MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_NT_JPST000210
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\121102_CRC_T_Fr18.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\121102_CRC_T_Fr18.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41.0	null	269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4,58-UNIMOD:4	0.07	41.0	5	2	1
PRT	sp|Q8IVH8-3|M4K3_HUMAN	Isoform 3 of Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP4K3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null		0.02	38.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	309-UNIMOD:21	0.04	38.0	3	1	0
PRT	sp|P23528|COF1_HUMAN	Cofilin-1 OS=Homo sapiens OX=9606 GN=CFL1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	37.0	null	139-UNIMOD:4	0.09	37.0	3	1	0
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	255-UNIMOD:21,226-UNIMOD:21	0.05	36.0	3	3	3
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null		0.15	36.0	3	2	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	502-UNIMOD:21,507-UNIMOD:4	0.05	35.0	1	1	1
PRT	sp|Q9HCM7|FBSL_HUMAN	Fibrosin-1-like protein OS=Homo sapiens OX=9606 GN=FBRSL1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	1010-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	781-UNIMOD:4	0.01	34.0	2	1	0
PRT	sp|P46100-6|ATRX_HUMAN	Isoform 6 of Transcriptional regulator ATRX OS=Homo sapiens OX=9606 GN=ATRX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	34-UNIMOD:21,33-UNIMOD:21	0.02	34.0	2	1	0
PRT	sp|Q9H0K1|SIK2_HUMAN	Serine/threonine-protein kinase SIK2 OS=Homo sapiens OX=9606 GN=SIK2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	484-UNIMOD:21,495-UNIMOD:35	0.02	34.0	1	1	1
PRT	sp|Q9H3H1-6|MOD5_HUMAN	Isoform 6 of tRNA dimethylallyltransferase OS=Homo sapiens OX=9606 GN=TRIT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	139-UNIMOD:21	0.15	34.0	1	1	1
PRT	sp|O14497-2|ARI1A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ARID1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34.0	null	362-UNIMOD:35,363-UNIMOD:21	0.01	34.0	3	1	0
PRT	sp|Q13129|RLF_HUMAN	Zinc finger protein Rlf OS=Homo sapiens OX=9606 GN=RLF PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34.0	null	1628-UNIMOD:21,1641-UNIMOD:4,1642-UNIMOD:4	0.01	34.0	1	1	1
PRT	sp|P30050-2|RL12_HUMAN	Isoform 2 of 60S ribosomal protein L12 OS=Homo sapiens OX=9606 GN=RPL12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	129-UNIMOD:4	0.15	33.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	321-UNIMOD:35,330-UNIMOD:21	0.06	33.0	4	1	0
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	21-UNIMOD:21	0.06	33.0	1	1	1
PRT	sp|Q8IXJ6-5|SIR2_HUMAN	Isoform 5 of NAD-dependent protein deacetylase sirtuin-2 OS=Homo sapiens OX=9606 GN=SIRT2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	298-UNIMOD:21	0.08	33.0	2	1	0
PRT	sp|P98174|FGD1_HUMAN	FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=FGD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	48-UNIMOD:21	0.03	33.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	963-UNIMOD:21,299-UNIMOD:21	0.03	33.0	2	2	2
PRT	sp|Q96F24-3|NRBF2_HUMAN	Isoform 3 of Nuclear receptor-binding factor 2 OS=Homo sapiens OX=9606 GN=NRBF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	103-UNIMOD:21	0.10	32.0	1	1	1
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	43-UNIMOD:21	0.05	32.0	7	1	0
PRT	sp|Q53GD3-4|CTL4_HUMAN	Isoform 4 of Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	0
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	830-UNIMOD:21	0.03	32.0	2	2	2
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	1	1	1
PRT	sp|O94776-2|MTA2_HUMAN	Isoform 2 of Metastasis-associated protein MTA2 OS=Homo sapiens OX=9606 GN=MTA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	260-UNIMOD:21,262-UNIMOD:21	0.04	31.0	2	1	0
PRT	sp|O15173|PGRC2_HUMAN	Membrane-associated progesterone receptor component 2 OS=Homo sapiens OX=9606 GN=PGRMC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	211-UNIMOD:21	0.10	31.0	5	2	1
PRT	sp|Q6ZRV2|FA83H_HUMAN	Protein FAM83H OS=Homo sapiens OX=9606 GN=FAM83H PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	411-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	344-UNIMOD:21	0.03	31.0	1	1	1
PRT	sp|Q8TAD8|SNIP1_HUMAN	Smad nuclear-interacting protein 1 OS=Homo sapiens OX=9606 GN=SNIP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	52-UNIMOD:21,54-UNIMOD:21	0.05	31.0	2	1	0
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=HIST1H1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1,18-UNIMOD:21	0.09	31.0	1	1	1
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	240-UNIMOD:21,242-UNIMOD:21	0.08	30.0	4	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	263-UNIMOD:21,231-UNIMOD:21	0.05	30.0	2	2	2
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	2535-UNIMOD:21	0.00	30.0	1	1	1
PRT	sp|Q96NB3|ZN830_HUMAN	Zinc finger protein 830 OS=Homo sapiens OX=9606 GN=ZNF830 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.01	30.0	2	1	0
PRT	sp|Q9NYF8-3|BCLF1_HUMAN	Isoform 3 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	510-UNIMOD:21,283-UNIMOD:21	0.03	30.0	3	2	1
PRT	sp|Q8TAA9-2|VANG1_HUMAN	Isoform 2 of Vang-like protein 1 OS=Homo sapiens OX=9606 GN=VANGL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	336-UNIMOD:21	0.03	30.0	1	1	1
PRT	sp|Q8NFC6|BD1L1_HUMAN	Biorientation of chromosomes in cell division protein 1-like 1 OS=Homo sapiens OX=9606 GN=BOD1L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	637-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	266-UNIMOD:21	0.05	30.0	2	1	0
PRT	sp|Q14686|NCOA6_HUMAN	Nuclear receptor coactivator 6 OS=Homo sapiens OX=9606 GN=NCOA6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	2018-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	3	1	0
PRT	sp|Q9Y520-2|PRC2C_HUMAN	Isoform 2 of Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	681-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q8N5C8-2|TAB3_HUMAN	Isoform 2 of TGF-beta-activated kinase 1 and MAP3K7-binding protein 3 OS=Homo sapiens OX=9606 GN=TAB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	102-UNIMOD:21,103-UNIMOD:21	0.03	30.0	2	1	0
PRT	sp|Q9H4A3-4|WNK1_HUMAN	Isoform 3 of Serine/threonine-protein kinase WNK1 OS=Homo sapiens OX=9606 GN=WNK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	112-UNIMOD:21,120-UNIMOD:21,132-UNIMOD:21	0.17	29.0	3	2	1
PRT	sp|P48730-2|KC1D_HUMAN	Isoform 2 of Casein kinase I isoform delta OS=Homo sapiens OX=9606 GN=CSNK1D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	337-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|Q3YEC7|RABL6_HUMAN	Rab-like protein 6 OS=Homo sapiens OX=9606 GN=RABL6 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	596-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|Q8TCJ2|STT3B_HUMAN	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B OS=Homo sapiens OX=9606 GN=STT3B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.02	29.0	1	1	1
PRT	sp|Q9Y2U5|M3K2_HUMAN	Mitogen-activated protein kinase kinase kinase 2 OS=Homo sapiens OX=9606 GN=MAP3K2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	331-UNIMOD:21,341-UNIMOD:35	0.04	29.0	3	1	0
PRT	sp|Q96JN8-2|NEUL4_HUMAN	Isoform 2 of Neuralized-like protein 4 OS=Homo sapiens OX=9606 GN=NEURL4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	905-UNIMOD:21	0.01	29.0	1	1	1
PRT	sp|Q14185|DOCK1_HUMAN	Dedicator of cytokinesis protein 1 OS=Homo sapiens OX=9606 GN=DOCK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q14814-6|MEF2D_HUMAN	Isoform MEF2D00 of Myocyte-specific enhancer factor 2D OS=Homo sapiens OX=9606 GN=MEF2D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	205-UNIMOD:21	0.05	29.0	2	1	0
PRT	sp|Q5T4S7-5|UBR4_HUMAN	Isoform 5 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	620-UNIMOD:21,619-UNIMOD:21	0.01	28.0	4	1	0
PRT	sp|Q15223|NECT1_HUMAN	Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	412-UNIMOD:35,422-UNIMOD:21	0.05	28.0	1	1	1
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.12	28.0	1	1	1
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.10	28.0	1	1	1
PRT	sp|Q96IZ0|PAWR_HUMAN	PRKC apoptosis WT1 regulator protein OS=Homo sapiens OX=9606 GN=PAWR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.04	28.0	1	1	1
PRT	sp|Q05682|CALD1_HUMAN	Caldesmon OS=Homo sapiens OX=9606 GN=CALD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	1	1	1
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|O94915|FRYL_HUMAN	Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null		0.00	28.0	2	1	0
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	337-UNIMOD:21	0.03	28.0	2	1	0
PRT	sp|O00712-6|NFIB_HUMAN	Isoform 6 of Nuclear factor 1 B-type OS=Homo sapiens OX=9606 GN=NFIB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	76-UNIMOD:21,80-UNIMOD:21	0.06	28.0	3	1	0
PRT	sp|P78346|RPP30_HUMAN	Ribonuclease P protein subunit p30 OS=Homo sapiens OX=9606 GN=RPP30 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	251-UNIMOD:21,257-UNIMOD:4	0.06	28.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	214-UNIMOD:21	0.03	28.0	2	2	2
PRT	sp|Q96D71-2|REPS1_HUMAN	Isoform 2 of RalBP1-associated Eps domain-containing protein 1 OS=Homo sapiens OX=9606 GN=REPS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	618-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q12872|SFSWA_HUMAN	Splicing factor, suppressor of white-apricot homolog OS=Homo sapiens OX=9606 GN=SFSWAP PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	742-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P21860-5|ERBB3_HUMAN	Isoform 5 of Receptor tyrosine-protein kinase erbB-3 OS=Homo sapiens OX=9606 GN=ERBB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	339-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q07889|SOS1_HUMAN	Son of sevenless homolog 1 OS=Homo sapiens OX=9606 GN=SOS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	1161-UNIMOD:21	0.01	28.0	1	1	1
PRT	sp|Q8N0Y7|PGAM4_HUMAN	Probable phosphoglycerate mutase 4 OS=Homo sapiens OX=9606 GN=PGAM4 PE=3 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	118-UNIMOD:21,126-UNIMOD:35	0.09	28.0	1	1	1
PRT	sp|P26358|DNMT1_HUMAN	DNA (cytosine-5)-methyltransferase 1 OS=Homo sapiens OX=9606 GN=DNMT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	122-UNIMOD:35,133-UNIMOD:21,127-UNIMOD:21	0.01	28.0	2	1	0
PRT	sp|Q14980-5|NUMA1_HUMAN	Isoform 5 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	864-UNIMOD:21	0.02	28.0	1	1	1
PRT	sp|P22681|CBL_HUMAN	E3 ubiquitin-protein ligase CBL OS=Homo sapiens OX=9606 GN=CBL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	483-UNIMOD:21,487-UNIMOD:35,486-UNIMOD:21	0.03	28.0	3	1	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	101-UNIMOD:21,108-UNIMOD:35,104-UNIMOD:21	0.16	28.0	2	1	0
PRT	sp|Q5T5Y3-2|CAMP1_HUMAN	Isoform 2 of Calmodulin-regulated spectrin-associated protein 1 OS=Homo sapiens OX=9606 GN=CAMSAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	802-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q96FF7|MISP3_HUMAN	Uncharacterized protein MISP3 OS=Homo sapiens OX=9606 GN=MISP3 PE=2 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	91-UNIMOD:21	0.06	27.0	3	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	246-UNIMOD:35	0.05	27.0	1	1	1
PRT	sp|Q99795|GPA33_HUMAN	Cell surface A33 antigen OS=Homo sapiens OX=9606 GN=GPA33 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.05	27.0	1	1	1
PRT	sp|P26639|SYTC_HUMAN	Threonine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=TARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	575-UNIMOD:21,280-UNIMOD:21	0.03	27.0	2	2	2
PRT	sp|O60493-2|SNX3_HUMAN	Isoform 2 of Sorting nexin-3 OS=Homo sapiens OX=9606 GN=SNX3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.12	27.0	1	1	1
PRT	sp|Q13573|SNW1_HUMAN	SNW domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SNW1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	224-UNIMOD:21,230-UNIMOD:35	0.03	27.0	2	1	0
PRT	sp|Q9H5N1-2|RABE2_HUMAN	Isoform 2 of Rab GTPase-binding effector protein 2 OS=Homo sapiens OX=9606 GN=RABEP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	193-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q9UHI5|LAT2_HUMAN	Large neutral amino acids transporter small subunit 2 OS=Homo sapiens OX=9606 GN=SLC7A8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	29-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|O15427|MOT4_HUMAN	Monocarboxylate transporter 4 OS=Homo sapiens OX=9606 GN=SLC16A3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	436-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|O75385|ULK1_HUMAN	Serine/threonine-protein kinase ULK1 OS=Homo sapiens OX=9606 GN=ULK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	556-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	3	1	0
PRT	sp|Q96SB4-4|SRPK1_HUMAN	Isoform 3 of SRSF protein kinase 1 OS=Homo sapiens OX=9606 GN=SRPK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	295-UNIMOD:21	0.02	27.0	1	1	1
PRT	sp|Q8TE68-4|ES8L1_HUMAN	Isoform 4 of Epidermal growth factor receptor kinase substrate 8-like protein 1 OS=Homo sapiens OX=9606 GN=EPS8L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	328-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.00	27.0	1	1	1
PRT	sp|Q9P1Y5|CAMP3_HUMAN	Calmodulin-regulated spectrin-associated protein 3 OS=Homo sapiens OX=9606 GN=CAMSAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	799-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P08621-4|RU17_HUMAN	Isoform 4 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	130-UNIMOD:21	0.04	27.0	3	1	0
PRT	sp|P08559-3|ODPA_HUMAN	Isoform 3 of Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial OS=Homo sapiens OX=9606 GN=PDHA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	263-UNIMOD:35,264-UNIMOD:21,262-UNIMOD:21,269-UNIMOD:21	0.04	27.0	4	1	0
PRT	sp|Q53GD3|CTL4_HUMAN	Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	5-UNIMOD:28	0.02	27.0	2	1	0
PRT	sp|P35613|BASI_HUMAN	Basigin OS=Homo sapiens OX=9606 GN=BSG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	362-UNIMOD:21	0.05	27.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P00387-2|NB5R3_HUMAN	Isoform 2 of NADH-cytochrome b5 reductase 3 OS=Homo sapiens OX=9606 GN=CYB5R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	181-UNIMOD:4	0.07	26.0	3	1	0
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|P10451-3|OSTP_HUMAN	Isoform C of Osteopontin OS=Homo sapiens OX=9606 GN=SPP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	207-UNIMOD:21	0.08	26.0	1	1	1
PRT	sp|Q8N122-3|RPTOR_HUMAN	Isoform 3 of Regulatory-associated protein of mTOR OS=Homo sapiens OX=9606 GN=RPTOR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	725-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P27797|CALR_HUMAN	Calreticulin OS=Homo sapiens OX=9606 GN=CALR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.04	26.0	2	1	0
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	75-UNIMOD:21,79-UNIMOD:21	0.06	26.0	3	1	0
PRT	sp|P53597|SUCA_HUMAN	Succinate--CoA ligase [ADP/GDP-forming] subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=SUCLG1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	297-UNIMOD:35	0.04	26.0	1	1	1
PRT	sp|Q2NKJ3-2|CTC1_HUMAN	Isoform 2 of CST complex subunit CTC1 OS=Homo sapiens OX=9606 GN=CTC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	671-UNIMOD:4,678-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	450-UNIMOD:21,775-UNIMOD:21,402-UNIMOD:21,406-UNIMOD:21,717-UNIMOD:21	0.07	26.0	4	4	4
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1174-UNIMOD:21,1176-UNIMOD:21	0.01	26.0	3	1	0
PRT	sp|Q9UBF8-3|PI4KB_HUMAN	Isoform 3 of Phosphatidylinositol 4-kinase beta OS=Homo sapiens OX=9606 GN=PI4KB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	179-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q9UK76|JUPI1_HUMAN	Jupiter microtubule associated homolog 1 OS=Homo sapiens OX=9606 GN=JPT1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	87-UNIMOD:21	0.10	26.0	1	1	1
PRT	sp|P78312-3|F193A_HUMAN	Isoform 3 of Protein FAM193A OS=Homo sapiens OX=9606 GN=FAM193A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	642-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q14202-2|ZMYM3_HUMAN	Isoform 2 of Zinc finger MYM-type protein 3 OS=Homo sapiens OX=9606 GN=ZMYM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	805-UNIMOD:21	0.01	26.0	1	1	1
PRT	sp|Q6XZF7-2|DNMBP_HUMAN	Isoform 2 of Dynamin-binding protein OS=Homo sapiens OX=9606 GN=DNMBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	616-UNIMOD:21	0.03	26.0	1	1	1
PRT	sp|Q9ULL8-2|SHRM4_HUMAN	Isoform 2 of Protein Shroom4 OS=Homo sapiens OX=9606 GN=SHROOM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	377-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|Q06323|PSME1_HUMAN	Proteasome activator complex subunit 1 OS=Homo sapiens OX=9606 GN=PSME1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	101-UNIMOD:4,106-UNIMOD:4	0.08	26.0	1	1	1
PRT	sp|Q63ZY3|KANK2_HUMAN	KN motif and ankyrin repeat domain-containing protein 2 OS=Homo sapiens OX=9606 GN=KANK2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	369-UNIMOD:35,375-UNIMOD:21	0.02	26.0	1	1	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	26.0	null	366-UNIMOD:21	0.05	26.0	3	1	0
PRT	sp|Q8WUF5|IASPP_HUMAN	RelA-associated inhibitor OS=Homo sapiens OX=9606 GN=PPP1R13L PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	597-UNIMOD:21,605-UNIMOD:35,607-UNIMOD:35	0.04	25.0	1	1	1
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|O00204-2|ST2B1_HUMAN	Isoform 2 of Sulfotransferase family cytosolic 2B member 1 OS=Homo sapiens OX=9606 GN=SULT2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	332-UNIMOD:21	0.07	25.0	1	1	1
PRT	sp|O75140-6|DEPD5_HUMAN	Isoform 6 of GATOR complex protein DEPDC5 OS=Homo sapiens OX=9606 GN=DEPDC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	579-UNIMOD:21,583-UNIMOD:35	0.01	25.0	2	1	0
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1377-UNIMOD:21	0.01	25.0	2	1	0
PRT	sp|Q86VQ1|GLCI1_HUMAN	Glucocorticoid-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=GLCCI1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	81-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	189-UNIMOD:35,191-UNIMOD:21,194-UNIMOD:35	0.02	25.0	2	1	0
PRT	sp|Q14165|MLEC_HUMAN	Malectin OS=Homo sapiens OX=9606 GN=MLEC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.07	25.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|Q08499-5|PDE4D_HUMAN	Isoform 2 of cAMP-specific 3',5'-cyclic phosphodiesterase 4D OS=Homo sapiens OX=9606 GN=PDE4D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	69-UNIMOD:35,73-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q8NEY1-6|NAV1_HUMAN	Isoform 6 of Neuron navigator 1 OS=Homo sapiens OX=9606 GN=NAV1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	528-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q8NDX1-2|PSD4_HUMAN	Isoform 2 of PH and SEC7 domain-containing protein 4 OS=Homo sapiens OX=9606 GN=PSD4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	990-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q8IWS0-5|PHF6_HUMAN	Isoform 5 of PHD finger protein 6 OS=Homo sapiens OX=9606 GN=PHF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	121-UNIMOD:21	0.08	25.0	1	1	1
PRT	sp|Q9BQI5-4|SGIP1_HUMAN	Isoform 4 of SH3-containing GRB2-like protein 3-interacting protein 1 OS=Homo sapiens OX=9606 GN=SGIP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	215-UNIMOD:21	0.03	25.0	3	1	0
PRT	sp|Q13884|SNTB1_HUMAN	Beta-1-syntrophin OS=Homo sapiens OX=9606 GN=SNTB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	389-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q93052|LPP_HUMAN	Lipoma-preferred partner OS=Homo sapiens OX=9606 GN=LPP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	151-UNIMOD:21	0.04	25.0	2	1	0
PRT	sp|Q13563-2|PKD2_HUMAN	Isoform 2 of Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	164-UNIMOD:4,166-UNIMOD:21	0.04	25.0	1	1	1
PRT	sp|Q96CP6-2|GRM1A_HUMAN	Isoform 2 of GRAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=GRAMD1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	270-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|O94875-9|SRBS2_HUMAN	Isoform 9 of Sorbin and SH3 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SORBS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	330-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q9NXL2-1|ARH38_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	34-UNIMOD:21	0.10	25.0	1	1	1
PRT	sp|Q8IVL1-6|NAV2_HUMAN	Isoform 6 of Neuron navigator 2 OS=Homo sapiens OX=9606 GN=NAV2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	189-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1365-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9UHB6|LIMA1_HUMAN	LIM domain and actin-binding protein 1 OS=Homo sapiens OX=9606 GN=LIMA1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	604-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	125-UNIMOD:21	0.00	25.0	2	1	0
PRT	sp|P28482-2|MK01_HUMAN	Isoform 2 of Mitogen-activated protein kinase 1 OS=Homo sapiens OX=9606 GN=MAPK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|O75382-4|TRIM3_HUMAN	Isoform 4 of Tripartite motif-containing protein 3 OS=Homo sapiens OX=9606 GN=TRIM3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	318-UNIMOD:21,308-UNIMOD:21	0.05	25.0	4	2	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	25.0	1	1	0
PRT	sp|P35749|MYH11_HUMAN	Myosin-11 OS=Homo sapiens OX=9606 GN=MYH11 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	1597-UNIMOD:28	0.01	25.0	1	1	1
PRT	sp|Q05D32|CTSL2_HUMAN	CTD small phosphatase-like protein 2 OS=Homo sapiens OX=9606 GN=CTDSPL2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	104-UNIMOD:21,115-UNIMOD:35	0.05	25.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null	97-UNIMOD:4	0.05	25.0	1	1	1
PRT	sp|Q3KQU3-2|MA7D1_HUMAN	Isoform 2 of MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	432-UNIMOD:21,362-UNIMOD:21	0.03	24.0	2	2	1
PRT	sp|Q8TEM1|PO210_HUMAN	Nuclear pore membrane glycoprotein 210 OS=Homo sapiens OX=9606 GN=NUP210 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1862-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q92504|S39A7_HUMAN	Zinc transporter SLC39A7 OS=Homo sapiens OX=9606 GN=SLC39A7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q15293-2|RCN1_HUMAN	Isoform 2 of Reticulocalbin-1 OS=Homo sapiens OX=9606 GN=RCN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|P22626-2|ROA2_HUMAN	Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.04	24.0	1	1	0
PRT	sp|Q15366|PCBP2_HUMAN	Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	187-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|O95425-2|SVIL_HUMAN	Isoform 2 of Supervillin OS=Homo sapiens OX=9606 GN=SVIL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	259-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q14677-2|EPN4_HUMAN	Isoform 2 of Clathrin interactor 1 OS=Homo sapiens OX=9606 GN=CLINT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	250-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|Q9Y4C1|KDM3A_HUMAN	Lysine-specific demethylase 3A OS=Homo sapiens OX=9606 GN=KDM3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	445-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q5T0N5-3|FBP1L_HUMAN	Isoform 3 of Formin-binding protein 1-like OS=Homo sapiens OX=9606 GN=FNBP1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	438-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1690-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q9Y6M7-11|S4A7_HUMAN	Isoform 11 of Sodium bicarbonate cotransporter 3 OS=Homo sapiens OX=9606 GN=SLC4A7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	437-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1261-UNIMOD:21	0.00	24.0	1	1	1
PRT	sp|P36873|PP1G_HUMAN	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit OS=Homo sapiens OX=9606 GN=PPP1CC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	307-UNIMOD:21	0.04	24.0	1	1	1
PRT	sp|Q96JM3|CHAP1_HUMAN	Chromosome alignment-maintaining phosphoprotein 1 OS=Homo sapiens OX=9606 GN=CHAMP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	282-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|P51787-2|KCNQ1_HUMAN	Isoform 2 of Potassium voltage-gated channel subfamily KQT member 1 OS=Homo sapiens OX=9606 GN=KCNQ1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	341-UNIMOD:21,349-UNIMOD:35,353-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|Q92574-2|TSC1_HUMAN	Isoform 2 of Hamartin OS=Homo sapiens OX=9606 GN=TSC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	470-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|O60244|MED14_HUMAN	Mediator of RNA polymerase II transcription subunit 14 OS=Homo sapiens OX=9606 GN=MED14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1124-UNIMOD:35,1127-UNIMOD:35,1136-UNIMOD:21,1142-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q5TC79|ZBT37_HUMAN	Zinc finger and BTB domain-containing protein 37 OS=Homo sapiens OX=9606 GN=ZBTB37 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	455-UNIMOD:4,465-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q13595-3|TRA2A_HUMAN	Isoform 3 of Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	101-UNIMOD:21,108-UNIMOD:35	0.08	24.0	1	1	1
PRT	sp|Q8WWI1-3|LMO7_HUMAN	Isoform 3 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1176-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q15678|PTN14_HUMAN	Tyrosine-protein phosphatase non-receptor type 14 OS=Homo sapiens OX=9606 GN=PTPN14 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	642-UNIMOD:21,646-UNIMOD:35,649-UNIMOD:35	0.01	24.0	1	1	1
PRT	sp|Q9BWN1|PRR14_HUMAN	Proline-rich protein 14 OS=Homo sapiens OX=9606 GN=PRR14 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	363-UNIMOD:21,369-UNIMOD:35	0.02	24.0	3	1	0
PRT	sp|P16333-2|NCK1_HUMAN	Isoform 2 of Cytoplasmic protein NCK1 OS=Homo sapiens OX=9606 GN=NCK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	32-UNIMOD:21	0.07	24.0	1	1	1
PRT	sp|Q16473|TENXA_HUMAN	Putative tenascin-XA OS=Homo sapiens OX=9606 GN=TNXA PE=5 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	138-UNIMOD:21	0.09	24.0	1	1	1
PRT	sp|Q00G26|PLIN5_HUMAN	Perilipin-5 OS=Homo sapiens OX=9606 GN=PLIN5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	277-UNIMOD:21	0.03	24.0	1	1	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	162-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.05	24.0	1	1	1
PRT	sp|Q14289-2|FAK2_HUMAN	Isoform 2 of Protein-tyrosine kinase 2-beta OS=Homo sapiens OX=9606 GN=PTK2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	800-UNIMOD:21	0.02	24.0	1	1	0
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	328-UNIMOD:21	0.02	24.0	2	1	0
PRT	sp|Q9NVW2-2|RNF12_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase RLIM OS=Homo sapiens OX=9606 GN=RLIM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	89-UNIMOD:21,94-UNIMOD:35	0.03	24.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	2191-UNIMOD:4,2144-UNIMOD:21,2152-UNIMOD:4	0.01	24.0	3	2	1
PRT	sp|Q9Y3I0|RTCB_HUMAN	tRNA-splicing ligase RtcB homolog OS=Homo sapiens OX=9606 GN=RTCB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|O60716-24|CTND1_HUMAN	Isoform 3 of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	167-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.10	24.0	1	1	1
PRT	sp|Q96ST3|SIN3A_HUMAN	Paired amphipathic helix protein Sin3a OS=Homo sapiens OX=9606 GN=SIN3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	272-UNIMOD:21	0.02	24.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	2	2	2
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null	308-UNIMOD:21	0.04	24.0	2	1	0
PRT	sp|O15347|HMGB3_HUMAN	High mobility group protein B3 OS=Homo sapiens OX=9606 GN=HMGB3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.12	24.0	1	1	1
PRT	sp|Q07157|ZO1_HUMAN	Tight junction protein ZO-1 OS=Homo sapiens OX=9606 GN=TJP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	1098-UNIMOD:28,1111-UNIMOD:21	0.01	24.0	1	1	1
PRT	sp|Q14669|TRIPC_HUMAN	E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	100-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9ULK2-3|AT7L1_HUMAN	Isoform 3 of Ataxin-7-like protein 1 OS=Homo sapiens OX=9606 GN=ATXN7L1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	481-UNIMOD:21	0.03	23.0	1	1	1
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P52272-2|HNRPM_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens OX=9606 GN=HNRNPM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	637-UNIMOD:4	0.04	23.0	2	2	2
PRT	sp|P15941-12|MUC1_HUMAN	Isoform S2 of Mucin-1 OS=Homo sapiens OX=9606 GN=MUC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	110-UNIMOD:35,115-UNIMOD:21	0.11	23.0	1	1	1
PRT	sp|Q8TF44|C2C4C_HUMAN	C2 calcium-dependent domain-containing protein 4C OS=Homo sapiens OX=9606 GN=C2CD4C PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	178-UNIMOD:21	0.05	23.0	1	1	1
PRT	sp|P49407-2|ARRB1_HUMAN	Isoform 1B of Beta-arrestin-1 OS=Homo sapiens OX=9606 GN=ARRB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	391-UNIMOD:35	0.05	23.0	1	1	1
PRT	sp|Q9H792|PEAK1_HUMAN	Inactive tyrosine-protein kinase PEAK1 OS=Homo sapiens OX=9606 GN=PEAK1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	898-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P78316-2|NOP14_HUMAN	Isoform 2 of Nucleolar protein 14 OS=Homo sapiens OX=9606 GN=NOP14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	312-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|P05771-2|KPCB_HUMAN	Isoform Beta-II of Protein kinase C beta type OS=Homo sapiens OX=9606 GN=PRKCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	641-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O14686|KMT2D_HUMAN	Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2240-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|P51178|PLCD1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 OS=Homo sapiens OX=9606 GN=PLCD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	134-UNIMOD:21,135-UNIMOD:35	0.02	23.0	1	1	1
PRT	sp|Q96Q11-2|TRNT1_HUMAN	Isoform 2 of CCA tRNA nucleotidyltransferase 1, mitochondrial OS=Homo sapiens OX=9606 GN=TRNT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q6NZ36-5|FAP20_HUMAN	Isoform 5 of Fanconi anemia core complex-associated protein 20 OS=Homo sapiens OX=9606 GN=FAAP20	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	113-UNIMOD:21	0.09	23.0	1	1	1
PRT	sp|Q8IU81|I2BP1_HUMAN	Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	436-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	168-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|O95613-2|PCNT_HUMAN	Isoform 2 of Pericentrin OS=Homo sapiens OX=9606 GN=PCNT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1696-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|Q00587-2|BORG5_HUMAN	Isoform 2 of Cdc42 effector protein 1 OS=Homo sapiens OX=9606 GN=CDC42EP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	34-UNIMOD:21,37-UNIMOD:35	0.04	23.0	1	1	1
PRT	sp|Q9Y2I9|TBC30_HUMAN	TBC1 domain family member 30 OS=Homo sapiens OX=9606 GN=TBC1D30 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	114-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9UFB7|ZBT47_HUMAN	Zinc finger and BTB domain-containing protein 47 OS=Homo sapiens OX=9606 GN=ZBTB47 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	390-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q13769|THOC5_HUMAN	THO complex subunit 5 homolog OS=Homo sapiens OX=9606 GN=THOC5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	328-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	11-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q5VZ89-5|DEN4C_HUMAN	Isoform 5 of DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1278-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P49736|MCM2_HUMAN	DNA replication licensing factor MCM2 OS=Homo sapiens OX=9606 GN=MCM2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	40-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P09651-3|ROA1_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens OX=9606 GN=HNRNPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	6-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	2048-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P12931|SRC_HUMAN	Proto-oncogene tyrosine-protein kinase Src OS=Homo sapiens OX=9606 GN=SRC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	17-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P51812|KS6A3_HUMAN	Ribosomal protein S6 kinase alpha-3 OS=Homo sapiens OX=9606 GN=RPS6KA3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	369-UNIMOD:21	0.03	23.0	2	1	0
PRT	sp|Q9UQ35|SRRM2_HUMAN	Serine/arginine repetitive matrix protein 2 OS=Homo sapiens OX=9606 GN=SRRM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1531-UNIMOD:21	0.00	23.0	1	1	1
PRT	sp|P51151|RAB9A_HUMAN	Ras-related protein Rab-9A OS=Homo sapiens OX=9606 GN=RAB9A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	179-UNIMOD:21	0.11	23.0	1	1	1
PRT	sp|Q14289|FAK2_HUMAN	Protein-tyrosine kinase 2-beta OS=Homo sapiens OX=9606 GN=PTK2B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	842-UNIMOD:21	0.02	23.0	1	1	0
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.11	23.0	1	1	1
PRT	sp|Q14764|MVP_HUMAN	Major vault protein OS=Homo sapiens OX=9606 GN=MVP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	873-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|P10398|ARAF_HUMAN	Serine/threonine-protein kinase A-Raf OS=Homo sapiens OX=9606 GN=ARAF PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	167-UNIMOD:28,181-UNIMOD:21	0.04	23.0	1	1	1
PRT	sp|Q15365|PCBP1_HUMAN	Poly(rC)-binding protein 1 OS=Homo sapiens OX=9606 GN=PCBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	251-UNIMOD:35,263-UNIMOD:21	0.07	23.0	1	1	1
PRT	sp|Q3KQU3|MA7D1_HUMAN	MAP7 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=MAP7D1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	399-UNIMOD:21,410-UNIMOD:21	0.03	23.0	2	2	1
PRT	sp|Q6ZU35|K1211_HUMAN	Uncharacterized protein KIAA1211 OS=Homo sapiens OX=9606 GN=KIAA1211 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	1056-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9UK80|UBP21_HUMAN	Ubiquitin carboxyl-terminal hydrolase 21 OS=Homo sapiens OX=9606 GN=USP21 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	115-UNIMOD:21,122-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	104-UNIMOD:4,125-UNIMOD:21	0.12	22.0	1	1	0
PRT	sp|Q14789-4|GOGB1_HUMAN	Isoform 4 of Golgin subfamily B member 1 OS=Homo sapiens OX=9606 GN=GOLGB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.00	22.0	1	1	1
PRT	sp|O75955-2|FLOT1_HUMAN	Isoform 2 of Flotillin-1 OS=Homo sapiens OX=9606 GN=FLOT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|Q14151|SAFB2_HUMAN	Scaffold attachment factor B2 OS=Homo sapiens OX=9606 GN=SAFB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P19174|PLCG1_HUMAN	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase gamma-1 OS=Homo sapiens OX=9606 GN=PLCG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	1233-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	549-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q01970-2|PLCB3_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	407-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q96A22|CK052_HUMAN	Uncharacterized protein C11orf52 OS=Homo sapiens OX=9606 GN=C11orf52 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	103-UNIMOD:21	0.12	22.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	218-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q9HB71-3|CYBP_HUMAN	Isoform 3 of Calcyclin-binding protein OS=Homo sapiens OX=9606 GN=CACYBP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	163-UNIMOD:35	0.07	22.0	1	1	1
PRT	sp|Q86YV5|PRAG1_HUMAN	Inactive tyrosine-protein kinase PRAG1 OS=Homo sapiens OX=9606 GN=PRAG1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	798-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O95347-2|SMC2_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 2 OS=Homo sapiens OX=9606 GN=SMC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|Q8NE71-2|ABCF1_HUMAN	Isoform 2 of ATP-binding cassette sub-family F member 1 OS=Homo sapiens OX=9606 GN=ABCF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	108-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q86U90|YRDC_HUMAN	YrdC domain-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=YRDC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	37-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q9UIS9-4|MBD1_HUMAN	Isoform 4 of Methyl-CpG-binding domain protein 1 OS=Homo sapiens OX=9606 GN=MBD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	297-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q92888-2|ARHG1_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	745-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P54727-2|RD23B_HUMAN	Isoform 2 of UV excision repair protein RAD23 homolog B OS=Homo sapiens OX=9606 GN=RAD23B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	88-UNIMOD:21	0.09	22.0	1	1	1
PRT	sp|Q9C0H9|SRCN1_HUMAN	SRC kinase signaling inhibitor 1 OS=Homo sapiens OX=9606 GN=SRCIN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	45-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q8WUY9-2|DEP1B_HUMAN	Isoform 2 of DEP domain-containing protein 1B OS=Homo sapiens OX=9606 GN=DEPDC1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	160-UNIMOD:21,169-UNIMOD:4	0.03	22.0	1	1	1
PRT	sp|O75791-2|GRAP2_HUMAN	Isoform 2 of GRB2-related adapter protein 2 OS=Homo sapiens OX=9606 GN=GRAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	149-UNIMOD:21	0.06	22.0	1	1	1
PRT	sp|Q9H7L9|SDS3_HUMAN	Sin3 histone deacetylase corepressor complex component SDS3 OS=Homo sapiens OX=9606 GN=SUDS3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	236-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|P40222|TXLNA_HUMAN	Alpha-taxilin OS=Homo sapiens OX=9606 GN=TXLNA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	514-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q12906-5|ILF3_HUMAN	Isoform 5 of Interleukin enhancer-binding factor 3 OS=Homo sapiens OX=9606 GN=ILF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	374-UNIMOD:35,382-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9Y618-5|NCOR2_HUMAN	Isoform 4 of Nuclear receptor corepressor 2 OS=Homo sapiens OX=9606 GN=NCOR2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	2161-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q86UU0-3|BCL9L_HUMAN	Isoform 3 of B-cell CLL/lymphoma 9-like protein OS=Homo sapiens OX=9606 GN=BCL9L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	915-UNIMOD:21,924-UNIMOD:35,929-UNIMOD:35	0.02	22.0	1	1	1
PRT	sp|Q9BXB4|OSB11_HUMAN	Oxysterol-binding protein-related protein 11 OS=Homo sapiens OX=9606 GN=OSBPL11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	189-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q13286-5|CLN3_HUMAN	Isoform 5 of Battenin OS=Homo sapiens OX=9606 GN=CLN3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	12-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|Q86W92-3|LIPB1_HUMAN	Isoform 3 of Liprin-beta-1 OS=Homo sapiens OX=9606 GN=PPFIBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	641-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O14578-3|CTRO_HUMAN	Isoform 3 of Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	115-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	161-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q9Y580|RBM7_HUMAN	RNA-binding protein 7 OS=Homo sapiens OX=9606 GN=RBM7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	107-UNIMOD:21	0.12	22.0	1	1	1
PRT	sp|P81605|DCD_HUMAN	Dermcidin OS=Homo sapiens OX=9606 GN=DCD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.13	22.0	1	1	1
PRT	sp|P01009-3|A1AT_HUMAN	Isoform 3 of Alpha-1-antitrypsin OS=Homo sapiens OX=9606 GN=SERPINA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	35-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|O60879-2|DIAP2_HUMAN	Isoform 2 of Protein diaphanous homolog 2 OS=Homo sapiens OX=9606 GN=DIAPH2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	1	1	1
PRT	sp|P22626|ROA2_HUMAN	Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens OX=9606 GN=HNRNPA2B1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	100-UNIMOD:27	0.04	22.0	1	1	0
PRT	sp|Q9Y446|PKP3_HUMAN	Plakophilin-3 OS=Homo sapiens OX=9606 GN=PKP3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	134-UNIMOD:21,157-UNIMOD:35	0.04	22.0	2	1	0
PRT	sp|Q9C0A6|SETD5_HUMAN	SET domain-containing protein 5 OS=Homo sapiens OX=9606 GN=SETD5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	1019-UNIMOD:4,1020-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9BZL4-3|PP12C_HUMAN	Isoform 3 of Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	407-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q9HC78|ZBT20_HUMAN	Zinc finger and BTB domain-containing protein 20 OS=Homo sapiens OX=9606 GN=ZBTB20 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	695-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|A6ND36|FA83G_HUMAN	Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	634-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|P04792|HSPB1_HUMAN	Heat shock protein beta-1 OS=Homo sapiens OX=9606 GN=HSPB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	80-UNIMOD:28,82-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|Q99613|EIF3C_HUMAN	Eukaryotic translation initiation factor 3 subunit C OS=Homo sapiens OX=9606 GN=EIF3C PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	34-UNIMOD:28,39-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|O14514|AGRB1_HUMAN	Adhesion G protein-coupled receptor B1 OS=Homo sapiens OX=9606 GN=ADGRB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	127-UNIMOD:4,130-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9P0T7|TMEM9_HUMAN	Transmembrane protein 9 OS=Homo sapiens OX=9606 GN=TMEM9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|P16070|CD44_HUMAN	CD44 antigen OS=Homo sapiens OX=9606 GN=CD44 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	706-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|Q92922|SMRC1_HUMAN	SWI/SNF complex subunit SMARCC1 OS=Homo sapiens OX=9606 GN=SMARCC1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	328-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q9Y520|PRC2C_HUMAN	Protein PRRC2C OS=Homo sapiens OX=9606 GN=PRRC2C PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	878-UNIMOD:21,895-UNIMOD:4	0.01	22.0	1	1	1
PRT	sp|Q96RU3|FNBP1_HUMAN	Formin-binding protein 1 OS=Homo sapiens OX=9606 GN=FNBP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	331-UNIMOD:35,359-UNIMOD:21	0.05	22.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	VHTECCHGDLLECADDR	1	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	41	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6568	37.729	2	2085.8303	2085.8303	K	A	265	282
PSM	VHTECCHGDLLECADDR	2	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	40	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7163	41.254	2	2085.8303	2085.8303	K	A	265	282
PSM	GHVAHLEDDEGDDDESK	3	sp|Q8IVH8-3|M4K3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38		ms_run[2]:scan=2228	12.668	2	1866.7504	1866.7504	R	H	386	403
PSM	SGPKPFSAPKPQTSPSPK	4	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	16-UNIMOD:21	ms_run[2]:scan=5819	33.197	2	1916.9397	1916.9397	R	R	294	312
PSM	HELQANCYEEVKDR	5	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	7-UNIMOD:4	ms_run[2]:scan=5326	30.339	2	1789.8053	1789.8053	K	C	133	147
PSM	IEDVGSDEEDDSGK	6	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	6-UNIMOD:21	ms_run[2]:scan=3904	22.058	2	1573.5669	1573.5669	K	D	250	264
PSM	RAAEDDEDDDVDTKK	7	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36		ms_run[2]:scan=1013	6.9293	2	1720.7388	1720.7388	K	Q	89	104
PSM	HIKEEPLSEEEPCTSTAIASPEK	8	sp|Q9Y2X3|NOP58_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	8-UNIMOD:21,13-UNIMOD:4	ms_run[2]:scan=9774	56.942	3	2661.1881	2661.1881	K	K	495	518
PSM	TPPAAAALGAPPPLVTAAGPPTPPGPPR	9	sp|Q9HCM7|FBSL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	22-UNIMOD:21	ms_run[2]:scan=15763	98.715	3	2618.3622	2618.3622	R	S	989	1017
PSM	KQELEEICHDLEAR	10	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	8-UNIMOD:4	ms_run[2]:scan=11959	70.956	2	1768.8414	1768.8414	K	V	774	788
PSM	LHDFLAHSSEESEETSSPPR	11	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	17-UNIMOD:21	ms_run[2]:scan=8835	51.187	3	2333.9801	2333.9801	K	L	18	38
PSM	RHTLSEVTNQLVVMPGAGK	12	sp|Q9H0K1|SIK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	3-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=11756	69.623	3	2132.0449	2132.0449	R	I	482	501
PSM	RLDSDAVNTIESQSVSPDHNKEPK	13	sp|Q9H3H1-6|MOD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	16-UNIMOD:21	ms_run[2]:scan=9506	55.21	3	2745.2607	2745.2607	R	E	124	148
PSM	SHHAPMSPGSSGGGGQPLAR	14	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2540	14.33	3	1982.8418	1982.8418	R	T	357	377
PSM	TEHSHSPGDSSAPIQNTDCCHSSER	15	sp|Q13129|RLF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	6-UNIMOD:21,19-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=2650	15.07301	3	2877.099345	2875.092314	R	D	1623	1648
PSM	HPHDIIDDINSGAVECPAS	16	sp|P30050-2|RL12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	16-UNIMOD:4	ms_run[2]:scan=12875	76.816	2	2045.9113	2045.9113	R	-	114	133
PSM	HTFMGVVSLGSPSGEVSHPR	17	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11248	66.257	3	2175.9773	2175.9773	R	K	318	338
PSM	KQSLGELIGTLNAAK	18	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=16196	102.02	2	1621.844	1621.8440	R	V	19	34
PSM	REHASIDAQSGAGVPNPSTSASPK	19	sp|Q8IXJ6-5|SIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	22-UNIMOD:21	ms_run[2]:scan=6382	36.563	3	2443.1129	2443.1129	R	K	277	301
PSM	RGSGSALGGPLDPQFVGPSDTSLGAAPGHR	20	sp|P98174|FGD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=14673	90.139	3	2940.3879	2940.3879	R	V	46	76
PSM	RHSVVAGGGGGEGR	21	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=858	6.3818	2	1374.6154	1374.6154	K	K	961	975
PSM	DAAAHLQTSHKPSAEDAEGQSPLSQK	22	sp|Q96F24-3|NRBF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	21-UNIMOD:21	ms_run[2]:scan=6152	35.179	3	2782.2559	2782.2559	K	Y	83	109
PSM	HELQANCYEEVKDR	23	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:4	ms_run[2]:scan=5325	30.337	3	1789.8053	1789.8053	K	C	133	147
PSM	IEDVGSDEEDDSGKDK	24	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	6-UNIMOD:21	ms_run[2]:scan=3199	18.145	2	1816.6888	1816.6888	K	K	250	266
PSM	PGAEGAPLLPPPLPPPSPPGSGR	25	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:21	ms_run[2]:scan=15579	97.283	2	2237.1246	2237.1246	R	G	27	50
PSM	QRDEDDEAYGKPVK	26	sp|Q53GD3-4|CTL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=1899	11.007	2	1648.7693	1648.7693	K	Y	5	19
PSM	SHHAPMSPGSSGGGGQPLAR	27	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	7-UNIMOD:21	ms_run[2]:scan=4879	27.717	3	1966.8469	1966.8469	R	T	357	377
PSM	STAQQELDGKPASPTPVIVASHTANK	28	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	13-UNIMOD:21	ms_run[2]:scan=9419	54.697	3	2726.3276	2726.3276	R	E	818	844
PSM	VETLKEEEEELKR	29	sp|Q9Y3L3|3BP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=8302	48.032	2	1630.8414	1630.8414	K	K	188	201
PSM	GHLSRPEAQSLSPYTTSANR	30	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	10-UNIMOD:21	ms_run[2]:scan=8346	48.3	2	2251.0383	2251.0383	R	A	251	271
PSM	GHLSRPEAQSLSPYTTSANR	31	sp|O94776-2|MTA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=8425	48.738	3	2251.0383	2251.0383	R	A	251	271
PSM	LLKPGEEPSEYTDEEDTKDHNK	32	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	12-UNIMOD:21	ms_run[2]:scan=6519	37.444	3	2653.1433	2653.1433	R	Q	200	222
PSM	RAAEDDEDDDVDTKK	33	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1007	6.9084	3	1720.7388	1720.7388	K	Q	89	104
PSM	RHSFATEGAGAVENFAAAR	34	sp|Q6ZRV2|FA83H_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=12692	75.691	3	2040.9167	2040.9167	K	Q	409	428
PSM	RKPSPEPEGEVGPPK	35	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	4-UNIMOD:21	ms_run[2]:scan=3871	21.862	2	1682.8029	1682.8029	K	I	341	356
PSM	RPDHSGGSPSPPTSEPAR	36	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	8-UNIMOD:21	ms_run[2]:scan=1902	11.021	2	1910.8272	1910.8272	R	S	45	63
PSM	SETAPAETATPAPVEKSPAK	37	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=6994	40.308365	2	2102.9781	2102.9768	M	K	2	22
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	38	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	26-UNIMOD:21	ms_run[2]:scan=9999	58.351	3	3407.6452	3407.6452	R	N	215	246
PSM	ESEDKPEIEDVGSDEEEEK	39	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	13-UNIMOD:21	ms_run[2]:scan=7729	44.575	2	2271.8792	2271.8792	K	K	251	270
PSM	FADQDDIGNVSFDR	40	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=12638	75.332	2	1597.7009	1597.7009	K	V	489	503
PSM	HADHSSLTLGSGSSTTR	41	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	14-UNIMOD:21	ms_run[2]:scan=4405	24.887	2	1792.7741	1792.7741	R	L	2522	2539
PSM	KAPDADDQDVKR	42	sp|Q96NB3|ZN830_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=915	6.5842	2	1356.6634	1356.6634	R	A	104	116
PSM	LHEDDKEQDIADK	43	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2268	12.886	2	1554.7162	1554.7162	R	M	1113	1126
PSM	LKDLFDYSPPLHK	44	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	8-UNIMOD:21	ms_run[2]:scan=14403	88.111	2	1651.8011	1651.8011	K	N	503	516
PSM	LLKPGEEPSEYTDEEDTKDHNK	45	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	12-UNIMOD:21	ms_run[2]:scan=6362	36.434	3	2653.1433	2653.1433	R	Q	200	222
PSM	RDSSHNELYYEEAEHER	46	sp|Q8TAA9-2|VANG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=7233	41.613	3	2242.8917	2242.8917	R	R	334	351
PSM	RLSESLHVVDENKNESK	47	sp|Q8NFC6|BD1L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21	ms_run[2]:scan=7217	41.528	2	2062.9685	2062.9685	R	L	633	650
PSM	RLSTSPDVIQGHQPR	48	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=6861	39.453	2	1769.8574	1769.8574	R	D	264	279
PSM	RNSRTEEPTVASESVENGHR	49	sp|Q14686|NCOA6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21	ms_run[2]:scan=4269	24.182	3	2334.035	2334.0350	R	K	2016	2036
PSM	SKDQDDQKPGPSER	50	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=650	5.5743	2	1585.7332	1585.7332	K	S	467	481
PSM	SVSHGSNHTQKPDEQR	51	sp|Q9Y520-2|PRC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	1-UNIMOD:21	ms_run[2]:scan=595	5.3613	2	1885.8068	1885.8068	R	S	681	697
PSM	TLVHSSSDGHIDPQHAAGK	52	sp|Q8N5C8-2|TAB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	6-UNIMOD:21	ms_run[2]:scan=4548	25.708	3	2035.9113	2035.9113	R	Q	97	116
PSM	AAEDDEDDDVDTKK	53	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1213	7.7677	2	1564.6377	1564.6377	R	Q	90	104
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	54	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	26-UNIMOD:21	ms_run[2]:scan=9526	55.336	3	3407.6452	3407.6452	R	N	215	246
PSM	DVDDGSGSPHSPHQLSSK	55	sp|Q9H4A3-4|WNK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=2626	14.927	2	1848.8238	1848.8238	R	S	1615	1633
PSM	HTFMGVVSLGSPSGEVSHPR	56	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11132	65.466	2	2175.9773	2175.9773	R	K	318	338
PSM	IHIDPEIQDGSPTTSR	57	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	11-UNIMOD:21	ms_run[2]:scan=9542	55.421	2	1844.8306	1844.8306	R	R	102	118
PSM	LRGTQEVAPPTPLTPTSHTANTSPR	58	sp|P48730-2|KC1D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21	ms_run[2]:scan=9125	52.895	3	2708.3283	2708.3283	R	P	334	359
PSM	PGAEGAPLLPPPLPPPSPPGSGR	59	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	17-UNIMOD:21	ms_run[2]:scan=15321	95.258	2	2237.1246	2237.1246	R	G	27	50
PSM	RADDFPVRDDPSDVTDEDEGPAEPPPPPK	60	sp|Q3YEC7|RABL6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	12-UNIMOD:21	ms_run[2]:scan=11187	65.86	3	3239.3932	3239.3932	R	L	585	614
PSM	RENPPVEDSSDEDDKR	61	sp|Q8TCJ2|STT3B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1546	9.3132	2	1886.8242	1886.8242	K	N	490	506
PSM	RRGSDIDNPTLTVMDISPPSR	62	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=11915	70.655	3	2422.1312	2422.1312	R	S	328	349
PSM	SFPLHSPVAGVAHR	63	sp|Q96JN8-2|NEUL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=9418	54.693	2	1553.7504	1553.7504	K	F	900	914
PSM	SGPKPFSAPKPQTSPSPK	64	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	16-UNIMOD:21	ms_run[2]:scan=5649	32.188	2	1916.9397	1916.9397	R	R	294	312
PSM	SQDKLDKDDLEK	65	sp|Q14185|DOCK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=3251	18.414	2	1432.7046	1432.7046	R	E	1681	1693
PSM	TLVHSSSDGHIDPQHAAGK	66	sp|Q8N5C8-2|TAB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	7-UNIMOD:21	ms_run[2]:scan=4467	25.22	2	2035.9113	2035.9113	R	Q	97	116
PSM	VIPAKSPPPPTHSTQLGAPSR	67	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	6-UNIMOD:21	ms_run[2]:scan=6335	36.287	3	2217.1307	2217.1307	K	K	200	221
PSM	AAPPPPPPPPPLESSPR	68	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	15-UNIMOD:21	ms_run[2]:scan=9374	54.415	3	1782.8706	1782.8706	K	V	606	623
PSM	AGIPQHHPPMAQNLQYPDDSDDEK	69	sp|Q15223|NECT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	10-UNIMOD:35,20-UNIMOD:21	ms_run[2]:scan=8312	48.089	3	2798.1643	2798.1643	K	K	403	427
PSM	ALVLIAFAQYLQQCPFEDHVK	70	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:4	ms_run[2]:scan=22206	151.41	3	2489.2777	2489.2777	K	L	45	66
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	71	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	28-UNIMOD:21	ms_run[2]:scan=9839	57.347	3	3407.6452	3407.6452	R	N	215	246
PSM	DADDAVYELDGK	72	sp|Q13243-2|SRSF5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10332	60.473	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELNGK	73	sp|Q13247-2|SRSF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=9229	53.519	2	1308.5834	1308.5834	R	E	47	59
PSM	DLDDIEDENEQLK	74	sp|Q96IZ0|PAWR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=11017	64.714	2	1574.6948	1574.6948	R	Q	313	326
PSM	EQGSDEISHHEK	75	sp|Q05682|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=960	6.7386	2	1394.6062	1394.6062	R	M	245	257
PSM	GVVDSDDLPLNVSR	76	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=12887	76.891	2	1484.7471	1484.7471	K	E	435	449
PSM	HDEDEDDSLKDR	77	sp|O94915|FRYL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=1511	9.1577	2	1472.6015	1472.6015	R	E	1330	1342
PSM	IGHHSTSDDSSAYR	78	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=1509	9.1504	3	1611.6315	1611.6315	R	S	333	347
PSM	KPEKPLFSSASPQDSSPR	79	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=6881	39.572	3	2036.9568	2036.9568	K	L	66	84
PSM	KPRPSEGDEDCLPASK	80	sp|P78346|RPP30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=3623	20.469	3	1864.8026	1864.8026	K	K	247	263
PSM	KQDFDEDDILK	81	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=10131	59.168	2	1364.646	1364.6460	K	E	50	61
PSM	LKSEDELRPEVDEHTQK	82	sp|Q96D71-2|REPS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=6030	34.458	2	2131.9787	2131.9787	R	T	616	633
PSM	PLPTLEVKPPDRPSSK	83	sp|Q12872|SFSWA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	14-UNIMOD:21	ms_run[2]:scan=11099	65.267	2	1839.9496	1839.9496	R	S	729	745
PSM	RESGPGIAPGPEPHGLTNK	84	sp|P21860-5|ERBB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=7269	41.804	3	1992.9419	1992.9419	K	K	337	356
PSM	RRPESAPAESSPSK	85	sp|Q07889|SOS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	5-UNIMOD:21	ms_run[2]:scan=803	6.1773	2	1577.7199	1577.7199	R	I	1157	1171
PSM	RSYDVPPPPMEPDHPFYSNISK	86	sp|Q8N0Y7|PGAM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	2-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=12394	73.71	3	2668.1669	2668.1669	R	D	117	139
PSM	RVGMADANSPPKPLSK	87	sp|P26358|DNMT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	4-UNIMOD:35,15-UNIMOD:21	ms_run[2]:scan=4146	23.473	2	1762.8437	1762.8437	R	P	119	135
PSM	RVSLEPHQGPGTPESK	88	sp|Q14980-5|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:21	ms_run[2]:scan=4169	23.601	2	1797.8411	1797.8411	K	K	853	869
PSM	SKDQDDQKPGPSER	89	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=649	5.5712	3	1585.7332	1585.7332	K	S	467	481
PSM	VERPPSPFSMAPQASLPPVPPR	90	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14186	86.508	3	2452.1974	2452.1974	K	L	478	500
PSM	VIPAKSPPPPTHSTQLGAPSR	91	sp|Q14814-6|MEF2D_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=6494	37.294	3	2217.1307	2217.1307	K	K	200	221
PSM	KEESEESDDDMGFGLFD	92	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	4-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=15859	99.447535	2	2045.715055	2044.713279	K	-	98	115
PSM	APVHFVEPLSPTGVAGHR	93	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=12408	73.805	2	1949.9513	1949.9513	K	K	793	811
PSM	ARSPPQPLGELKR	94	sp|Q96FF7|MISP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=7982	46.157	3	1527.7923	1527.7923	R	F	89	102
PSM	DPDAQPGGELMLGGTDSK	95	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:35	ms_run[2]:scan=9302	53.983	2	1802.7993	1802.7993	R	Y	236	254
PSM	EREEEDDYRQEEQR	96	sp|Q99795|GPA33_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=2015	11.611	2	1909.8038	1909.8038	R	S	294	308
PSM	FNLTYVSHDGDDKK	97	sp|P26639|SYTC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=8273	47.85	2	1637.7686	1637.7686	R	R	571	585
PSM	FPPEDFRHSPEDFR	98	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=11739	69.509	2	1854.7727	1854.7727	R	R	567	581
PSM	GDDGIFDDNFIEER	99	sp|O60493-2|SNX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=16191	101.98	2	1640.6954	1640.6954	R	K	73	87
PSM	GPPSPPAPVMHSPSR	100	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5086	28.974	2	1608.712	1608.7120	R	K	221	236
PSM	HAPSLHGSTELLPLSR	101	sp|Q9H5N1-2|RABE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=12070	71.637	2	1793.8825	1793.8825	R	D	186	202
PSM	IGHHSTSDDSSAYR	102	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=1503	9.1144	2	1611.6315	1611.6315	R	S	333	347
PSM	KHPGGGESDASPEAGSGGGGVALK	103	sp|Q9UHI5|LAT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	16-UNIMOD:21	ms_run[2]:scan=4471	25.24	3	2200.975	2200.9750	K	K	14	38
PSM	LHKPPADSGVDLR	104	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=5244	29.933	2	1483.7184	1483.7184	K	E	429	442
PSM	LHSAPNLSDLHVVR	105	sp|O75385|ULK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=12129	72.026	3	1636.8087	1636.8087	R	P	554	568
PSM	LKDLFDYSPPLHK	106	sp|Q9NYF8-3|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=14544	89.133	2	1651.8011	1651.8011	K	N	503	516
PSM	PGAEGAPLLPPPLPPPSPPGSGR	107	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	17-UNIMOD:21	ms_run[2]:scan=15449	96.277	2	2237.1246	2237.1246	R	G	27	50
PSM	RNDHDDDEDEEVISK	108	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3077	17.52	3	1814.7555	1814.7555	K	T	341	356
PSM	RPNKQEESESPVER	109	sp|Q96SB4-4|SRPK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=1064	7.1174	2	1763.784	1763.7840	K	P	286	300
PSM	SLNSTPPPPPAPAPAPPPALAR	110	sp|Q8TE68-4|ES8L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=11766	69.686	2	2195.114	2195.1140	R	P	328	350
PSM	VKDDIESLHDK	111	sp|Q14204|DYHC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=3808	21.501	2	1297.6514	1297.6514	R	F	612	623
PSM	VLTPPHDVDSLPHLR	112	sp|Q9P1Y5|CAMP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=13758	83.269	3	1774.8767	1774.8767	R	K	797	812
PSM	YDERPGPSPLPHR	113	sp|P08621-4|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	8-UNIMOD:21	ms_run[2]:scan=5293	30.173	3	1599.7195	1599.7195	R	D	123	136
PSM	YHGHSMSDPGVSYR	114	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=3276	18.528	2	1687.645	1687.6450	R	T	258	272
PSM	YSPSQNSPIHHIPSR	115	sp|Q9NYF8-3|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	2-UNIMOD:21	ms_run[2]:scan=7634	43.995	2	1798.8152	1798.8152	R	R	282	297
PSM	QRDEDDEAYGKPVK	116	sp|Q53GD3|CTL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=3519	19.849733333333333	2	1631.7441	1631.7422	K	Y	5	19
PSM	RKPEDVLDDDDAGSAPLK	117	sp|P35613|BASI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	14-UNIMOD:21	ms_run[1]:scan=9640	56.09488833333333	3	2019.917478	2019.915031	R	S	349	367
PSM	AAPPPPPPPPPLESSPR	118	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	15-UNIMOD:21	ms_run[2]:scan=9541	55.419	3	1782.8706	1782.8706	K	V	606	623
PSM	ARSPPQPLGELKR	119	sp|Q96FF7|MISP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=7822	45.142	3	1527.7923	1527.7923	R	F	89	102
PSM	ARSPPQPLGELKR	120	sp|Q96FF7|MISP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=8156	47.176	3	1527.7923	1527.7923	R	F	89	102
PSM	DGDDVIIIGVFK	121	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17816	114.93	2	1289.6867	1289.6867	K	G	302	314
PSM	DKEVSDDEAEEK	122	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	5-UNIMOD:21	ms_run[2]:scan=1215	7.7749	2	1472.5556	1472.5556	R	E	227	239
PSM	DPDDHTVCHLLFANQTEK	123	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:4	ms_run[2]:scan=12915	77.077	2	2138.9691	2138.9691	K	D	174	192
PSM	DPDDHTVCHLLFANQTEK	124	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:4	ms_run[2]:scan=13049	77.993	3	2138.9691	2138.9691	K	D	174	192
PSM	FHQLDIDDLQSIR	125	sp|P16152-2|CBR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=14837	91.372	2	1598.8053	1598.8053	R	A	59	72
PSM	GHVAHLEDDEGDDDESK	126	sp|Q8IVH8-3|M4K3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=2214	12.606	3	1866.7504	1866.7504	R	H	386	403
PSM	GKDSYETSQLDDQSAETHSHK	127	sp|P10451-3|OSTP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	14-UNIMOD:21	ms_run[2]:scan=4244	24.029	3	2441.9973	2441.9973	R	Q	194	215
PSM	GVHIHQAGGSPPASSTSSSSLTNDVAK	128	sp|Q8N122-3|RPTOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:21	ms_run[2]:scan=7891	45.562	3	2671.2239	2671.2239	K	Q	710	737
PSM	IKDPDASKPEDWDER	129	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=6964	40.118	2	1799.8326	1799.8326	K	A	208	223
PSM	KKEPAITSQNSPEAR	130	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=1771	10.412	2	1734.8302	1734.8302	K	E	69	84
PSM	KKEPAITSQNSPEAR	131	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=1974	11.355	3	1734.8302	1734.8302	K	E	69	84
PSM	LHDFLAHSSEESEETSSPPR	132	sp|P46100-6|ATRX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	16-UNIMOD:21	ms_run[2]:scan=8864	51.346	2	2333.9801	2333.9801	K	L	18	38
PSM	LLKPGEEPSEYTDEEDTK	133	sp|O15173|PGRC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:21	ms_run[2]:scan=8259	47.77	3	2158.9195	2158.9195	R	D	200	218
PSM	MGHAGAIIAGGK	134	sp|P53597|SUCA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	1-UNIMOD:35	ms_run[2]:scan=2449	13.853	2	1097.5652	1097.5652	R	G	297	309
PSM	PCLHSATPSTPQTDPTGPEGPHLGQSR	135	sp|Q2NKJ3-2|CTC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:4,9-UNIMOD:21	ms_run[2]:scan=8592	49.74	3	2904.2862	2904.2862	R	L	670	697
PSM	PGAEGAPLLPPPLPPPSPPGSGR	136	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	17-UNIMOD:21	ms_run[2]:scan=15568	97.202	3	2237.1246	2237.1246	R	G	27	50
PSM	RESPSPAPKPR	137	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=871	6.4255	2	1300.6289	1300.6289	K	K	448	459
PSM	RHNSASVENVSLR	138	sp|Q9Y4H2|IRS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=5360	30.529	2	1547.7206	1547.7206	K	K	1171	1184
PSM	RLSEQLAHTPTAFK	139	sp|Q9UBF8-3|PI4KB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=10367	60.692	2	1677.824	1677.8240	R	R	177	191
PSM	RNDHDDDEDEEVISK	140	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=3083	17.547	2	1814.7555	1814.7555	K	T	341	356
PSM	RNSSEASSGDFLDLK	141	sp|Q9UK76|JUPI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=12552	74.772	2	1704.7356	1704.7356	R	G	85	100
PSM	RPPSVGDVFHGISK	142	sp|P78312-3|F193A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21	ms_run[2]:scan=12796	76.326	2	1574.7606	1574.7606	K	E	639	653
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	143	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=8556	49.525	3	2602.1925	2602.1925	R	F	118	143
PSM	RRGSDIDNPTLTVMDISPPSR	144	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=12075	71.664	3	2422.1312	2422.1312	R	S	328	349
PSM	SAPTAPTPPPPPPPATPR	145	sp|Q14202-2|ZMYM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	7-UNIMOD:21	ms_run[2]:scan=7867	45.411	2	1827.892	1827.8921	R	K	799	817
PSM	SHSDASVGSHSSTESEHGSSSPR	146	sp|Q6XZF7-2|DNMBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	20-UNIMOD:21	ms_run[2]:scan=807	6.1915	3	2390.9361	2390.9361	R	F	597	620
PSM	SLVLGHQSQSSPPHGEADGHPSEK	147	sp|Q9ULL8-2|SHRM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:21	ms_run[2]:scan=5094	29.027	3	2560.1344	2560.1344	R	G	368	392
PSM	VERPPSPFSMAPQASLPPVPPR	148	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=14607	89.615	3	2452.1974	2452.1974	K	L	478	500
PSM	KGEDEDKGPPCGPVNCNEK	149	sp|Q06323|PSME1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	11-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=2973	16.936575	3	2129.901649	2128.915368	K	I	91	110
PSM	ALAMPGRPESPPVFR	150	sp|Q63ZY3|KANK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	4-UNIMOD:35,10-UNIMOD:21	ms_run[1]:scan=10550	61.82877333333333	2	1720.821121	1719.816778	R	S	366	381
PSM	FASDDEHDEHDENGATGPVKR	151	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	3-UNIMOD:21	ms_run[1]:scan=4006	22.628420000000002	3	2405.942862	2404.955726	K	A	364	385
PSM	AGPPAPAPPAPIPPPAPSQSSPPEQPQSMEMR	152	sp|Q8WUF5|IASPP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	21-UNIMOD:21,29-UNIMOD:35,31-UNIMOD:35	ms_run[2]:scan=11065	65.04	3	3325.5149	3325.5149	R	S	577	609
PSM	DRDDFPVVLVGNK	153	sp|P10301|RRAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=13245	79.421	2	1472.7623	1472.7623	K	A	131	144
PSM	EPRPNSSPSPSPGQASETPHPRPS	154	sp|O00204-2|ST2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	6-UNIMOD:21	ms_run[2]:scan=4380	24.766	3	2575.1453	2575.1453	R	-	327	351
PSM	FHVGSAESMLHVR	155	sp|O75140-6|DEPD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=10217	59.724	3	1564.6858	1564.6858	R	P	575	588
PSM	GRPPAEKLSPNPPK	156	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=4101	23.188	2	1566.7919	1566.7919	R	L	1369	1383
PSM	GSQHSPTRPPVAAAAASLGSLPGPGAAR	157	sp|Q86VQ1|GLCI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	7-UNIMOD:21	ms_run[2]:scan=13791	83.527	3	2660.3184	2660.3184	R	G	75	103
PSM	HAIMRSPQMVSAIVR	158	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:35,6-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=6619	38.023	2	1806.8634	1806.8634	R	T	186	201
PSM	HTFMGVVSLGSPSGEVSHPR	159	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=13645	82.437	3	2159.9823	2159.9823	R	K	318	338
PSM	KAPDADDQDVKR	160	sp|Q96NB3|ZN830_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=912	6.5741	3	1356.6634	1356.6634	R	A	104	116
PSM	KEEEEEEEEYDEGSNLKK	161	sp|Q14165|MLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4965	28.242	3	2212.9495	2212.9495	K	Q	230	248
PSM	KLEEEEDGKLK	162	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=2277	12.931	3	1316.6824	1316.6824	R	K	164	175
PSM	KLMHSSSLTNSSIPR	163	sp|Q08499-5|PDE4D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=6040	34.516	3	1752.823	1752.8230	K	F	67	82
PSM	KPISLGHPGSLK	164	sp|Q8NEY1-6|NAV1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=6784	39.002	2	1312.6904	1312.6904	K	K	519	531
PSM	KSHSSPSLHQDEAPTTAK	165	sp|Q8NDX1-2|PSD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=2298	13.021	3	1999.9	1999.9000	K	V	987	1005
PSM	KTAHNSEADLEESFNEHELEPSSPK	166	sp|Q8IWS0-5|PHF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	23-UNIMOD:21	ms_run[2]:scan=11634	68.815	3	2904.2451	2904.2451	K	S	99	124
PSM	LTRPFPTGTPPPLPPK	167	sp|Q9BQI5-4|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=12457	74.128	3	1794.9434	1794.9434	K	N	207	223
PSM	LVHSGPGKGSPQAGVDLSFATR	168	sp|Q13884|SNTB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=11242	66.216	3	2260.1001	2260.1001	R	T	380	402
PSM	NKPGPNIESGNEDDDASFK	169	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	9-UNIMOD:21	ms_run[2]:scan=7878	45.482	2	2112.8637	2112.8637	K	I	206	225
PSM	PGAEGAPLLPPPLPPPSPPGSGR	170	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=15713	98.326	2	2237.1246	2237.1246	R	G	27	50
PSM	PRPPQSSTGSTASPPVSTPVTGHK	171	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=6315	36.192	3	2452.1748	2452.1748	K	R	139	163
PSM	REDQGPPCPSPVGGGDPLHR	172	sp|Q13563-2|PKD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	8-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=7922	45.771	3	2206.9579	2206.9579	R	H	157	177
PSM	RGHVTPNLSR	173	sp|Q96CP6-2|GRM1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=2425	13.721	2	1215.5874	1215.5874	R	A	266	276
PSM	RKSEPAVGPPR	174	sp|O94875-9|SRBS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=2243	12.759	3	1272.634	1272.6340	R	G	328	339
PSM	RKTDTVVESSVSGDHSGTLR	175	sp|Q9NXL2-1|ARH38_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=5677	32.359	3	2210.0329	2210.0329	R	R	32	52
PSM	RPSGTGTGPEDGRPSLGSPYGQPPR	176	sp|P50479-2|PDLI4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	15-UNIMOD:21	ms_run[2]:scan=8208	47.492	3	2602.1925	2602.1925	R	F	118	143
PSM	RQHSSDSVSSINSATSHSSVGSNIESDSK	177	sp|Q8IVL1-6|NAV2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:21	ms_run[2]:scan=7478	43.063	3	3069.3273	3069.3273	R	K	185	214
PSM	SKDQDDQKPGPSER	178	sp|Q15424-2|SAFB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=742	5.932	2	1585.7332	1585.7332	K	S	467	481
PSM	SLHSAHSLASR	179	sp|O15027-2|SC16A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=2083	11.937	2	1244.5663	1244.5663	R	R	1356	1367
PSM	SRPFTVAASFQSTSVKSPK	180	sp|Q9UHB6|LIMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=10844	63.628	3	2104.0354	2104.0354	R	T	588	607
PSM	TPHVQAVQGPLGSPPKR	181	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=7875	45.463	3	1847.9407	1847.9407	R	G	113	130
PSM	TPHVQAVQGPLGSPPKR	182	sp|Q15149|PLEC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	13-UNIMOD:21	ms_run[2]:scan=8035	46.48	3	1847.9407	1847.9407	R	G	113	130
PSM	VADPDHDHTGFLTEYVATR	183	sp|P28482-2|MK01_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=12671	75.555	3	2142.997	2142.9970	R	W	173	192
PSM	VHTECCHGDLLECADDR	184	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6542	37.569	3	2085.8303	2085.8303	K	A	265	282
PSM	VHTECCHGDLLECADDR	185	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=7135	41.116	3	2085.8303	2085.8303	K	A	265	282
PSM	VKSPGGPGSHVR	186	sp|O75382-4|TRIM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=1100	7.2591	3	1256.6027	1256.6027	R	Q	316	328
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	187	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=14329	87.55629	3	3442.4047	3442.4027	K	L	104	135
PSM	QLHEYETELEDERK	188	sp|P35749|MYH11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=12248	72.74876166666667	3	1800.8187	1800.8161	R	Q	1597	1611
PSM	RKSQVNGEAGSYEMTNQHVK	189	sp|Q05D32|CTSL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21,14-UNIMOD:35	ms_run[1]:scan=3009	17.148576666666667	3	2359.028353	2358.042374	R	Q	102	122
PSM	VHIPNDDAQFDASHCDSDK	190	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	15-UNIMOD:4	ms_run[1]:scan=8279	47.88668333333333	3	2170.887556	2169.902161	R	G	83	102
PSM	AAPPPPPPPPPLESSPR	191	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	14-UNIMOD:21	ms_run[2]:scan=9539	55.407	2	1782.8706	1782.8706	K	V	606	623
PSM	ALRPGDLPPSPDDVKR	192	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=9177	53.214	3	1811.8931	1811.8931	R	R	299	315
PSM	ARPSSPSTSWHR	193	sp|Q3KQU3-2|MA7D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=3330	18.808	2	1447.6358	1447.6358	K	P	428	440
PSM	ASPGHSPHYFAASSPTSPNALPPAR	194	sp|Q8TEM1|PO210_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	16-UNIMOD:21	ms_run[2]:scan=9842	57.362	3	2596.186	2596.1860	R	K	1847	1872
PSM	DGPVRPQNAEEEKR	195	sp|Q92504|S39A7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1654	9.8313	3	1623.7965	1623.7965	K	G	298	312
PSM	DKDDKISWEEYK	196	sp|Q15293-2|RCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=8892	51.508	3	1554.7202	1554.7202	R	Q	79	91
PSM	EESGKPGAHVTVK	197	sp|P22626-2|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1260	7.9586	2	1337.6939	1337.6939	R	K	88	101
PSM	EKEISDDEAEEEKGEK	198	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=2852	16.215	2	1943.7885	1943.7885	R	E	222	238
PSM	GPPSPPAPVMHSPSR	199	sp|Q13573|SNW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5138	29.278	3	1608.712	1608.7120	R	K	221	236
PSM	GVTIPYRPKPSSSPVIFAGGQDR	200	sp|Q15366|PCBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=12928	77.163	3	2508.2526	2508.2526	K	Y	177	200
PSM	HAHSSSLQQAASR	201	sp|O95425-2|SVIL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=1171	7.5857	2	1458.6365	1458.6365	K	S	248	261
PSM	HAIMRSPQMVSAIVR	202	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35,6-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=6757	38.861	3	1806.8634	1806.8634	R	T	186	201
PSM	HIHITQATETTTTR	203	sp|Q14677-2|EPN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=4265	24.155	3	1688.7883	1688.7883	K	H	243	257
PSM	HLEHAPSPSDVSNAPEVK	204	sp|Q9Y4C1|KDM3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	7-UNIMOD:21	ms_run[2]:scan=7617	43.899	3	1992.8942	1992.8942	K	A	439	457
PSM	HSSDINHLVTQGRESPEGSYTDDANQEVR	205	sp|Q5T0N5-3|FBP1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=9664	56.258	3	3320.4331	3320.4331	R	G	429	458
PSM	HSTPSNSSNPSGPPSPNSPHR	206	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=1936	11.185	3	2219.9345	2219.9345	K	S	1676	1697
PSM	HTFMGVVSLGSPSGEVSHPR	207	sp|P02765|FETUA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=11097	65.256	3	2175.9773	2175.9773	R	K	318	338
PSM	IKDPDASKPEDWDER	208	sp|P27797|CALR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=6398	36.659	2	1799.8326	1799.8326	K	A	208	223
PSM	KFDGVEGPRTPK	209	sp|Q6PKG0-3|LARP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	10-UNIMOD:21	ms_run[2]:scan=4212	23.85	2	1409.6704	1409.6704	R	Y	290	302
PSM	KIPVFHNGSTPTLGETPK	210	sp|Q9Y6M7-11|S4A7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=10993	64.551	2	2001.9925	2001.9925	R	E	429	447
PSM	KLHVSTINLQK	211	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=8769	50.805	2	1359.7276	1359.7276	K	A	1257	1268
PSM	KPNATRPVTPPR	212	sp|P36873|PP1G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=2415	13.669	2	1412.7289	1412.7289	K	G	303	315
PSM	KPSPSESPEPWKPFPAVSPEPR	213	sp|Q96JM3|CHAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=13851	84.004	3	2525.1992	2525.1992	R	R	280	302
PSM	KQELEEICHDLEAR	214	sp|P35579-2|MYH9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:4	ms_run[2]:scan=11926	70.72	3	1768.8414	1768.8414	K	V	774	788
PSM	KSPTLLEVSMPHFMR	215	sp|P51787-2|KCNQ1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	2-UNIMOD:21,10-UNIMOD:35,14-UNIMOD:35	ms_run[2]:scan=12256	72.805	3	1883.8675	1883.8675	R	T	340	355
PSM	KTHSAASSSQGASVNPEPLHSSLDK	216	sp|Q92574-2|TSC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=6586	37.833	3	2614.2024	2614.2024	R	L	467	492
PSM	LHEDDKEQDIADK	217	sp|P55011|S12A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2290	12.988	3	1554.7162	1554.7162	R	M	1113	1126
PSM	LHKPPADSGVDLR	218	sp|O15427|MOT4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=5432	30.944	2	1483.7184	1483.7184	K	E	429	442
PSM	LLKPGEEPSEYTDEEDTKDHNK	219	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	12-UNIMOD:21	ms_run[2]:scan=6527	37.484	2	2653.1433	2653.1433	R	Q	200	222
PSM	LTRPFPTGTPPPLPPK	220	sp|Q9BQI5-4|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=12771	76.169	3	1794.9434	1794.9434	K	N	207	223
PSM	MPGMSPANPSLHSPVPDASHSPR	221	sp|O60244|MED14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	1-UNIMOD:35,4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=7142	41.15	3	2480.0614	2480.0614	R	A	1124	1147
PSM	NHPGCIPLEGPHSISPETTVTSR	222	sp|Q5TC79|ZBT37_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:4,15-UNIMOD:21	ms_run[2]:scan=11629	68.784	3	2565.1683	2565.1683	K	G	451	474
PSM	PRPPQSSTGSTASPPVSTPVTGHK	223	sp|Q93052|LPP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=6478	37.201	3	2452.1748	2452.1748	K	R	139	163
PSM	RAHTPTPGIYMGR	224	sp|Q13595-3|TRA2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4272	24.198	3	1551.7017	1551.7017	K	P	98	111
PSM	REHASIDAQSGAGVPNPSTSASPK	225	sp|Q8IXJ6-5|SIR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	22-UNIMOD:21	ms_run[2]:scan=6219	35.559	3	2443.1129	2443.1129	R	K	277	301
PSM	RGESLDNLDSPR	226	sp|Q8WWI1-3|LMO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=7006	40.371	2	1437.6249	1437.6249	R	S	1173	1185
PSM	RHNSASVENVSLR	227	sp|Q9Y4H2|IRS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=4905	27.893	3	1547.7206	1547.7206	K	K	1171	1184
PSM	RHSLEVMNSMVR	228	sp|Q15678|PTN14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,7-UNIMOD:35,10-UNIMOD:35	ms_run[2]:scan=3456	19.492	3	1569.6793	1569.6793	K	G	640	652
PSM	RHTVGGGEMAR	229	sp|Q9BWN1|PRR14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=665	5.6323	3	1265.5336	1265.5336	R	A	361	372
PSM	RKPSVPDSASPADDSFVDPGER	230	sp|P16333-2|NCK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=9470	55.012	3	2408.0645	2408.0645	K	L	18	40
PSM	RLGPLSAEGTTGLAPAGQTSEESRPR	231	sp|Q16473|TENXA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	19-UNIMOD:21	ms_run[2]:scan=10631	62.316	3	2717.3134	2717.3134	K	L	120	146
PSM	RLSTSPDVIQGHQPR	232	sp|Q9Y385|UB2J1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=6841	39.326	3	1769.8574	1769.8574	R	D	264	279
PSM	RNDHDDDEDEEVISK	233	sp|Q12789-3|TF3C1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=2903	16.502	3	1814.7555	1814.7555	K	T	341	356
PSM	RRSQAELETLVLSR	234	sp|Q00G26|PLIN5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=12862	76.735	3	1736.8934	1736.8934	R	S	275	289
PSM	RSTVLGLPQHVQK	235	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=7972	46.088	3	1541.8079	1541.8079	R	E	160	173
PSM	SHHAPMSPGSSGGGGQPLAR	236	sp|O14497-2|ARI1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=2356	13.333	3	1982.8418	1982.8418	R	T	357	377
PSM	SLGDDISSETSGDFR	237	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12234	72.663	2	1584.6904	1584.6904	K	K	139	154
PSM	SPLTPEKEVGYLEFTGPPQKPPR	238	sp|Q14289-2|FAK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=14917	92.004	3	2646.3095	2646.3095	K	L	797	820
PSM	SPSPPLPTHIPPEPPR	239	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=11597	68.558	3	1797.8815	1797.8815	R	T	326	342
PSM	SRSPLGFYVHLK	240	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=13336	80.087	2	1482.7384	1482.7385	R	N	278	290
PSM	SRSPLHPMSEIPR	241	sp|Q9NVW2-2|RNF12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=6351	36.374	2	1601.7385	1601.7385	R	R	87	100
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	242	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	13-UNIMOD:21	ms_run[2]:scan=8969	51.971	3	3112.5078	3112.5078	R	S	818	847
PSM	THEAEIVEGENHTYCIR	243	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:4	ms_run[2]:scan=8777	50.853	3	2056.9273	2056.9273	K	F	2177	2194
PSM	THEAEIVEGENHTYCIR	244	sp|P21333-2|FLNA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:4	ms_run[2]:scan=8826	51.146	3	2056.9273	2056.9273	K	F	2177	2194
PSM	VEQHVVDGKER	245	sp|Q9Y3I0|RTCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1118	7.3327	2	1294.663	1294.6630	K	T	358	369
PSM	VGGSSVDLHR	246	sp|O60716-24|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=4396	24.844	2	1105.4917	1105.4917	R	F	164	174
PSM	VNVDEVGGEALGR	247	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=10250	59.92	2	1313.6575	1313.6575	K	L	19	32
PSM	VSKPSQLQAHTPASQQTPPLPPYASPR	248	sp|Q96ST3|SIN3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	23-UNIMOD:21	ms_run[2]:scan=10699	62.751	3	2962.4702	2962.4702	K	S	250	277
PSM	LKEFLEDYDDDRDD	249	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24		ms_run[1]:scan=11625	68.76007	3	1786.7543	1786.7528	R	P	496	510
PSM	SGPKPFSAPKPQTSPSPK	250	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	14-UNIMOD:21	ms_run[1]:scan=4532	25.598953333333334	2	1917.944694	1916.939729	R	R	295	313
PSM	SGPKPFSAPKPQTSPSPK	251	sp|Q01518|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	14-UNIMOD:21	ms_run[1]:scan=6108	34.91377833333333	2	1917.925828	1916.939729	R	R	295	313
PSM	QRDEDDEAYGKPVK	252	sp|Q53GD3|CTL4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=1920	11.102558333333333	3	1631.7430	1631.7422	K	Y	5	19
PSM	KKVEEEDEEEEEEEEEEEEEEDE	253	sp|O15347|HMGB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=7050	40.62543	3	2928.098386	2926.089467	R	-	178	201
PSM	QPYPSRPPFDNQHSQDLDSR	254	sp|Q07157|ZO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28,14-UNIMOD:21	ms_run[1]:scan=11214	66.05016666666667	3	2446.0349	2446.0334	K	Q	1098	1118
PSM	ALQHTESPSETNKPHSK	255	sp|Q14669|TRIPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=918	6.5947	2	1969.8895	1969.8895	K	S	94	111
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	256	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	28-UNIMOD:21	ms_run[2]:scan=9677	56.341	3	3407.6452	3407.6452	R	N	215	246
PSM	APSAVSPIPAVIPSPSHKPSK	257	sp|Q9ULK2-3|AT7L1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=11465	67.697	3	2146.1188	2146.1188	K	T	476	497
PSM	DASDDLDDLNFFNQK	258	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=17609	113.3	2	1755.7588	1755.7588	K	K	65	80
PSM	DKFNECGHVLYADIK	259	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:4	ms_run[2]:scan=10907	64.007	2	1807.8563	1807.8563	K	M	632	647
PSM	DPDDHTVCHLLFANQTEK	260	sp|P00387-2|NB5R3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:4	ms_run[2]:scan=12901	76.984	3	2138.9691	2138.9691	K	D	174	192
PSM	DTYHPMSEYPTYHTHGR	261	sp|P15941-12|MUC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=6105	34.899	3	2186.8517	2186.8517	R	Y	105	122
PSM	ESLFHSEHGALAQVGSPGAGR	262	sp|Q8TF44|C2C4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:21	ms_run[2]:scan=11125	65.422	3	2185.9906	2185.9906	K	R	163	184
PSM	FASDDEHDEHDENGATGPVKR	263	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3941	22.271	3	2404.9557	2404.9557	K	A	364	385
PSM	FHVGSAESMLHVR	264	sp|O75140-6|DEPD5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=10237	59.836	2	1564.6858	1564.6858	R	P	575	588
PSM	GMKDDKEEEEDGTGSPQLNNR	265	sp|P49407-2|ARRB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=2885	16.407	3	2364.0136	2364.0136	K	-	390	411
PSM	HFTNWTKPTSPTR	266	sp|Q9H792|PEAK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	10-UNIMOD:21	ms_run[2]:scan=6708	38.575	2	1651.7508	1651.7508	R	S	889	902
PSM	HMSADDLNDGFVLDKDDR	267	sp|P78316-2|NOP14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35	ms_run[2]:scan=10484	61.434	3	2077.9011	2077.9011	K	R	311	329
PSM	HPPVLTPPDQEVIR	268	sp|P05771-2|KPCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21	ms_run[2]:scan=11644	68.87	3	1676.8287	1676.8287	R	N	636	650
PSM	HQPSTPDPFLKPR	269	sp|O14686|KMT2D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=8053	46.589	3	1598.7606	1598.7606	R	C	2236	2249
PSM	IIHHSGSMDQR	270	sp|P51178|PLCD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21,8-UNIMOD:35	ms_run[2]:scan=651	5.5779	2	1375.5704	1375.5704	K	Q	128	139
PSM	IVDKPGDHDPETLEAIAENAK	271	sp|Q96Q11-2|TRNT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12114	71.922	3	2261.1176	2261.1176	R	G	208	229
PSM	KIPVFHNGSTPTLGETPK	272	sp|Q9Y6M7-11|S4A7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=10982	64.484	3	2001.9925	2001.9925	R	E	429	447
PSM	KKEPAITSQNSPEAR	273	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=1756	10.347	3	1734.8302	1734.8302	K	E	69	84
PSM	KPEKPLFSSASPQDSSPR	274	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:21	ms_run[2]:scan=6540	37.558	3	2036.9568	2036.9568	K	L	66	84
PSM	KPEKPLFSSASPQDSSPR	275	sp|O00712-6|NFIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:21	ms_run[2]:scan=6706	38.568	3	2036.9568	2036.9568	K	L	66	84
PSM	KPPAPPSPVQSQSPSTNWSPAVPVK	276	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	13-UNIMOD:21	ms_run[2]:scan=12631	75.295	3	2662.3156	2662.3156	K	K	763	788
PSM	LDETDDPDDYGDR	277	sp|P07384|CAN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=5885	33.544	2	1524.5852	1524.5852	R	E	401	414
PSM	LLHGAGGHLESPAR	278	sp|Q6NZ36-5|FAP20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=5020	28.556	2	1493.714	1493.7140	R	S	103	117
PSM	LTRPFPTGTPPPLPPK	279	sp|Q9BQI5-4|SGIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=12304	73.116	3	1794.9434	1794.9434	K	N	207	223
PSM	NVAEALGHSPKDPGGGGGPVR	280	sp|Q8IU81|I2BP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=7275	41.837	3	2050.9586	2050.9586	K	A	428	449
PSM	PGAEGAPLLPPPLPPPSPPGSGR	281	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	17-UNIMOD:21	ms_run[2]:scan=15182	94.183	3	2237.1246	2237.1246	R	G	27	50
PSM	PYHPPPLFPPSPQPPDSTPR	282	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=13510	81.368	3	2303.0776	2303.0776	R	Q	158	178
PSM	RHNSASVENVSLR	283	sp|Q9Y4H2|IRS2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=5338	30.41	3	1547.7206	1547.7206	K	K	1171	1184
PSM	RHSQALEALQQR	284	sp|O95613-2|PCNT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=5981	34.169	3	1515.7307	1515.7307	R	L	1694	1706
PSM	RHTVGGGEMAR	285	sp|Q9BWN1|PRR14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=664	5.6299	2	1265.5336	1265.5336	R	A	361	372
PSM	RLTADMISHPLGDFR	286	sp|Q00587-2|BORG5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,6-UNIMOD:35	ms_run[2]:scan=12558	74.811	3	1823.839	1823.8390	R	H	32	47
PSM	RRDSLDSSTEASGSDVVLGGR	287	sp|Q9Y2I9|TBC30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=8800	50.982	3	2243.0179	2243.0179	R	S	111	132
PSM	RRGTPEPEEAGR	288	sp|Q9UFB7|ZBT47_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=1044	7.0421	3	1433.6413	1433.6413	R	R	387	399
PSM	RRPTLGVQLDDK	289	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=8200	47.451	3	1476.745	1476.7450	R	R	325	337
PSM	RRSPPADAIPK	290	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3343	18.873	3	1286.6496	1286.6496	K	S	9	20
PSM	RRSPPADAIPK	291	sp|P18754|RCC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=3525	19.888	3	1286.6496	1286.6496	K	S	9	20
PSM	RSSLPLDHGSPAQENPESEK	292	sp|Q5VZ89-5|DEN4C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=7164	41.257	3	2257.0012	2257.0012	R	S	1276	1296
PSM	RTDALTSSPGR	293	sp|P49736|MCM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=2093	11.986	2	1239.5609	1239.5609	R	D	34	45
PSM	SESPKEPEQLR	294	sp|P09651-3|ROA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=4339	24.562	3	1378.613	1378.6130	K	K	4	15
PSM	SGPKPFSAPKPQTSPSPK	295	sp|Q01518-2|CAP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:21	ms_run[2]:scan=4502	25.416	2	1916.9397	1916.9397	R	R	294	312
PSM	SHVSSEPYEPISPPQVPVVHEK	296	sp|O75376-2|NCOR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	12-UNIMOD:21	ms_run[2]:scan=13135	78.622	3	2521.189	2521.1890	R	Q	2037	2059
PSM	SLEPAENVHGAGGGAFPASQTPSKPASADGHR	297	sp|P12931|SRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=8838	51.202	3	3179.4422	3179.4422	R	G	17	49
PSM	TPKDSPGIPPSANAHQLFR	298	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=10959	64.352	3	2112.0154	2112.0154	K	G	365	384
PSM	TPKDSPGIPPSANAHQLFR	299	sp|P51812|KS6A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=11414	67.374	3	2112.0154	2112.0154	K	G	365	384
PSM	TVARTPLGQR	300	sp|Q9UQ35|SRRM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	5-UNIMOD:21	ms_run[2]:scan=2562	14.461	2	1177.5969	1177.5969	K	S	1527	1537
PSM	VERPPSPFSMAPQASLPPVPPR	301	sp|P22681|CBL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	6-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=13917	84.488	3	2452.1974	2452.1974	K	L	478	500
PSM	VLATEDRSDHLIQTDTVNLHR	302	sp|P51151|RAB9A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=10518	61.619	3	2512.2071	2512.2071	R	K	172	193
PSM	YDERPGPSPLPHR	303	sp|P08621-4|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=5114	29.144	3	1599.7195	1599.7195	R	D	123	136
PSM	YDERPGPSPLPHR	304	sp|P08621-4|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	8-UNIMOD:21	ms_run[2]:scan=5651	32.201	3	1599.7195	1599.7195	R	D	123	136
PSM	KLEEEEDGKLK	305	sp|P11387|TOP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=2293	12.997451666666667	2	1316.682980	1316.682361	R	K	164	175
PSM	SPLTPEKEVGYLEFTGPPQKPPR	306	sp|Q14289|FAK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	4-UNIMOD:21	ms_run[1]:scan=15037	93.01594833333333	3	2647.314271	2646.309470	K	L	839	862
PSM	VGAHAGEYGAEALER	307	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=7310	42.06612333333334	3	1528.727194	1528.727020	K	M	18	33
PSM	RVASGPSPGEGISPQSAQAPQAPGDNHVVPVLR	308	sp|Q14764|MVP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:21	ms_run[1]:scan=12264	72.86057666666667	3	3354.649020	3354.647017	R	-	861	894
PSM	QHEAPSNRPLNELLTPQGPSPR	309	sp|P10398|ARAF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,15-UNIMOD:21	ms_run[1]:scan=12586	74.98614833333333	3	2500.1878	2500.1855	R	T	167	189
PSM	QQSHFAMMHGGTGFAGIDSSSPEVK	310	sp|Q15365|PCBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:35,20-UNIMOD:21	ms_run[1]:scan=11595	68.54539	3	2700.101432	2701.130203	R	G	244	269
PSM	RKPNAGGSPAPVR	311	sp|Q3KQU3|MA7D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	8-UNIMOD:21	ms_run[1]:scan=1061	7.106823333333334	3	1386.676320	1385.692897	R	R	392	405
PSM	KPASPPLPATQQEKPSQTPEAGR	312	sp|Q6ZU35|K1211_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	18-UNIMOD:21	ms_run[1]:scan=5758	32.836668333333336	3	2495.225341	2494.221718	R	K	1039	1062
PSM	SVSSGDLRPMGIALGGHR	313	sp|Q9UK80|UBP21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21,10-UNIMOD:35	ms_run[1]:scan=10352	60.60433166666667	3	1904.895507	1904.892796	K	G	113	131
PSM	RRPEASPVQK	314	sp|Q3KQU3|MA7D1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:21	ms_run[1]:scan=815	6.227201666666667	2	1246.619150	1246.618335	R	K	405	415
PSM	FASDDEHDEHDENGATGPVKR	315	sp|P05455|LA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	3-UNIMOD:21	ms_run[1]:scan=4358	24.65661833333333	3	2405.941455	2404.955726	K	A	364	385
PSM	AAPPPPPPPPPLESSPR	316	sp|Q5T4S7-5|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	15-UNIMOD:21	ms_run[2]:scan=9696	56.451	3	1782.8706	1782.8706	K	V	606	623
PSM	ALRPGDLPPSPDDVKR	317	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=7967	46.054	3	1811.8931	1811.8931	R	R	299	315
PSM	ALRPGDLPPSPDDVKR	318	sp|O75382-4|TRIM3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=8134	47.063	3	1811.8931	1811.8931	R	R	299	315
PSM	APVHFVEPLSPTGVAGHR	319	sp|Q5T5Y3-2|CAMP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=12392	73.698	3	1949.9513	1949.9513	K	K	793	811
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	320	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=12601	75.094	3	3459.4297	3459.4297	K	L	104	135
PSM	DHANEELDELKR	321	sp|Q14789-4|GOGB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6323	36.233	3	1467.6954	1467.6954	R	K	2673	2685
PSM	DIHDDQDYLHSLGK	322	sp|O75955-2|FLOT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10575	61.983	3	1654.7587	1654.7587	K	A	105	119
PSM	EEKDQDELKPGPTNR	323	sp|Q14151|SAFB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2184	12.452	2	1754.8435	1754.8435	K	S	543	558
PSM	ERGSDASGQLFHGR	324	sp|P19174|PLCG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=5794	33.036	3	1595.6842	1595.6842	R	A	1230	1244
PSM	GRPPAEKLSPNPPK	325	sp|P51531-2|SMCA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=4249	24.057	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GVVDSDDLPLNVSR	326	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=12912	77.057	3	1484.7471	1484.7471	K	E	435	449
PSM	HAPSLHGSTELLPLSR	327	sp|Q9H5N1-2|RABE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=12056	71.557	3	1793.8825	1793.8825	R	D	186	202
PSM	HDEDEDDSLKDR	328	sp|O94915|FRYL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1510	9.1542	3	1472.6015	1472.6015	R	E	1330	1342
PSM	HFKDEDEDEDVASPDGLGR	329	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=7995	46.247	3	2209.8801	2209.8801	K	L	537	556
PSM	HRPSAGGPDSAGR	330	sp|Q01970-2|PLCB3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=754	5.9828	3	1343.5732	1343.5732	R	K	404	417
PSM	HRPSPPATPPPK	331	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2468	13.954	3	1440.6316	1440.6316	R	T	399	411
PSM	HVHLENATEYATLR	332	sp|Q96A22|CK052_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=9015	52.235	3	1732.7934	1732.7934	K	F	94	108
PSM	IYHLPDAESDEDEDFK	333	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=12716	75.837	2	2001.7881	2001.7881	K	E	210	226
PSM	KIYEDGDDDMKR	334	sp|Q9HB71-3|CYBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:35	ms_run[2]:scan=1321	8.2299	2	1499.6562	1499.6562	K	T	154	166
PSM	KLFAPVPFPSGSTEDVSPSGPQQPPPLPQK	335	sp|Q86YV5|PRAG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=16437	103.97	3	3208.5846	3208.5846	K	K	789	819
PSM	KLNYEENKEESLLEK	336	sp|O95347-2|SMC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8639	50.016	3	1864.9418	1864.9418	K	R	467	482
PSM	KLSVPTSDEEDEVPAPKPR	337	sp|Q8NE71-2|ABCF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=9345	54.254	3	2173.0304	2173.0304	K	G	103	122
PSM	LFRPPSPAPAAPGAR	338	sp|Q86U90|YRDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=9201	53.362	3	1583.7974	1583.7974	R	L	32	47
PSM	LKEFLEDYDDDRDDPK	339	sp|P49756|RBM25_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10485	61.438	2	2011.9011	2011.9011	R	Y	496	512
PSM	LLKPGEEPSEYTDEEDTKDHNK	340	sp|O15173|PGRC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=6005	34.304	3	2653.1433	2653.1433	R	Q	200	222
PSM	MPGMSPANPSLHSPVPDASHSPR	341	sp|O60244|MED14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:35,19-UNIMOD:21	ms_run[2]:scan=8822	51.126	3	2464.0665	2464.0665	R	A	1124	1147
PSM	PGAEGAPLLPPPLPPPSPPGSGR	342	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	17-UNIMOD:21	ms_run[2]:scan=15312	95.19	3	2237.1246	2237.1246	R	G	27	50
PSM	PGAQPLPPPPPSQSPEPTEPHPR	343	sp|Q9UIS9-4|MBD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:21	ms_run[2]:scan=8500	49.157	3	2489.174	2489.1740	R	A	284	307
PSM	PKPRPSPSSTR	344	sp|Q92888-2|ARHG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=706	5.7882	2	1288.6289	1288.6289	R	E	738	749
PSM	PYHPPPLFPPSPQPPDSTPR	345	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=13774	83.4	3	2303.0776	2303.0776	R	Q	158	178
PSM	QEKPAEKPAETPVATSPTATDSTSGDSSR	346	sp|P54727-2|RD23B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	16-UNIMOD:21	ms_run[2]:scan=4780	27.172	3	3024.3561	3024.3561	K	S	73	102
PSM	RAPSVANVGSHCDLSLK	347	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=9448	54.885	3	1889.8819	1889.8819	R	I	2141	2158
PSM	RFSNVGLVHTSER	348	sp|Q9C0H9|SRCN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8501	49.161	3	1580.7461	1580.7461	R	R	43	56
PSM	RHSIAIGEVPACR	349	sp|Q8WUY9-2|DEP1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=7458	42.952	2	1544.7283	1544.7283	K	L	158	171
PSM	RHTDPVQLQAAGR	350	sp|O75791-2|GRAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=4574	25.893	3	1527.7307	1527.7307	R	V	147	160
PSM	RHTVGGGEMAR	351	sp|Q9BWN1|PRR14_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=656	5.5963	3	1265.5336	1265.5336	R	A	361	372
PSM	RKPNAGGSPAPVR	352	sp|Q3KQU3-2|MA7D1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	8-UNIMOD:21	ms_run[2]:scan=1045	7.0456	2	1385.6929	1385.6929	R	R	355	368
PSM	RPASPSSPEHLPATPAESPAQR	353	sp|Q9H7L9|SDS3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=7327	42.172	3	2362.1067	2362.1067	K	F	231	253
PSM	RPDHSGGSPSPPTSEPAR	354	sp|Q8TAD8|SNIP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	10-UNIMOD:21	ms_run[2]:scan=2347	13.295	3	1910.8272	1910.8272	R	S	45	63
PSM	RPEGPGAQAPSSPR	355	sp|P40222|TXLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=1959	11.291	2	1485.6726	1485.6726	R	V	504	518
PSM	RPMEEDGEEKSPSK	356	sp|Q12906-5|ILF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35,11-UNIMOD:21	ms_run[2]:scan=674	5.6616	2	1713.6917	1713.6917	K	K	372	386
PSM	RPPSDLYLPPPDHGAPAR	357	sp|Q9Y618-5|NCOR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=9756	56.818	3	2034.9677	2034.9677	R	G	2158	2176
PSM	RPSDLTISINQMGSPGMGHLK	358	sp|Q86UU0-3|BCL9L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21,12-UNIMOD:35,17-UNIMOD:35	ms_run[2]:scan=10488	61.454	3	2350.0811	2350.0811	R	S	913	934
PSM	RPSQNAISFFNVGHSK	359	sp|Q9BXB4|OSB11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=13176	78.925	3	1867.873	1867.8730	R	L	187	203
PSM	RQSPSPSTRPIR	360	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=1839	10.728	2	1460.7249	1460.7249	R	R	711	723
PSM	RRFSDSEGEETVPEPR	361	sp|Q13286-5|CLN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=6621	38.034	3	1969.8531	1969.8531	R	L	9	25
PSM	RRGSDIDNPTLTVMDISPPSR	362	sp|Q9Y2U5|M3K2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=12029	71.388	3	2422.1312	2422.1312	R	S	328	349
PSM	RRPSDENTIAPSEVQK	363	sp|Q86W92-3|LIPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=4445	25.099	3	1905.8946	1905.8946	R	W	638	654
PSM	RRPTLGVQLDDK	364	sp|Q13769|THOC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=8061	46.633	2	1476.745	1476.7450	R	R	325	337
PSM	RRSDLYESELR	365	sp|O14578-3|CTRO_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=6945	40.001	3	1502.6879	1502.6879	R	E	113	124
PSM	RVGMADANSPPKPLSK	366	sp|P26358|DNMT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=4151	23.505	3	1762.8437	1762.8437	R	P	119	135
PSM	SGDETPGSEVPGDK	367	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=4392	24.826	2	1453.561	1453.5610	R	A	161	175
PSM	SGSSHAPQDVSLSYPQHHVGNSSPTSTSPSR	368	sp|Q9Y580|RBM7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	22-UNIMOD:21	ms_run[2]:scan=7782	44.913	3	3270.4327	3270.4327	R	Y	86	117
PSM	SPSPPLPTHIPPEPPR	369	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=11988	71.133	3	1797.8815	1797.8815	R	T	326	342
PSM	SSLLEKGLDGAKK	370	sp|P81605|DCD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=7255	41.722	3	1344.7613	1344.7613	R	A	63	76
PSM	TDTSHHDQDHPTFNK	371	sp|P01009-3|A1AT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:21	ms_run[2]:scan=1946	11.231	2	1858.7272	1858.7272	K	I	35	50
PSM	VFDENKEDDLTELSHR	372	sp|O60879-2|DIAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=10164	59.381	3	1945.9017	1945.9017	K	L	379	395
PSM	VKEDPDGEHAR	373	sp|P52272-2|HNRPM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=683	5.6988	2	1251.5844	1251.5844	K	R	144	155
PSM	VLQHYQESDKGEELGPGNVQK	374	sp|Q9Y6C9|MTCH2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6777	38.968	3	2354.1503	2354.1503	K	E	91	112
PSM	YHGHSMSDPGVSYR	375	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:35,7-UNIMOD:21	ms_run[2]:scan=3266	18.481	3	1687.645	1687.6450	R	T	258	272
PSM	YHGHSMSDPGVSYR	376	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=5610	31.942	2	1671.6501	1671.6501	R	T	258	272
PSM	YHGHSMSDPGVSYR	377	sp|P08559-3|ODPA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=5741	32.728	3	1671.6501	1671.6501	R	T	258	272
PSM	KEESEESDDDMGFGLFD	378	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=15725	98.42987833333333	2	2045.716457	2044.713279	K	-	98	115
PSM	HELQANCYEEVKDR	379	sp|P23528|COF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:4	ms_run[1]:scan=5116	29.155275	3	1790.790522	1789.805347	K	C	133	147
PSM	EESGKPGAHVTVK	380	sp|P22626|ROA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:27	ms_run[1]:scan=1265	7.9762	3	1319.6824	1319.6828	R	K	100	113
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	381	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=10154	59.31495166666667	3	2909.292249	2908.307590	R	P	132	161
PSM	KPLHLDGGYCSPAEGFSSR	382	sp|Q9C0A6|SETD5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:4,11-UNIMOD:21	ms_run[1]:scan=10377	60.750834999999995	3	2157.942565	2156.935055	R	Y	1010	1029
PSM	TLNGVSSPPHPSPKSPVLEEAPFSR	383	sp|Q9BZL4-3|PP12C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	15-UNIMOD:21	ms_run[1]:scan=12982	77.529535	3	2710.304029	2709.316347	R	R	393	418
PSM	HVALHSASNGTPPAGTPPGAR	384	sp|Q9HC78|ZBT20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	16-UNIMOD:21	ms_run[1]:scan=4934	28.06675	3	2074.960111	2073.974552	R	A	680	701
PSM	RHSEQVANGPTPPPR	385	sp|A6ND36|FA83G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=2519	14.206306666666668	3	1722.784596	1721.799882	R	R	632	647
PSM	QLSSGVSEIR	386	sp|P04792|HSPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=12207	72.49215500000001	2	1137.5069	1137.5062	R	H	80	90
PSM	QPLLLSEDEEDTKR	387	sp|Q99613|EIF3C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,6-UNIMOD:21	ms_run[1]:scan=12711	75.80666333333333	2	1734.7720	1734.7708	K	V	34	48
PSM	LCDPSAPLAFLQASK	388	sp|O14514|AGRB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:4,5-UNIMOD:21	ms_run[1]:scan=2763	15.696931666666668	2	1697.799318	1696.789560	R	Q	126	141
PSM	KPDAYTEQLHNEEENEDAR	389	sp|Q9P0T7|TMEM9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=6759	38.86701333333333	3	2288.000099	2286.998898	R	S	118	137
PSM	KPSGLNGEASKSQEMVHLVNK	390	sp|P16070|CD44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	12-UNIMOD:21	ms_run[1]:scan=8657	50.114145	3	2333.111576	2332.124646	R	E	695	716
PSM	KHSPSPPPPTPTESR	391	sp|Q92922|SMRC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=2052	11.788115	2	1693.784125	1693.782500	R	K	326	341
PSM	RLSSAHNGGSAFGAAGYGGAQPTPPMPTR	392	sp|Q9Y446|PKP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21,26-UNIMOD:35	ms_run[1]:scan=9990	58.29842666666667	3	2909.293132	2908.307590	R	P	132	161
PSM	SVEDVRPHHTDANNQSACFEAPDQK	393	sp|Q9Y520|PRC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	1-UNIMOD:21,18-UNIMOD:4	ms_run[1]:scan=7186	41.373870000000004	3	2932.209090	2931.224314	R	T	878	903
PSM	LMSLLTSPHQPPPPPPASASPSAVPNGPQSPK	394	sp|Q96RU3|FNBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	2-UNIMOD:35,30-UNIMOD:21	ms_run[1]:scan=12471	74.21389166666667	3	3280.586227	3279.599916	K	Q	330	362