	sp|Q9BZF1-3|OSBL8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=10068	55.6	3	2168.964	2168.9640	K	G	16	35
PSM	DQMSHLFNVAHTLR	659	sp|P27708|PYR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=12869	72.851	3	1763.7815	1763.7815	K	M	1935	1949
PSM	DRRPSVDAPVTDVGFLR	660	sp|Q9BUH8|BEGIN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21	ms_run[2]:scan=14692	84.976	3	1978.9626	1978.9626	R	A	242	259
PSM	DTDDVPMILVGNK	661	sp|P61224-4|RAP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:35	ms_run[2]:scan=13286	75.54	2	1431.6915	1431.6915	K	C	63	76
PSM	EEHGGLIRSPR	662	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=3538	19.308	2	1329.6191	1329.6191	K	H	71	82
PSM	EEKDQDELKPGPTNR	663	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2321	13.104	2	1754.8435	1754.8435	K	S	543	558
PSM	EKNDIHLDADDPNSADK	664	sp|Q99590-2|SCAFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5169	28.015	2	1895.8497	1895.8497	K	H	684	701
PSM	ERHSCDALNR	665	sp|Q6P996-3|PDXD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,5-UNIMOD:4	ms_run[2]:scan=1320	8.2539	2	1336.5343	1336.5343	R	W	330	340
PSM	ERSPALKSPLQSVVVR	666	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=12737	72.026	3	1844.9873	1844.9873	R	R	246	262
PSM	ETPHSPGVEDAPIAK	667	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21	ms_run[2]:scan=6729	36.758	2	1626.7291	1626.7291	R	V	486	501
PSM	FHDIDDVK	668	sp|Q9H2U2-6|IPYR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5161	27.972	2	987.46616	987.4662	K	K	115	123
PSM	FHQLDIDDLQSIR	669	sp|P16152-2|CBR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=15661	91.721	3	1598.8053	1598.8053	R	A	59	72
PSM	FNGGHSPTHSPEK	670	sp|Q9Y5K6|CD2AP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=1073	7.2368	2	1473.6038	1473.6038	R	I	505	518
PSM	FSAVKDELPQSPGLIHGR	671	sp|Q9HCH5-15|SYTL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=12851	72.752	2	2029.9986	2029.9986	R	E	192	210
PSM	GDLAFGAPGPRPPSPFDDPADDPEHK	672	sp|Q93074-3|MED12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:21	ms_run[2]:scan=15445	90.015	3	2781.2072	2781.2072	R	E	622	648
PSM	GPPSPPAPVMHSPSR	673	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5212	28.249	2	1608.712	1608.7120	R	K	221	236
PSM	GRPDLSTLTHSIVR	674	sp|Q9BW71-3|HIRP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=13054	74.026	3	1630.8192	1630.8192	R	R	17	31
PSM	GRPPAEKLSPNPPNLTK	675	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=7877	43.104	3	1894.9666	1894.9666	R	K	1411	1428
PSM	GRPPAEKLSPNPPNLTK	676	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=8411	46.138	3	1894.9666	1894.9666	R	K	1411	1428
PSM	GRPPAEKLSPNPPNLTK	677	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=8416	46.165	2	1894.9666	1894.9666	R	K	1411	1428
PSM	GSHFFPGNNVIYEKTIR	678	sp|Q8WVV4|POF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:21	ms_run[2]:scan=13525	77.102	3	2057.9724	2057.9724	R	K	155	172
PSM	GVTIPYRPKPSSSPVIFAGGQDR	679	sp|Q15366-6|PCBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=14179	81.454	3	2508.2526	2508.2526	K	Y	173	196
PSM	GVTSISADTHKYGYAPK	680	sp|O95470|SGPL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8221	45.038	2	1793.8948	1793.8948	K	G	343	360
PSM	HAHSLGSLDASK	681	sp|Q96JN0-3|LCOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=4130	22.477	2	1301.5765	1301.5765	R	V	1045	1057
PSM	HELSPPQKR	682	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=2122	12.043	2	1170.5547	1170.5547	R	M	71	80
PSM	HHSETNFGVK	683	sp|Q5HYW2|NHSL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=2945	16.373	2	1234.5132	1234.5132	R	L	433	443
PSM	HIEPELAGRDSPIR	684	sp|P86791|CCZ1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=7842	42.891	2	1668.7985	1668.7985	R	A	256	270
PSM	HIKEEPLSEEEPCTSTAIASPEK	685	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:4,20-UNIMOD:21	ms_run[2]:scan=9646	53.141	3	2661.1881	2661.1881	K	K	495	518
PSM	HIVSNDSSDSDDESHEPK	686	sp|P47712|PA24A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=1472	8.97	3	1996.8246	1996.8246	K	G	428	446
PSM	HLSESSGKPLSTK	687	sp|Q8IVT2|MISP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=2540	14.36	2	1449.6865	1449.6865	R	Q	469	482
PSM	HRPSPPATPPPK	688	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1611	9.5945	2	1440.6316	1440.6316	R	T	399	411
PSM	HRPSPPATPPPK	689	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1419	8.7268	3	1440.6316	1440.6316	R	T	399	411
PSM	IGHHSTSDDSSAYR	690	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21	ms_run[2]:scan=2077	11.813	3	1611.6315	1611.6315	R	S	333	347
PSM	IHGSGHVEEPASPLAAYQK	691	sp|Q12955-6|ANK3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:21	ms_run[2]:scan=8670	47.627	3	2069.9572	2069.9572	K	S	911	930
PSM	KDSLLKPGLR	692	sp|O75427|LRCH4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=7379	40.338	2	1205.6533	1205.6533	R	A	430	440
PSM	KFQEQECPPSPEPTRK	693	sp|P62070-2|RRAS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=4593	24.948	3	2036.9027	2036.9027	R	E	100	116
PSM	KHSQTDLVSR	694	sp|O14683|P5I11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=2163	12.26	3	1249.5816	1249.5816	K	L	12	22
PSM	KKEPAITSQNSPEAR	695	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=1599	9.5405	2	1734.8302	1734.8302	K	E	69	84
PSM	KKEPAITSQNSPEAR	696	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=1680	9.9099	3	1734.8302	1734.8302	K	E	69	84
PSM	KKEPAITSQNSPEAR	697	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=3641	19.823	3	1734.8302	1734.8302	K	E	69	84
PSM	KKEPAITSQNSPEAR	698	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=3257	17.945	3	1734.8302	1734.8302	K	E	69	84
PSM	KLSSWDQAETPGHTPSLR	699	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=10610	58.808	3	2088.963	2088.9630	K	W	214	232
PSM	KMPQLTASAIVSPHGDESPR	700	sp|Q9Y6J9|TAF6L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:35,18-UNIMOD:21	ms_run[2]:scan=9794	53.994	3	2216.0297	2216.0297	R	G	484	504
PSM	KQPPKEPSEVPTPK	701	sp|P17096-2|HMGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:21	ms_run[2]:scan=3745	20.415	3	1640.8175	1640.8175	R	R	31	45
PSM	KSNLDEEVNVIPPHTPVR	702	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:21	ms_run[2]:scan=11217	62.49	3	2123.0412	2123.0412	R	T	359	377
PSM	KSNLDEEVNVIPPHTPVR	703	sp|P06400|RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:21	ms_run[2]:scan=11385	63.501	3	2123.0412	2123.0412	R	T	359	377
PSM	LDELRDEGK	704	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2913	16.23	2	1073.5353	1073.5353	K	A	206	215
PSM	LFRPPSPAPAAPGAR	705	sp|Q86U90|YRDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=9599	52.867	3	1583.7974	1583.7974	R	L	32	47
PSM	LGGLRPESPESLTSVSR	706	sp|Q9H6F5|CCD86_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=12733	71.997	3	1863.9092	1863.9092	R	T	11	28
PSM	LKDLFDYSPPLHK	707	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=15876	93.323	2	1651.8011	1651.8011	K	N	503	516
PSM	LRSSLVFKPTLPEQK	708	sp|Q5T0W9|FA83B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=13307	75.668	3	1821.9754	1821.9754	R	E	540	555
PSM	NHLLQFALESPAKSPASSSSK	709	sp|Q9NS91|RAD18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:21	ms_run[2]:scan=13919	79.688	3	2278.0995	2278.0995	R	N	90	111
PSM	NHSGSRTPPVALNSSR	710	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21	ms_run[2]:scan=4123	22.445	2	1758.8163	1758.8163	R	M	2098	2114
PSM	NRLSEEFLTAHPR	711	sp|Q15813|TBCE_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=11271	62.771	3	1648.7723	1648.7723	K	Y	405	418
PSM	PGAEGAPLLPPPLPPPSPPGSGR	712	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	17-UNIMOD:21	ms_run[2]:scan=16323	96.699	3	2237.1246	2237.1246	R	G	27	50
PSM	PKSPSSGSGGGGPKPYK	713	sp|Q9ULD5|ZN777_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=1216	7.811	3	1666.7716	1666.7716	R	C	621	638
PSM	RAGDLLEDSPK	714	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=6509	35.412	2	1279.5809	1279.5809	R	R	150	161
PSM	RAGDLLEDSPKR	715	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=4975	26.985	3	1435.6821	1435.6821	R	P	150	162
PSM	RAPSVANVGSHCDLSLK	716	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9993	55.171	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RFSLAPPKEER	717	sp|Q9P219|DAPLE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=8573	47.106	2	1408.6864	1408.6864	R	L	1885	1896
PSM	RGSGHPAYAEVEPVGEK	718	sp|Q6UX71-3|PXDC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=6891	37.618	3	1861.836	1861.8360	R	E	126	143
PSM	RGSLSNAGDPEIVK	719	sp|O43847|NRDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=7401	40.446	2	1521.7188	1521.7188	R	S	92	106
PSM	RGSMEQAPAVALPPTHK	720	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7255	39.667	3	1884.8917	1884.8917	R	K	524	541
PSM	RGSMEQAPAVALPPTHK	721	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7486	40.887	2	1884.8917	1884.8917	R	K	524	541
PSM	RHSSPSSPTSPK	722	sp|O94921-3|CDK14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=745	5.992	3	1346.598	1346.5980	R	F	71	83
PSM	RHSTSDLSDATFSDIR	723	sp|Q9P227-2|RHG23_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=11298	62.943	2	1886.816	1886.8160	K	R	675	691
PSM	RHSVSEMTSCPEPQGFSDPPGQGPTGTFR	724	sp|P85299-2|PRR5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,10-UNIMOD:4	ms_run[2]:scan=12600	71.159	3	3225.3645	3225.3645	R	S	179	208
PSM	RHSVTLPSSK	725	sp|Q07352|TISB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=2838	15.861	2	1190.5809	1190.5809	R	F	52	62
PSM	RISHSLYSGIEGLDESPSR	726	sp|Q8TEW0-9|PARD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21	ms_run[2]:scan=13906	79.604	3	2182.0056	2182.0056	R	N	700	719
PSM	RKPSPEPEGEVGPPK	727	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=3794	20.659	3	1682.8029	1682.8029	K	I	341	356
PSM	RKPSPEPEGEVGPPK	728	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=4731	25.724	3	1682.8029	1682.8029	K	I	341	356
PSM	RKTFVSDLLPPTDK	729	sp|Q7Z4Q2-3|HEAT3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=12859	72.801	3	1695.8597	1695.8597	R	E	252	266
PSM	RLSGQPSAGLVPITHVAK	730	sp|Q9H3Y6|SRMS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=11551	64.512	2	1910.0139	1910.0139	R	A	92	110
PSM	RLSNSSLCSIEEEHR	731	sp|Q2PPJ7-3|RGPA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,8-UNIMOD:4	ms_run[2]:scan=9524	52.431	3	1895.8197	1895.8197	R	M	371	386
PSM	RPAAAAAAGSASPR	732	sp|Q96S55-2|WRIP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:21	ms_run[2]:scan=1286	8.1027	2	1332.63	1332.6300	K	S	142	156
PSM	RPILQLSPPGPR	733	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21	ms_run[2]:scan=13196	74.942	2	1409.7544	1409.7544	R	G	12	24
PSM	RPKSNIAVEGR	734	sp|Q8TEH3-7|DEN1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=1805	10.497	3	1305.6554	1305.6554	K	R	465	476
PSM	RPSLPSSPSPGLPK	735	sp|O43294-2|TGFI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=9956	54.943	2	1498.7545	1498.7545	K	A	118	132
PSM	RPTLGVQLDDKR	736	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=8423	46.201	3	1476.745	1476.7450	R	K	326	338
PSM	RPVSPGKDITAR	737	sp|P31629|ZEP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=3685	20.086	3	1375.6973	1375.6973	R	R	2115	2127
PSM	RRDSDGVDGFEAEGK	738	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=5854	31.715	3	1716.7105	1716.7105	R	K	1051	1066
PSM	RRDSDGVDGFEAEGK	739	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=6043	32.741	3	1716.7105	1716.7105	R	K	1051	1066
PSM	RRDSGDNSAPSGQER	740	sp|Q8IXQ3|CI040_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=610	5.4672	2	1710.7071	1710.7071	K	E	73	88
PSM	RRSPSPAPPPR	741	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,5-UNIMOD:21	ms_run[2]:scan=1050	7.1475	3	1376.6115	1376.6115	R	R	558	569
PSM	RSPPPGPDGHAK	742	sp|P57081-3|WDR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21	ms_run[2]:scan=771	6.0856	2	1294.5819	1294.5819	R	K	244	256
PSM	RSTVLGLPQHVQK	743	sp|Q9P206|K1522_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=8295	45.452	2	1541.8079	1541.8079	R	E	160	173
PSM	RSYDVPPPPMEPDHPFYSNISK	744	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21	ms_run[2]:scan=14537	83.923	3	2652.172	2652.1720	R	D	117	139
PSM	RTPTMPQEEAAACPPHILPPEK	745	sp|Q9NYV4|CDK12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21,5-UNIMOD:35,13-UNIMOD:4	ms_run[2]:scan=11356	63.316	3	2565.1757	2565.1757	R	R	1243	1265
PSM	RVHSENNACINFK	746	sp|O94921-3|CDK14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=5587	30.23	3	1667.7239	1667.7239	K	T	46	59
PSM	RVPVAAAEVPGAAAEEAPGRDPSPVAPPDGR	747	sp|Q717R9|CYS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	23-UNIMOD:21	ms_run[2]:scan=11624	64.954	3	3085.4982	3085.4982	R	D	37	68
PSM	RYSDHAGPAIPSVVAYPK	748	sp|P27448-6|MARK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:21	ms_run[2]:scan=12760	72.171	3	2006.9615	2006.9615	R	R	401	419
PSM	SEVQQPVHPKPLSPDSR	749	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	16-UNIMOD:21	ms_run[2]:scan=6283	34.079	2	1979.9466	1979.9466	K	A	350	367
PSM	SHSGPAGSFNKPAIR	750	sp|Q9UJM3|ERRFI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=6553	35.686	3	1604.7461	1604.7461	R	I	249	264
PSM	SPMQAVHPVHVK	751	sp|Q9H334-6|FOXP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21,3-UNIMOD:35	ms_run[2]:scan=3174	17.555	2	1424.6636	1424.6636	R	E	549	561
PSM	SPSPPLPTHIPPEPPR	752	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=12468	70.264	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	753	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=13094	74.29	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	754	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=13882	79.466	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	755	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=14184	81.484	3	1797.8815	1797.8815	R	T	326	342
PSM	SRSPIIHSPK	756	sp|O94913|PCF11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21	ms_run[2]:scan=3076	17.085	2	1200.6016	1200.6016	K	R	487	497
PSM	SSQRHSPPFSK	757	sp|Q8WV28-3|BLNK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=2158	12.235	2	1336.5925	1336.5925	R	T	124	135
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	758	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:21	ms_run[2]:scan=9236	50.791	3	3112.5078	3112.5078	R	S	818	847
PSM	THSKPLPPLTAK	759	sp|Q9Y2U8|MAN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=5337	28.867	2	1368.7167	1368.7167	R	S	289	301
PSM	THTRVSVQR	760	sp|P15880|RS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=1198	7.7448	2	1162.5608	1162.5608	K	T	276	285
PSM	TPKDSPGIPPSANAHQLFR	761	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21	ms_run[2]:scan=11462	63.962	3	2112.0154	2112.0154	K	G	365	384
PSM	VCFAQHTPSLPAESPRPLK	762	sp|P51790-4|CLCN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	2-UNIMOD:4,14-UNIMOD:21	ms_run[2]:scan=12155	68.269	3	2214.0657	2214.0657	R	L	705	724
PSM	VHASRPASLDSGR	763	sp|Q3V6T2-5|GRDN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=2641	14.858	2	1431.662	1431.6620	R	T	1579	1592
PSM	VHIEIGPDGR	764	sp|P55795|HNRH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=7591	41.482	2	1091.5724	1091.5724	R	V	317	327
PSM	VKPASPVAQPK	765	sp|Q96EV2|RBM33_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21	ms_run[2]:scan=1995	11.398	2	1200.6268	1200.6268	K	E	761	772
PSM	VLMKSPSPALHPPQK	766	sp|Q9H6S0|YTDC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=5811	31.484	3	1724.8685	1724.8685	R	Y	1217	1232
PSM	VPGSSGHLHK	767	sp|Q9UEW8-2|STK39_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:21	ms_run[2]:scan=1333	8.3107	2	1097.5019	1097.5019	R	T	348	358
PSM	WHQPPPSPLPLR	768	sp|Q68DK7-3|MSL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21	ms_run[2]:scan=11449	63.885	3	1503.7388	1503.7388	R	E	173	185
PSM	YGPLKPLPQTPHLEEDLK	769	sp|P10244-2|MYBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=14283	82.165	3	2154.0762	2154.0762	K	E	505	523
PSM	DKDDDEVFEKK	770	sp|Q04637|IF4G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=3676	20.028086666666667	3	1368.653451	1366.625240	K	Q	854	865
PSM	AFKPEETSSNSDPPSPPVLNNSHPVPR	771	sp|O60293|ZC3H1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	15-UNIMOD:21	ms_run[1]:scan=10904	60.605331666666665	3	2981.369011	2979.376381	R	S	641	668
PSM	QERLSPEVAPPAHR	772	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28,5-UNIMOD:21	ms_run[1]:scan=6145	33.31061833333334	3	1648.7412	1648.7722	K	R	31	45
PSM	SETAPAETATPAPVEKSPAK	773	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=7340	40.11366666666667	2	2102.9775	2102.9768	M	K	2	22
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	774	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14665	84.783785	3	3458.399045	3459.429735	K	L	104	135
PSM	SASVNKEPVSLPGIMR	775	sp|Q8WWI1|LMO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:21,15-UNIMOD:35	ms_run[1]:scan=12207	68.5817	2	1779.860096	1779.859037	R	R	1491	1507
PSM	HPPVLTPPDQEVIR	776	sp|P05771-2|KPCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:21	ms_run[1]:scan=12306	69.21673333333334	2	1676.829293	1676.828722	R	N	636	650
PSM	RPSQNAISFFNVGHSK	777	sp|Q9BXB4|OSB11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	3-UNIMOD:21	ms_run[1]:scan=14383	82.84428833333332	3	1868.8572	1867.8722	R	L	187	203
PSM	RGSMEQAPAVALPPTHK	778	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:21,4-UNIMOD:35	ms_run[1]:scan=7260	39.68905833333333	3	1885.893449	1884.891734	R	K	524	541
PSM	SHVSSEPYEPISPPQVPVVHEK	779	sp|O75376|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	12-UNIMOD:21	ms_run[1]:scan=13330	75.81577166666666	3	2522.192766	2521.189021	R	Q	2140	2162
PSM	RDSLQKPGLEAPPR	780	sp|Q9NRM7|LATS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:21	ms_run[1]:scan=7081	38.70063	3	1642.818721	1642.819220	R	A	378	392
PSM	QKTPPPVAPKPAVK	781	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5684	30.750733333333333	3	1519.8152	1519.8158	K	S	753	767
PSM	QKTPPPVAPKPAVK	782	sp|Q9UMS6|SYNP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=5662	30.61962	2	1519.8165	1519.8158	K	S	753	767
PSM	QSPGSTSPKPPHTLSR	783	sp|O43159|RRP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28,7-UNIMOD:21	ms_run[1]:scan=5988	32.431375	2	1738.8038	1738.8034	K	K	170	186
PSM	HLPGPGQQPGPWGPEQASSPAR	784	sp|Q63HR2|TNS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	19-UNIMOD:21	ms_run[1]:scan=11596	64.79002666666668	3	2330.055160	2330.059344	R	G	1078	1100
PSM	LNGPQDHSHLLYSTIPR	785	sp|O60716|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	14-UNIMOD:21	ms_run[1]:scan=12082	67.82364333333334	3	2026.966929	2026.962590	K	M	85	102
PSM	VIPAKSPPPPTHSTQLGAPSR	786	sp|Q14814|MEF2D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	6-UNIMOD:21	ms_run[1]:scan=6593	35.91457	3	2218.134264	2217.130718	K	K	246	267
PSM	KIPVFHNGSTPTLGETPK	787	sp|Q9Y6M7|S4A7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	9-UNIMOD:21	ms_run[1]:scan=12121	68.062685	2	2002.977377	2001.992493	R	E	548	566
PSM	VHIPNDDAQFDASHCDSDK	788	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	15-UNIMOD:4	ms_run[1]:scan=8726	47.93554666666667	3	2170.885910	2169.902161	R	G	83	102
PSM	QCPPGRPYPHQDSIPSLEPGSHSK	789	sp|Q6GQQ9|OTU7B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28,2-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=11566	64.60109666666666	3	2733.2008	2733.2001	R	D	733	757
PSM	LGSFGSITR	790	sp|Q14315|FLNC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:21	ms_run[1]:scan=12187	68.45878	2	1016.468226	1016.469212	R	Q	2231	2240
PSM	RVKTNVPVK	791	sp|Q9UKM9|RALY_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:21	ms_run[1]:scan=1228	7.85888	2	1119.616554	1119.616545	R	L	157	166
PSM	KKEPLIISK	792	sp|P55285|CADH6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:21	ms_run[1]:scan=5002	27.126133333333332	2	1134.641712	1134.641362	R	E	641	650
PSM	RHSVTLPSSK	793	sp|Q07352|TISB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	3-UNIMOD:21	ms_run[1]:scan=3115	17.302564999999998	2	1190.580621	1190.580887	R	F	52	62
PSM	YHGHSMSDPGVSYR	794	sp|P29803|ODPAT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:21	ms_run[1]:scan=3487	18.97856	3	1672.622598	1671.650106	R	T	287	301
PSM	TVSVRAAIPSTILR	795	sp|Q6ZV29|PLPL7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:21,10-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=18997	117.78974166666667	2	1722.791628	1722.787205	K	L	232	246
PSM	KKEPAITSQNSPEAR	796	sp|P23193|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	11-UNIMOD:21	ms_run[1]:scan=3250	17.91015666666667	3	1734.829519	1734.830179	K	E	90	105
PSM	RLSTSPDVIQGHQPR	797	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:21	ms_run[1]:scan=7918	43.34982166666667	2	1770.840300	1769.857397	R	D	264	279
PSM	RCSAGLGALAQRPGSVSK	798	sp|Q9NXV2|KCTD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	2-UNIMOD:4,3-UNIMOD:21	ms_run[1]:scan=9091	50.01224666666667	3	1893.920668	1893.924431	R	W	27	45
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	799	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=13933	79.78092833333334	3	3460.415661	3459.429735	K	L	104	135
PSM	AAPPPPPPPPPLESSPR	800	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=10228	56.579	3	1782.8706	1782.8706	K	V	606	623
PSM	AHSLKPSIK	801	sp|Q8WXG6-6|MADD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=3173	17.552	2	1059.5478	1059.5478	K	E	1175	1184
PSM	ALRPGDLPPSPDDVKR	802	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=8346	45.743	3	1811.8931	1811.8931	R	R	299	315
PSM	ALRPGDLPPSPDDVKR	803	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=9191	50.555	3	1811.8931	1811.8931	R	R	299	315
PSM	APSHMSSSHSFPQLAR	804	sp|Q9Y2J4-3|AMOL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=7428	40.593	2	1834.7822	1834.7822	R	N	174	190
PSM	APTVPPPLPPTPPQPAR	805	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=12009	67.358	2	1811.9335	1811.9335	R	R	616	633
PSM	APTVPPPLPPTPPQPAR	806	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=12186	68.455	3	1811.9335	1811.9335	R	R	616	633
PSM	APTVPPPLPPTPPQPAR	807	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=12484	70.375	2	1811.9335	1811.9335	R	R	616	633
PSM	APTVPPPLPPTPPQPAR	808	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=12171	68.366	2	1811.9335	1811.9335	R	R	616	633
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	809	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=12924	73.19	3	3459.4297	3459.4297	K	L	104	135
PSM	DHNEEEGEETGLRDEK	810	sp|Q32MZ4-3|LRRF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=3111	17.282	3	1885.7926	1885.7926	R	P	441	457
PSM	DNQDREENDKDPER	811	sp|Q14152-2|EIF3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=708	5.8504	3	1758.7405	1758.7405	R	E	1178	1192
PSM	DVDDFFEHER	812	sp|Q9UNH7-2|SNX6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=12939	73.285	2	1307.5418	1307.5418	K	T	89	99
PSM	EEHGGLIRSPR	813	sp|P26368-2|U2AF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=3912	21.327	2	1329.6191	1329.6191	K	H	71	82
PSM	EEQTDTSDGESVTHHIR	814	sp|P36915|GNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=5119	27.749	2	2019.8171	2019.8171	R	R	45	62
PSM	ELGTHLGHSSPQIR	815	sp|Q2M1Z3|RHG31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=6504	35.386	3	1610.7566	1610.7566	K	Q	1045	1059
PSM	GPPSPPAPVMHSPSR	816	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:21	ms_run[2]:scan=7354	40.184	2	1592.7171	1592.7171	R	K	221	236
PSM	GPPSPPAPVMHSPSR	817	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=7903	43.257	3	1592.7171	1592.7171	R	K	221	236
PSM	GPSLGASSHQHSR	818	sp|P49450-2|CENPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=1367	8.4741	2	1399.5994	1399.5994	R	R	30	43
PSM	GRPPAEKLSPNPPK	819	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=3821	20.81	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPK	820	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=4034	22.001	2	1566.7919	1566.7919	R	L	1369	1383
PSM	GRPPAEKLSPNPPNLTK	821	sp|P51532-5|SMCA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=8244	45.161	2	1894.9666	1894.9666	R	K	1411	1428
PSM	GSGGGGGPQVPHQSPPKR	822	sp|Q9NYF3|FA53C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=3720	20.293	3	1778.8213	1778.8213	R	V	149	167
PSM	HADHSSLTLGSGSSTTR	823	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=4303	23.382	3	1792.7741	1792.7741	R	L	2522	2539
PSM	HAHSSSLQQAASR	824	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=1370	8.4936	2	1458.6365	1458.6365	K	S	248	261
PSM	HELSPPQKR	825	sp|Q9BXP5-5|SRRT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=1647	9.7597	2	1170.5547	1170.5547	R	M	71	80
PSM	HGTGISVIQHTNSLSR	826	sp|P15822|ZEP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:21	ms_run[2]:scan=8553	46.976	3	1785.8523	1785.8523	R	P	1129	1145
PSM	HLTHAQSTLDAK	827	sp|Q15125|EBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=1666	9.8396	2	1400.6449	1400.6449	K	A	210	222
PSM	HNDLDDVGK	828	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=2893	16.128	2	1011.4621	1011.4621	K	D	82	91
PSM	HPEPVPEEGSEDELPPQVHK	829	sp|Q7Z3C6-2|ATG9A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=10055	55.523	3	2329.0264	2329.0264	R	V	758	778
PSM	HRGSADYSMEAK	830	sp|Q04726-2|TLE3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=972	6.8396	3	1446.5599	1446.5599	K	K	214	226
PSM	HRPSPPATPPPK	831	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1644	9.7414	3	1440.6316	1440.6316	R	T	399	411
PSM	HRPSPPATPPPK	832	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1189	7.7061	3	1440.6316	1440.6316	R	T	399	411
PSM	HSPQPSPSSSFNEGLLTGGHR	833	sp|Q9Y2J4-3|AMOL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=12147	68.226	3	2271.007	2271.0070	R	H	599	620
PSM	HTSAREPSAFTLPPPR	834	sp|Q8TE67-2|ES8L3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10351	57.274	3	1842.8778	1842.8778	R	R	212	228
PSM	IFQGSFGGPTLYENPHYQSPNMHR	835	sp|Q8TDN6|BRX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	19-UNIMOD:21,22-UNIMOD:35	ms_run[2]:scan=14249	81.932	3	2872.2429	2872.2429	K	R	243	267
PSM	IGHHSTSDDSSAYR	836	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=1366	8.4705	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	837	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=1806	10.501	2	1611.6315	1611.6315	R	S	333	347
PSM	IHSLTHLDSVTK	838	sp|P46736-4|BRCC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=8730	47.956	3	1429.6966	1429.6966	R	I	136	148
PSM	IKGEHPGLSIGDVAK	839	sp|P09429|HMGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=10000	55.216	2	1599.8022	1599.8022	K	K	113	128
PSM	KADRDQSPFSK	840	sp|Q13427|PPIG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=2211	12.522	2	1357.6027	1357.6027	K	I	681	692
PSM	KEHISAENMSLETLR	841	sp|Q13426-2|XRCC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=11277	62.806	3	1836.8441	1836.8441	K	N	309	324
PSM	KGSFGLHAQPEFLR	842	sp|Q9BZ71-2|PITM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=13904	79.592	2	1665.8028	1665.8028	R	K	496	510
PSM	KHSQTDLVSR	843	sp|O14683|P5I11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=1961	11.249	3	1249.5816	1249.5816	K	L	12	22
PSM	KKEPAITSQNSPEAR	844	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=2366	13.376	2	1734.8302	1734.8302	K	E	69	84
PSM	KKEPAITSQNSPEAR	845	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=3001	16.7	3	1734.8302	1734.8302	K	E	69	84
PSM	KLHSPTSSAK	846	sp|Q0IIM8|TBC8B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=688	5.7737	2	1134.5434	1134.5434	R	G	1032	1042
PSM	KLMHSSSLTNSSIPR	847	sp|Q08499-5|PDE4D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=6359	34.538	2	1752.823	1752.8230	K	F	67	82
PSM	KLPPPPPQAPPEEENESEPEEPSGVEGAAFQSR	848	sp|O60341|KDM1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	17-UNIMOD:21	ms_run[2]:scan=13053	74.022	3	3605.6199	3605.6199	K	L	150	183
PSM	KLSPPPLPPR	849	sp|O00750|P3C2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10089	55.747	2	1180.6369	1180.6369	K	A	153	163
PSM	KLSPPPLPPR	850	sp|O00750|P3C2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10435	57.778	2	1180.6369	1180.6369	K	A	153	163
PSM	KLSPPPLPPR	851	sp|O00750|P3C2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10606	58.786	2	1180.6369	1180.6369	K	A	153	163
PSM	KLSPPPLPPR	852	sp|O00750|P3C2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10774	59.801	2	1180.6369	1180.6369	K	A	153	163
PSM	KLSPPPLPPR	853	sp|O00750|P3C2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=11281	62.835	2	1180.6369	1180.6369	K	A	153	163
PSM	KPIDSLRDSR	854	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=3272	18.016	2	1265.6129	1265.6129	R	S	2680	2690
PSM	KRLSQSDEDVIR	855	sp|Q9H7D7-3|WDR26_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=5345	28.906	3	1524.7297	1524.7297	K	L	118	130
PSM	KRPEPSSDYDLSPAK	856	sp|Q6W2J9-4|BCOR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:21	ms_run[2]:scan=5702	30.859	3	1768.8033	1768.8033	R	Q	1347	1362
PSM	KSPSGPVKSPPLSPVGTTPVK	857	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=9540	52.529	3	2139.1341	2139.1341	R	L	177	198
PSM	KSPSGPVKSPPLSPVGTTPVK	858	sp|Q9BVC5-2|ASHWN_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=9718	53.552	3	2139.1341	2139.1341	R	L	177	198
PSM	KTSGPLSPPTGPPGPAPAGPAVR	859	sp|P49815-7|TSC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=11591	64.758	3	2188.1042	2188.1042	K	L	609	632
PSM	KYEEVCEEVLHAK	860	sp|Q9BZF9-2|UACA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:4	ms_run[2]:scan=9347	51.409	3	1632.7818	1632.7818	R	K	1240	1253
PSM	KYSDASDCHGEDSQAFCEK	861	sp|P01023|A2MG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:4,17-UNIMOD:4	ms_run[2]:scan=4738	25.76	3	2232.8688	2232.8688	R	F	271	290
PSM	LFRPPSPAPAAPGAR	862	sp|Q86U90|YRDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=9626	53.03	2	1583.7974	1583.7974	R	L	32	47
PSM	LKAEPAAPPAAPSTPAPPPAVPK	863	sp|P48634-4|PRC2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=9827	54.187	3	2254.1763	2254.1763	R	E	504	527
PSM	LKEEHGIELSSPR	864	sp|O14647-2|CHD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=6652	36.247	2	1573.7501	1573.7501	R	H	1355	1368
PSM	LKSEDELRPEVDEHTQK	865	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=6344	34.447	2	2131.9787	2131.9787	R	T	616	633
PSM	LLRPLSPVTPPPPNSGSK	866	sp|Q9C0A6-2|SETD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=11293	62.911	3	1936.0183	1936.0183	K	S	736	754
PSM	LRGTQEVAPPTPLTPTSHTANTSPR	867	sp|P48730-2|KC1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=9634	53.072	3	2708.3283	2708.3283	R	P	334	359
PSM	LRSCSVTDAVAEQGHLPPPSAPAGR	868	sp|Q96PU5-4|NED4L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,4-UNIMOD:4	ms_run[2]:scan=11689	65.352	3	2652.2479	2652.2479	R	A	217	242
PSM	LSVHDMKPLDSPGR	869	sp|Q15643|TRIPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=9709	53.501	3	1630.7538	1630.7538	K	R	1881	1895
PSM	MHIEKDETPLSTPTAR	870	sp|Q9UI36-2|DACH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35,8-UNIMOD:21	ms_run[2]:scan=5061	27.464	2	1920.8652	1920.8652	R	D	519	535
PSM	MHIEKDETPLSTPTAR	871	sp|Q9UI36-2|DACH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35,12-UNIMOD:21	ms_run[2]:scan=5830	31.58	3	1920.8652	1920.8652	R	D	519	535
PSM	NAGSAVTMSDEHANKPAESPTSVLEKPDR	872	sp|Q9C0G0-3|ZN407_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=8688	47.731	3	3133.4023	3133.4023	K	G	934	963
PSM	PGAEGAPLLPPPLPPPSPPGSGR	873	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	17-UNIMOD:21	ms_run[2]:scan=16049	94.686	3	2237.1246	2237.1246	R	G	27	50
PSM	PRHSVASLESIVNEAK	874	sp|P29375-2|KDM5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=13815	79.02	3	1815.888	1815.8880	R	N	967	983
PSM	PTSPEKFSVPHVCAR	875	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=10410	57.628	3	1790.8175	1790.8175	R	F	1439	1454
PSM	RASLSHPR	876	sp|P28799-3|GRN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=1088	7.2956	2	1002.476	1002.4760	R	D	253	261
PSM	RATREEPPGAPFAENTAER	877	sp|O15047|SET1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=8083	44.285	3	2177.9855	2177.9855	R	F	386	405
PSM	REDSYHVR	878	sp|P49760-2|CLK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=1606	9.5715	2	1140.4713	1140.4713	R	S	47	55
PSM	RESPSPAPKPR	879	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=1352	8.4085	3	1300.6289	1300.6289	K	K	448	459
PSM	RETFVLKDSPVR	880	sp|Q6PGN9-2|PSRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=8770	48.177	3	1525.7654	1525.7654	R	D	114	126
PSM	RFSALEQGIHPPQAQSK	881	sp|P18627|LAG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=12348	69.462	3	1972.952	1972.9520	R	I	482	499
PSM	RFSDHAGPSIPPAVSYTK	882	sp|Q9P0L2-2|MARK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=11020	61.297	3	2008.9408	2008.9408	R	R	286	304
PSM	RGFEGSCSQKESEEGNPVR	883	sp|O43719|HTSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:4,12-UNIMOD:21	ms_run[2]:scan=4662	25.307	3	2231.9267	2231.9267	K	G	474	493
PSM	RGHTASESDEQQWPEEK	884	sp|Q9NTI5-2|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=5303	28.674	3	2092.8487	2092.8487	K	R	1252	1269
PSM	RGSMEQAPAVALPPTHK	885	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7447	40.693	3	1884.8917	1884.8917	R	K	524	541
PSM	RGSMEQAPAVALPPTHK	886	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=7873	43.085	3	1884.8917	1884.8917	R	K	524	541
PSM	RGSMEQAPAVALPPTHK	887	sp|Q8WUF5|IASPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,4-UNIMOD:35	ms_run[2]:scan=8438	46.288	3	1884.8917	1884.8917	R	K	524	541
PSM	RHDSDTFPELK	888	sp|P38398-8|BRCA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=8550	46.96	2	1423.6133	1423.6133	K	L	644	655
PSM	RHTSAEEEEPPPVK	889	sp|Q9BZ95-3|NSD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=2626	14.783	3	1684.7458	1684.7458	R	I	454	468
PSM	RKEDEVSIGSAPLAK	890	sp|Q7Z7G8-2|VP13B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=8872	48.779	2	1678.8291	1678.8291	R	Q	993	1008
PSM	RKPSPEPEGEVGPPK	891	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=4355	23.689	3	1682.8029	1682.8029	K	I	341	356
PSM	RKPSPEPEGEVGPPK	892	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=5207	28.223	3	1682.8029	1682.8029	K	I	341	356
PSM	RKSTSNLADLR	893	sp|Q96N96-6|SPT13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=4981	27.012	3	1339.6609	1339.6609	K	T	268	279
PSM	RLPDAHSDYAR	894	sp|Q96PK6|RBM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=3951	21.524	3	1379.5983	1379.5983	R	Y	637	648
PSM	RLQPSTPEKK	895	sp|Q9UM11-3|FZR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=1035	7.0891	3	1262.6384	1262.6384	R	G	116	126
PSM	RLSEQLAHTPTAFK	896	sp|Q9UBF8-3|PI4KB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10916	60.675	3	1677.824	1677.8240	R	R	177	191
PSM	RLSGQPSAGLVPITHVAK	897	sp|Q9H3Y6|SRMS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=11496	64.172	3	1910.0139	1910.0139	R	A	92	110
PSM	RLSKPGTAAELR	898	sp|Q5JSL3|DOC11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=4915	26.69	3	1377.713	1377.7130	K	Q	10	22
PSM	RLSSTSLASGHSVR	899	sp|Q9BZL6-2|KPCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:21	ms_run[2]:scan=4817	26.165	2	1536.741	1536.7410	R	L	38	52
PSM	RNSIEVAGLSHGLEGLR	900	sp|Q16825|PTN21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=14894	86.32	3	1886.9364	1886.9364	K	L	635	652
PSM	RNTLQLHR	901	sp|P61313|RL15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=3369	18.443	2	1116.5553	1116.5553	R	Y	195	203
PSM	RPAEATSSPTSPERPR	902	sp|Q9BU76|MMTA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=1783	10.397	2	1817.8421	1817.8421	R	H	210	226
PSM	RPILQLSPPGPR	903	sp|Q8N3X1|FNBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=13115	74.418	3	1409.7544	1409.7544	R	G	12	24
PSM	RPQPYPYPSKK	904	sp|Q9H3N1|TMX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=4039	22.03	3	1439.6963	1439.6963	R	L	213	224
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	905	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=9038	49.701	3	2602.1925	2602.1925	R	F	118	143
PSM	RPTLGVQLDDKR	906	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=8785	48.258	3	1476.745	1476.7450	R	K	326	338
PSM	RQQEGFKGTFPDAR	907	sp|Q15233-2|NONO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=8064	44.197	3	1715.7781	1715.7781	R	E	276	290
PSM	RRESLSYIPK	908	sp|A1L390-2|PKHG3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=7116	38.908	2	1327.665	1327.6650	R	G	271	281
PSM	RRPESAPAESSPSK	909	sp|Q07889|SOS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=1056	7.1684	3	1577.7199	1577.7199	R	I	1157	1171
PSM	RSSPSARPPDVPGQQPQAAK	910	sp|Q96JP5-2|ZFP91_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=5082	27.579	2	2153.0379	2153.0379	R	S	81	101
PSM	RSSQPPADRDPAPFR	911	sp|Q10570|CPSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=5963	32.297	2	1775.8104	1775.8104	R	A	764	779
PSM	RSYDVPPPPMEPDHPFYSNISK	912	sp|P18669|PGAM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=13002	73.687	3	2668.1669	2668.1669	R	D	117	139
PSM	RTPGNQTPVMPSASPILHSQGK	913	sp|Q9UIF8-4|BAZ2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=9241	50.822	3	2398.1464	2398.1464	R	E	347	369
PSM	RVHSENNACINFK	914	sp|O94921-3|CDK14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,9-UNIMOD:4	ms_run[2]:scan=5606	30.316	2	1667.7239	1667.7239	K	T	46	59
PSM	SESPKEPEQLR	915	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=4591	24.941	3	1378.613	1378.6130	K	K	4	15
PSM	SGHHPGETPPLITPGSAQS	916	sp|Q14802|FXYD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21	ms_run[2]:scan=9217	50.691	2	1948.868	1948.8680	K	-	69	88
PSM	SLGVDMDDKDDAHYAVQAR	917	sp|Q9BZE4-3|NOG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:35	ms_run[2]:scan=7781	42.52	3	2120.9433	2120.9433	R	R	410	429
PSM	SLVHRLSDGDMTSALR	918	sp|Q8WXE1-2|ATRIP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=9077	49.935	2	1852.8503	1852.8503	R	G	512	528
PSM	SPPDQPAVPHPPPSTPIK	919	sp|P35611-2|ADDA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	15-UNIMOD:21	ms_run[2]:scan=9195	50.574	2	1940.9397	1940.9397	K	L	600	618
PSM	SPSPPLPTHIPPEPPR	920	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=12314	69.26	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	921	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=13560	77.328	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	922	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=14032	80.474	3	1797.8815	1797.8815	R	T	326	342
PSM	SRSPIIHSPK	923	sp|O94913|PCF11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:21	ms_run[2]:scan=3274	18.022	3	1200.6016	1200.6016	K	R	487	497
PSM	SSSDPPAVHPPLPPLR	924	sp|O43150|ASAP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:21	ms_run[2]:scan=13297	75.614	2	1745.8502	1745.8502	R	V	820	836
PSM	SSSLEGFHNHFK	925	sp|Q13480|GAB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:21	ms_run[2]:scan=8524	46.787	2	1468.6136	1468.6136	R	V	417	429
PSM	STAQQELDGKPASPTPVIVASHTANK	926	sp|P35606-2|COPB2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:21	ms_run[2]:scan=9295	51.117	3	2726.3276	2726.3276	R	E	818	844
PSM	TPFHTSLHQGTSK	927	sp|Q08495-3|DEMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	6-UNIMOD:21	ms_run[2]:scan=5256	28.44	3	1519.6821	1519.6821	R	S	249	262
PSM	TPKDSPGIPPSANAHQLFR	928	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=11627	64.969	3	2112.0154	2112.0154	K	G	365	384
PSM	VLHTALHSSSSYR	929	sp|Q96S82|UBL7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=4764	25.89	2	1536.7086	1536.7086	R	E	115	128
PSM	VLLLEANRHSPGPER	930	sp|Q9UDT6-2|CLIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=8769	48.173	3	1766.8829	1766.8829	R	D	879	894
PSM	WGQPPSPTPVPRPPDADPNTPSPK	931	sp|Q14839|CHD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	20-UNIMOD:21	ms_run[2]:scan=11972	67.127	3	2614.2217	2614.2217	K	P	510	534
PSM	YHGHSMSDPGVSYR	932	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3537	19.306	3	1687.645	1687.6450	R	T	258	272
PSM	YHGHSMSDPGVSYR	933	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=3753	20.458	2	1687.645	1687.6450	R	T	258	272
PSM	RESPSPAPKPR	934	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:21	ms_run[1]:scan=1347	8.385233333333332	2	1300.629390	1300.628900	K	K	448	459
PSM	RKPSPEPEGEVGPPK	935	sp|Q7Z5L9|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:21	ms_run[1]:scan=4488	24.398113333333335	2	1682.803508	1682.802901	K	I	357	372
PSM	AFKPEETSSNSD	936	sp|O60293|ZC3H1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20		ms_run[1]:scan=2891	16.1158	2	1310.5617	1310.5621	R	P	641	653
PSM	APTVPPPLPPTPPQPAR	937	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:21	ms_run[1]:scan=13483	76.83725666666666	2	1812.939775	1811.933522	R	R	616	633
PSM	MLPHAPGVQMQAIPEDAIPEESGDEDEDDPDKR	938	sp|Q13547|HDAC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:35,10-UNIMOD:35,22-UNIMOD:21	ms_run[1]:scan=13099	74.32520833333334	3	3742.564073	3742.565183	R	I	372	405
PSM	RPTLGVQLDDKR	939	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	3-UNIMOD:21	ms_run[1]:scan=8322	45.595105	3	1476.7430	1476.7445	R	K	326	338
PSM	GHTDTEGRPPSPPPTSTPEK	940	sp|Q00613|HSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:21	ms_run[1]:scan=4405	23.966643333333334	3	2167.961359	2166.958293	R	C	353	373
PSM	KPHTESLELQVR	941	sp|Q9BSJ8|ESYT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:21	ms_run[1]:scan=8056	44.15265	3	1516.746590	1515.744658	R	G	855	867
PSM	KFSGFSAKPNNSGEAPSSPTPK	942	sp|P49916|DNLI3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	18-UNIMOD:21	ms_run[1]:scan=7583	41.42718833333333	3	2315.049102	2314.063092	R	R	225	247
PSM	QVNQISGAHNTSDKQTPSKPK	943	sp|Q9NZJ0|DTL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28,18-UNIMOD:21	ms_run[1]:scan=4352	23.672826666666666	3	2327.0912	2327.0902	R	K	181	202
PSM	HKELSVLLLEMK	944	sp|Q14789|GOGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	5-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=13790	78.85478499999999	3	1534.7820	1534.7825	K	E	556	568
PSM	LQDTNSFFAGNQAKR	945	sp|Q96S95|CK2N2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	4-UNIMOD:21	ms_run[1]:scan=948	6.741136666666667	2	1775.7842	1775.7982	R	P	30	45
PSM	VMEEEGLKDEEKR	946	sp|Q15208|STK38_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:35	ms_run[1]:scan=2675	15.053173333333334	2	1607.752293	1606.750852	K	L	51	64
PSM	MGHAGAIIAGGK	947	sp|P53597|SUCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	1-UNIMOD:35	ms_run[1]:scan=2817	15.756783333333335	2	1096.568500	1097.565164	R	G	297	309
PSM	PKSPSSGSGGGGPK	948	sp|Q9ULD5|ZN777_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:21	ms_run[1]:scan=6665	36.34407	2	1279.582011	1278.560546	R	P	621	635
PSM	DADDAVYELNGK	949	sp|Q08170|SRSF4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=9765	53.827045	2	1308.583853	1308.583375	R	D	47	59
PSM	GDAHLRPTSLVQR	950	sp|Q9C0C2|TB182_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:21	ms_run[1]:scan=8035	44.03541333333334	2	1528.752401	1528.751141	K	R	414	427
PSM	SERSAVDPSSGHPR	951	sp|Q9P2B7|CFA97_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:21	ms_run[1]:scan=923	6.639745	2	1559.684390	1560.668199	R	R	506	520
PSM	GRPPAEKLSPNPPK	952	sp|P51531|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:21	ms_run[1]:scan=5263	28.474843333333336	3	1566.792986	1566.791943	R	L	1369	1383
PSM	LSGEHSESSTPRPR	953	sp|Q7Z3K3|POGZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:21	ms_run[1]:scan=1411	8.6842	2	1619.712470	1618.710064	K	S	1359	1373
PSM	RLPQDHADSCVVSSDDEELSR	954	sp|P78317|RNF4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:4,13-UNIMOD:21	ms_run[1]:scan=8647	47.509838333333335	3	2495.046364	2494.043162	R	D	82	103
PSM	GSGPQRPHSFSEALR	955	sp|Q6DT37|MRCKG_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:21	ms_run[1]:scan=8877	48.804093333333334	3	1704.773643	1704.773333	R	R	1474	1489
PSM	YSPSQNSPIHHIPSR	956	sp|Q9NYF8|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:21	ms_run[1]:scan=7968	43.629985	2	1798.810128	1798.815197	R	R	284	299
PSM	RLSQRPTPEELEQR	957	sp|Q8IZ21|PHAR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:21	ms_run[1]:scan=7787	42.55482	2	1817.879058	1817.878526	R	N	588	602
PSM	KEESEESDDDMGFGLFD	958	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=16603	98.83915833333333	2	2045.714772	2044.713279	K	-	98	115
PSM	GPALTPIRDEEWGGHSPR	959	sp|Q86X29|LSR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:21	ms_run[1]:scan=11630	64.98304499999999	3	2054.930891	2053.937104	R	S	449	467
PSM	GSEDSPPKHAGNNESHSSR	960	sp|P48651|PTSS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:21	ms_run[1]:scan=687	5.769871666666667	3	2072.817488	2071.834489	K	R	438	457
PSM	KNQKPSQVNGAPGSPTEPAGQK	961	sp|Q9BQG0|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	16-UNIMOD:21	ms_run[1]:scan=2616	14.734398333333333	3	2300.079039	2299.095789	K	Q	1254	1276
PSM	LFRPPSPAPAAPGAR	962	sp|Q86U90|YRDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:21	ms_run[1]:scan=9801	54.029295	2	1583.798423	1583.797363	R	L	32	47
PSM	YDERPGPSPLPHR	963	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	8-UNIMOD:21	ms_run[1]:scan=5853	31.711661666666664	2	1599.720511	1599.719506	R	D	219	232
PSM	ASPAPGSGHPEGPGAHLDMNSLDR	964	sp|O94826|TOM70_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:21,19-UNIMOD:35	ms_run[1]:scan=7792	42.58257166666667	3	2465.034533	2465.043102	R	A	90	114
PSM	KADTTTPTTIDPIHEPPSLPPEPK	965	sp|O60885|BRD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	6-UNIMOD:21	ms_run[1]:scan=13762	78.66590333333333	3	2660.291305	2661.293880	R	T	291	315