MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	CRC_NT_JPST000210
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\PeakList.PeakListMergePreMS2_1\121102_CRC_T_Fr20.mqWzd.txt
MTD	ms_run[2]-location	D:\JobRequest\ResultFiles\20190825\20190825082952780184^10.242.132.48^taba@jp\Psearch.MaxQuantExec1\121102_CRC_T_Fr20.maxqFin.txt
MTD	software[1]	[MS, MS:1001583, MaxQuant, 1.6.2.10]
MTD	software[1]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[1]-setting	enzymes=Trypsin/P
MTD	software[1]-setting	enzymeMode=0
MTD	software[1]-setting	fixedModifications=Carbamidomethyl (C)
MTD	software[1]-setting	variableModifications=Oxidation (M),Phospho (STY)
MTD	software[1]-setting	maxMissedCleavages=2
MTD	software[1]-setting	lcmsRunType=Standard
MTD	software[1]-setting	firstSearchTol=20
MTD	software[1]-setting	mainSearchTol=4.5
MTD	software[2]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[2]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[2]-setting	CLE=[RK]|{}
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[2]-setting	TOL(-)=20
MTD	software[2]-setting	TOL(+)=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.3
MTD	software[2]-setting	ITOLU=Daltons
MTD	software[2]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[2]-setting	PFA=2
MTD	software[3]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[3]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	search_enzyme_number=2
MTD	software[3]-setting	FixMod=Carbamidomethyl (C)
MTD	software[3]-setting	VarMod=Oxidation (M),Phospho (S),Phospho (T),Phospho (Y)
MTD	software[3]-setting	max_variable_mods_in_peptide=5
MTD	software[3]-setting	allowed_missed_cleavage=2
MTD	software[3]-setting	peptide_mass_tolerance=20
MTD	software[3]-setting	peptide_mass_units=2
MTD	software[3]-setting	fragment_bin_tol=1.0005
MTD	software[3]-setting	fragment_bin_offset=0.4
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	variable_mod[2]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[2]-site	S
MTD	variable_mod[2]-position	Anywhere
MTD	variable_mod[3]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[3]-site	T
MTD	variable_mod[3]-position	Anywhere
MTD	variable_mod[4]	[UNIMOD, UNIMOD:21, Phospho,]
MTD	variable_mod[4]-site	Y
MTD	variable_mod[4]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|O75381-2|PEX14_HUMAN	Isoform 2 of Peroxisomal membrane protein PEX14 OS=Homo sapiens OX=9606 GN=PEX14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39.0	null	299-UNIMOD:4	0.09	39.0	1	1	1
PRT	sp|Q14934-18|NFAC4_HUMAN	Isoform 18 of Nuclear factor of activated T-cells, cytoplasmic 4 OS=Homo sapiens OX=9606 GN=NFATC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38.0	null	219-UNIMOD:21	0.03	38.0	2	1	0
PRT	sp|Q9BUJ2-5|HNRL1_HUMAN	Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 OS=Homo sapiens OX=9606 GN=HNRNPUL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37.0	null	240-UNIMOD:21,242-UNIMOD:21	0.08	37.0	6	1	0
PRT	sp|P07339|CATD_HUMAN	Cathepsin D OS=Homo sapiens OX=9606 GN=CTSD PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36.0	null	246-UNIMOD:35	0.05	36.0	1	1	1
PRT	sp|Q9NQX3|GEPH_HUMAN	Gephyrin OS=Homo sapiens OX=9606 GN=GPHN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	188-UNIMOD:21,198-UNIMOD:21,194-UNIMOD:21	0.04	35.0	4	1	0
PRT	sp|O96013-3|PAK4_HUMAN	Isoform 3 of Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	105-UNIMOD:21,123-UNIMOD:4,114-UNIMOD:21	0.08	35.0	2	1	0
PRT	sp|Q8N1G0-2|ZN687_HUMAN	Isoform 2 of Zinc finger protein 687 OS=Homo sapiens OX=9606 GN=ZNF687	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35.0	null	183-UNIMOD:21	0.03	35.0	1	1	1
PRT	sp|P06748|NPM_HUMAN	Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35.0	null	104-UNIMOD:385,104-UNIMOD:4,125-UNIMOD:21	0.11	35.0	1	1	0
PRT	sp|P15259|PGAM2_HUMAN	Phosphoglycerate mutase 2 OS=Homo sapiens OX=9606 GN=PGAM2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.07	33.0	1	1	1
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	255-UNIMOD:21	0.04	33.0	4	4	4
PRT	sp|Q9H1E3-2|NUCKS_HUMAN	Isoform 2 of Nuclear ubiquitous casein and cyclin-dependent kinase substrate 1 OS=Homo sapiens OX=9606 GN=NUCKS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	39-UNIMOD:21	0.09	33.0	2	1	0
PRT	sp|P06454-2|PTMA_HUMAN	Isoform 2 of Prothymosin alpha OS=Homo sapiens OX=9606 GN=PTMA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null		0.15	33.0	3	2	1
PRT	sp|Q7Z422-2|SZRD1_HUMAN	Isoform 2 of SUZ domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SZRD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33.0	null	19-UNIMOD:21,17-UNIMOD:21	0.20	33.0	4	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|P49917|DNLI4_HUMAN	DNA ligase 4 OS=Homo sapiens OX=9606 GN=LIG4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|Q9H3P7|GCP60_HUMAN	Golgi resident protein GCP60 OS=Homo sapiens OX=9606 GN=ACBD3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32.0	null	43-UNIMOD:21	0.05	32.0	3	1	0
PRT	sp|Q6PJT7-10|ZC3HE_HUMAN	Isoform 10 of Zinc finger CCCH domain-containing protein 14 OS=Homo sapiens OX=9606 GN=ZC3H14	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.03	31.0	2	1	0
PRT	sp|Q9BXJ9|NAA15_HUMAN	N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|Q9NYF8-2|BCLF1_HUMAN	Isoform 2 of Bcl-2-associated transcription factor 1 OS=Homo sapiens OX=9606 GN=BCLAF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	266-UNIMOD:21,510-UNIMOD:21,282-UNIMOD:21,288-UNIMOD:21	0.05	31.0	5	3	1
PRT	sp|Q99959-2|PKP2_HUMAN	Isoform 1 of Plakophilin-2 OS=Homo sapiens OX=9606 GN=PKP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31.0	null	172-UNIMOD:21	0.02	31.0	1	1	1
PRT	sp|P17029|ZKSC1_HUMAN	Zinc finger protein with KRAB and SCAN domains 1 OS=Homo sapiens OX=9606 GN=ZKSCAN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	208-UNIMOD:21	0.03	30.0	4	1	0
PRT	sp|P20042|IF2B_HUMAN	Eukaryotic translation initiation factor 2 subunit 2 OS=Homo sapiens OX=9606 GN=EIF2S2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.05	30.0	1	1	1
PRT	sp|Q5H9R7-3|PP6R3_HUMAN	Isoform 3 of Serine/threonine-protein phosphatase 6 regulatory subunit 3 OS=Homo sapiens OX=9606 GN=PPP6R3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|Q9BQ39|DDX50_HUMAN	ATP-dependent RNA helicase DDX50 OS=Homo sapiens OX=9606 GN=DDX50 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	41-UNIMOD:21	0.02	30.0	1	1	1
PRT	sp|Q9Y6W3|CAN7_HUMAN	Calpain-7 OS=Homo sapiens OX=9606 GN=CAPN7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q8TF72|SHRM3_HUMAN	Protein Shroom3 OS=Homo sapiens OX=9606 GN=SHROOM3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	970-UNIMOD:21	0.01	30.0	1	1	1
PRT	sp|Q8N4B1-2|SESQ1_HUMAN	Isoform 2 of Sesquipedalian-1 OS=Homo sapiens OX=9606 GN=PHETA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	90-UNIMOD:21,98-UNIMOD:35	0.13	30.0	2	1	0
PRT	sp|P35900|K1C20_HUMAN	Keratin, type I cytoskeletal 20 OS=Homo sapiens OX=9606 GN=KRT20 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	13-UNIMOD:21,26-UNIMOD:35	0.04	30.0	1	1	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30.0	null	269-UNIMOD:4,270-UNIMOD:4,277-UNIMOD:4,58-UNIMOD:4	0.09	30.0	3	3	3
PRT	sp|Q9BQ67|GRWD1_HUMAN	Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=GRWD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30.0	null	108-UNIMOD:35,122-UNIMOD:21	0.07	30.0	1	1	1
PRT	sp|P16401|H15_HUMAN	Histone H1.5 OS=Homo sapiens OX=9606 GN=HIST1H1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	2-UNIMOD:1,18-UNIMOD:21	0.09	30.0	1	1	1
PRT	sp|Q6VMQ6-2|MCAF1_HUMAN	Isoform 2 of Activating transcription factor 7-interacting protein 1 OS=Homo sapiens OX=9606 GN=ATF7IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	672-UNIMOD:21	0.01	29.0	6	1	0
PRT	sp|P60174-1|TPIS_HUMAN	Isoform 2 of Triosephosphate isomerase OS=Homo sapiens OX=9606 GN=TPI1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	21-UNIMOD:21	0.06	29.0	1	1	1
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	303-UNIMOD:21	0.04	29.0	1	1	1
PRT	sp|O94915|FRYL_HUMAN	Protein furry homolog-like OS=Homo sapiens OX=9606 GN=FRYL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null		0.00	29.0	2	1	0
PRT	sp|Q9NXL2-1|ARH38_HUMAN	Isoform 1 of Rho guanine nucleotide exchange factor 38 OS=Homo sapiens OX=9606 GN=ARHGEF38	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	34-UNIMOD:21	0.10	29.0	1	1	1
PRT	sp|Q717R9|CYS1_HUMAN	Cystin-1 OS=Homo sapiens OX=9606 GN=CYS1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	17-UNIMOD:21	0.14	29.0	1	1	1
PRT	sp|P01833|PIGR_HUMAN	Polymeric immunoglobulin receptor OS=Homo sapiens OX=9606 GN=PIGR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29.0	null	735-UNIMOD:21,741-UNIMOD:35	0.02	29.0	1	1	1
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	263-UNIMOD:21,231-UNIMOD:21	0.05	28.0	2	2	2
PRT	sp|Q15642-4|CIP4_HUMAN	Isoform 4 of Cdc42-interacting protein 4 OS=Homo sapiens OX=9606 GN=TRIP10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	450-UNIMOD:21,444-UNIMOD:21	0.06	28.0	3	1	0
PRT	sp|P50479-2|PDLI4_HUMAN	Isoform 2 of PDZ and LIM domain protein 4 OS=Homo sapiens OX=9606 GN=PDLIM4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	112-UNIMOD:21	0.07	28.0	1	1	1
PRT	sp|P17676-2|CEBPB_HUMAN	Isoform 2 of CCAAT/enhancer-binding protein beta OS=Homo sapiens OX=9606 GN=CEBPB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	42-UNIMOD:21	0.06	28.0	1	1	1
PRT	sp|Q05682-5|CALD1_HUMAN	Isoform 5 of Caldesmon OS=Homo sapiens OX=9606 GN=CALD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	196-UNIMOD:21	0.03	28.0	3	2	1
PRT	sp|Q12996|CSTF3_HUMAN	Cleavage stimulation factor subunit 3 OS=Homo sapiens OX=9606 GN=CSTF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28.0	null	691-UNIMOD:21	0.03	28.0	1	1	1
PRT	sp|Q9UD71-2|PPR1B_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 1B OS=Homo sapiens OX=9606 GN=PPP1R1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28.0	null	9-UNIMOD:21	0.11	28.0	1	1	1
PRT	sp|Q96FF7|MISP3_HUMAN	Uncharacterized protein MISP3 OS=Homo sapiens OX=9606 GN=MISP3 PE=2 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	91-UNIMOD:21	0.06	27.0	1	1	1
PRT	sp|P51532-5|SMCA4_HUMAN	Isoform 5 of Transcription activator BRG1 OS=Homo sapiens OX=9606 GN=SMARCA4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	1419-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|Q13813-3|SPTN1_HUMAN	Isoform 3 of Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens OX=9606 GN=SPTAN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|P12694|ODBA_HUMAN	2-oxoisovalerate dehydrogenase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=BCKDHA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	337-UNIMOD:21	0.03	27.0	2	1	0
PRT	sp|Q9HBL0|TENS1_HUMAN	Tensin-1 OS=Homo sapiens OX=9606 GN=TNS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	374-UNIMOD:21,378-UNIMOD:21	0.01	27.0	2	1	0
PRT	sp|Q9UNZ2-4|NSF1C_HUMAN	Isoform 2 of NSFL1 cofactor p47 OS=Homo sapiens OX=9606 GN=NSFL1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	114-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q9H4H8-2|FA83D_HUMAN	Isoform 2 of Protein FAM83D OS=Homo sapiens OX=9606 GN=FAM83D	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	347-UNIMOD:4,353-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q6P2E9-2|EDC4_HUMAN	Isoform 2 of Enhancer of mRNA-decapping protein 4 OS=Homo sapiens OX=9606 GN=EDC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.02	27.0	1	1	1
PRT	sp|P54259|ATN1_HUMAN	Atrophin-1 OS=Homo sapiens OX=9606 GN=ATN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	168-UNIMOD:21	0.02	27.0	4	1	0
PRT	sp|O60927|PP1RB_HUMAN	E3 ubiquitin-protein ligase PPP1R11 OS=Homo sapiens OX=9606 GN=PPP1R11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	27.0	null	102-UNIMOD:21,124-UNIMOD:35	0.22	27.0	3	1	0
PRT	sp|P12814-2|ACTN1_HUMAN	Isoform 2 of Alpha-actinin-1 OS=Homo sapiens OX=9606 GN=ACTN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null		0.01	27.0	2	1	0
PRT	sp|Q6P1M3-2|L2GL2_HUMAN	Isoform A of Lethal(2) giant larvae protein homolog 2 OS=Homo sapiens OX=9606 GN=LLGL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	680-UNIMOD:21	0.02	27.0	2	1	0
PRT	sp|Q01518-2|CAP1_HUMAN	Isoform 2 of Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27.0	null	306-UNIMOD:21	0.04	27.0	1	1	1
PRT	sp|Q8NI27|THOC2_HUMAN	THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	1417-UNIMOD:21	0.01	27.0	1	1	1
PRT	sp|P13667|PDIA4_HUMAN	Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.02	26.0	1	1	1
PRT	sp|P41162|ETV3_HUMAN	ETS translocation variant 3 OS=Homo sapiens OX=9606 GN=ETV3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	159-UNIMOD:21	0.04	26.0	3	1	0
PRT	sp|P16152-2|CBR1_HUMAN	Isoform 2 of Carbonyl reductase [NADPH] 1 OS=Homo sapiens OX=9606 GN=CBR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.08	26.0	1	1	1
PRT	sp|P00491|PNPH_HUMAN	Purine nucleoside phosphorylase OS=Homo sapiens OX=9606 GN=PNP PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	31-UNIMOD:4,33-UNIMOD:21	0.07	26.0	1	1	1
PRT	sp|Q14558|KPRA_HUMAN	Phosphoribosyl pyrophosphate synthase-associated protein 1 OS=Homo sapiens OX=9606 GN=PRPSAP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	204-UNIMOD:4,209-UNIMOD:35,215-UNIMOD:21,218-UNIMOD:35	0.08	26.0	1	1	1
PRT	sp|Q8IYB3|SRRM1_HUMAN	Serine/arginine repetitive matrix protein 1 OS=Homo sapiens OX=9606 GN=SRRM1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	450-UNIMOD:21,402-UNIMOD:21,406-UNIMOD:21	0.03	26.0	11	2	1
PRT	sp|Q14671-2|PUM1_HUMAN	Isoform 2 of Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	209-UNIMOD:21	0.02	26.0	2	1	0
PRT	sp|O15027-2|SC16A_HUMAN	Isoform 2 of Protein transport protein Sec16A OS=Homo sapiens OX=9606 GN=SEC16A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1368-UNIMOD:21,1369-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|O95159|ZFPL1_HUMAN	Zinc finger protein-like 1 OS=Homo sapiens OX=9606 GN=ZFPL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	230-UNIMOD:4	0.05	26.0	2	1	0
PRT	sp|O75376-2|NCOR1_HUMAN	Isoform 2 of Nuclear receptor corepressor 1 OS=Homo sapiens OX=9606 GN=NCOR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null	1999-UNIMOD:21	0.01	26.0	2	1	0
PRT	sp|P10301|RRAS_HUMAN	Ras-related protein R-Ras OS=Homo sapiens OX=9606 GN=RRAS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.07	26.0	4	2	1
PRT	sp|P68871|HBB_HUMAN	Hemoglobin subunit beta OS=Homo sapiens OX=9606 GN=HBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26.0	null		0.10	26.0	1	1	1
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	104-UNIMOD:21,108-UNIMOD:35	0.16	26.0	1	1	1
PRT	sp|Q9H6F5|CCD86_HUMAN	Coiled-coil domain-containing protein 86 OS=Homo sapiens OX=9606 GN=CCDC86 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	18-UNIMOD:21	0.05	26.0	1	1	1
PRT	sp|Q13243-2|SRSF5_HUMAN	Isoform SRP40-2 of Serine/arginine-rich splicing factor 5 OS=Homo sapiens OX=9606 GN=SRSF5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.12	25.0	2	1	0
PRT	sp|Q13247-2|SRSF6_HUMAN	Isoform SRP55-2 of Serine/arginine-rich splicing factor 6 OS=Homo sapiens OX=9606 GN=SRSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.10	25.0	1	1	1
PRT	sp|P98177-2|FOXO4_HUMAN	Isoform Zeta of Forkhead box protein O4 OS=Homo sapiens OX=9606 GN=FOXO4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	175-UNIMOD:21	0.05	25.0	1	1	1
PRT	sp|P46013-2|KI67_HUMAN	Isoform Short of Proliferation marker protein Ki-67 OS=Homo sapiens OX=9606 GN=MKI67	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	353-UNIMOD:21,355-UNIMOD:4	0.01	25.0	1	1	1
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	214-UNIMOD:21	0.03	25.0	2	2	2
PRT	sp|O43294-2|TGFI1_HUMAN	Isoform 2 of Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens OX=9606 GN=TGFB1I1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	126-UNIMOD:21,51-UNIMOD:21,74-UNIMOD:4,120-UNIMOD:21	0.11	25.0	4	2	1
PRT	sp|Q9P206|K1522_HUMAN	Uncharacterized protein KIAA1522 OS=Homo sapiens OX=9606 GN=KIAA1522 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	832-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|Q96MU7-2|YTDC1_HUMAN	Isoform 2 of YTH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=YTHDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	398-UNIMOD:21	0.03	25.0	1	1	1
PRT	sp|P16144-4|ITB4_HUMAN	Isoform Beta-4D of Integrin beta-4 OS=Homo sapiens OX=9606 GN=ITGB4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1391-UNIMOD:35,1404-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q13136-2|LIPA1_HUMAN	Isoform 2 of Liprin-alpha-1 OS=Homo sapiens OX=9606 GN=PPFIA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null		0.01	25.0	1	1	1
PRT	sp|Q8WWI1-4|LMO7_HUMAN	Isoform 4 of LIM domain only protein 7 OS=Homo sapiens OX=9606 GN=LMO7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1510-UNIMOD:21,1593-UNIMOD:21	0.02	25.0	2	2	2
PRT	sp|Q86XR7|TCAM2_HUMAN	TIR domain-containing adapter molecule 2 OS=Homo sapiens OX=9606 GN=TICAM2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	22-UNIMOD:21	0.07	25.0	2	1	0
PRT	sp|Q5T5U3-3|RHG21_HUMAN	Isoform 3 of Rho GTPase-activating protein 21 OS=Homo sapiens OX=9606 GN=ARHGAP21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	846-UNIMOD:21	0.02	25.0	1	1	1
PRT	sp|Q15149|PLEC_HUMAN	Plectin OS=Homo sapiens OX=9606 GN=PLEC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	125-UNIMOD:21	0.00	25.0	1	1	1
PRT	sp|Q92538-3|GBF1_HUMAN	Isoform 3 of Golgi-specific brefeldin A-resistance guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=GBF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25.0	null	1762-UNIMOD:4,1769-UNIMOD:21	0.01	25.0	1	1	1
PRT	sp|Q9UFC0|LRWD1_HUMAN	Leucine-rich repeat and WD repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=LRWD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	212-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|P13639|EF2_HUMAN	Elongation factor 2 OS=Homo sapiens OX=9606 GN=EEF2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|Q13151|ROA0_HUMAN	Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens OX=9606 GN=HNRNPA0 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	84-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q8IXT5|RB12B_HUMAN	RNA-binding protein 12B OS=Homo sapiens OX=9606 GN=RBM12B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	24.0	null	575-UNIMOD:21,718-UNIMOD:21	0.03	24.0	4	2	1
PRT	sp|Q9NTI5-5|PDS5B_HUMAN	Isoform 5 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	71-UNIMOD:21	0.11	24.0	1	1	1
PRT	sp|Q8N4C8-4|MINK1_HUMAN	Isoform 4 of Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	713-UNIMOD:21	0.02	24.0	1	1	0
PRT	sp|Q13796|SHRM2_HUMAN	Protein Shroom2 OS=Homo sapiens OX=9606 GN=SHROOM2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	313-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|P23193-2|TCEA1_HUMAN	Isoform 2 of Transcription elongation factor A protein 1 OS=Homo sapiens OX=9606 GN=TCEA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	79-UNIMOD:21	0.06	24.0	2	1	0
PRT	sp|Q9BQA1-2|MEP50_HUMAN	Isoform 2 of Methylosome protein 50 OS=Homo sapiens OX=9606 GN=WDR77	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	5-UNIMOD:21,1-UNIMOD:35	0.06	24.0	4	2	1
PRT	sp|Q9Y385|UB2J1_HUMAN	Ubiquitin-conjugating enzyme E2 J1 OS=Homo sapiens OX=9606 GN=UBE2J1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	266-UNIMOD:21	0.05	24.0	1	1	1
PRT	sp|Q01581|HMCS1_HUMAN	Hydroxymethylglutaryl-CoA synthase, cytoplasmic OS=Homo sapiens OX=9606 GN=HMGCS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	495-UNIMOD:21	0.06	24.0	1	1	1
PRT	sp|P35527|K1C9_HUMAN	Keratin, type I cytoskeletal 9 OS=Homo sapiens OX=9606 GN=KRT9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.03	24.0	1	1	1
PRT	sp|Q3T8J9-3|GON4L_HUMAN	Isoform 3 of GON-4-like protein OS=Homo sapiens OX=9606 GN=GON4L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	1896-UNIMOD:21	0.01	24.0	2	1	0
PRT	sp|Q8TE67|ES8L3_HUMAN	Epidermal growth factor receptor kinase substrate 8-like protein 3 OS=Homo sapiens OX=9606 GN=EPS8L3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null	205-UNIMOD:21	0.03	24.0	2	1	0
PRT	sp|Q14978|NOLC1_HUMAN	Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens OX=9606 GN=NOLC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|Q9BSQ5-4|CCM2_HUMAN	Isoform 4 of Cerebral cavernous malformations 2 protein OS=Homo sapiens OX=9606 GN=CCM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	180-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|Q9Y3L3|3BP1_HUMAN	SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	626-UNIMOD:21,262-UNIMOD:21,265-UNIMOD:35	0.05	23.0	4	2	0
PRT	sp|P81605|DCD_HUMAN	Dermcidin OS=Homo sapiens OX=9606 GN=DCD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.11	23.0	1	1	1
PRT	sp|P27816-5|MAP4_HUMAN	Isoform 5 of Microtubule-associated protein 4 OS=Homo sapiens OX=9606 GN=MAP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	278-UNIMOD:35,280-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|O43707-2|ACTN4_HUMAN	Isoform ACTN4ISO of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q9Y5S2|MRCKB_HUMAN	Serine/threonine-protein kinase MRCK beta OS=Homo sapiens OX=9606 GN=CDC42BPB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1690-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|P02765|FETUA_HUMAN	Alpha-2-HS-glycoprotein OS=Homo sapiens OX=9606 GN=AHSG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	321-UNIMOD:35,330-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|A8CG34-2|P121C_HUMAN	Isoform 2 of Nuclear envelope pore membrane protein POM 121C OS=Homo sapiens OX=9606 GN=POM121C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	196-UNIMOD:4,199-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q15019|SEPT2_HUMAN	Septin-2 OS=Homo sapiens OX=9606 GN=SEPT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	218-UNIMOD:21	0.06	23.0	1	1	1
PRT	sp|P35579-2|MYH9_HUMAN	Isoform 2 of Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1365-UNIMOD:21	0.01	23.0	1	1	1
PRT	sp|Q9NX55-3|HYPK_HUMAN	Isoform 3 of Huntingtin-interacting protein K OS=Homo sapiens OX=9606 GN=HYPK	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null		0.14	23.0	1	1	1
PRT	sp|Q7L2H7-2|EIF3M_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit M OS=Homo sapiens OX=9606 GN=EIF3M	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	205-UNIMOD:21,206-UNIMOD:21	0.05	23.0	2	1	0
PRT	sp|Q9Y4H2|IRS2_HUMAN	Insulin receptor substrate 2 OS=Homo sapiens OX=9606 GN=IRS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1148-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|Q9Y4F5-3|C170B_HUMAN	Isoform 3 of Centrosomal protein of 170 kDa protein B OS=Homo sapiens OX=9606 GN=CEP170B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	1018-UNIMOD:21,702-UNIMOD:21	0.02	23.0	3	2	1
PRT	sp|Q12929-2|EPS8_HUMAN	Isoform 2 of Epidermal growth factor receptor kinase substrate 8 OS=Homo sapiens OX=9606 GN=EPS8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	425-UNIMOD:21,427-UNIMOD:35	0.03	23.0	1	1	1
PRT	sp|P62995-3|TRA2B_HUMAN	Isoform 3 of Transformer-2 protein homolog beta OS=Homo sapiens OX=9606 GN=TRA2B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	101-UNIMOD:21,108-UNIMOD:35	0.07	23.0	12	1	0
PRT	sp|Q9NTJ3-2|SMC4_HUMAN	Isoform 2 of Structural maintenance of chromosomes protein 4 OS=Homo sapiens OX=9606 GN=SMC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	27-UNIMOD:21,28-UNIMOD:21	0.02	23.0	2	1	0
PRT	sp|Q9P2D6-3|F135A_HUMAN	Isoform 3 of Protein FAM135A OS=Homo sapiens OX=9606 GN=FAM135A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	427-UNIMOD:21,430-UNIMOD:4	0.01	23.0	1	1	1
PRT	sp|Q08378-4|GOGA3_HUMAN	Isoform 3 of Golgin subfamily A member 3 OS=Homo sapiens OX=9606 GN=GOLGA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23.0	null	22-UNIMOD:21	0.02	23.0	1	1	1
PRT	sp|P48436|SOX9_HUMAN	Transcription factor SOX-9 OS=Homo sapiens OX=9606 GN=SOX9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	218-UNIMOD:35,236-UNIMOD:21	0.07	22.0	1	1	1
PRT	sp|P11387|TOP1_HUMAN	DNA topoisomerase 1 OS=Homo sapiens OX=9606 GN=TOP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1001476, X!Tandem, ]	22.0	null	2-UNIMOD:1,10-UNIMOD:21	0.04	22.0	2	2	2
PRT	sp|Q7Z5L9-2|I2BP2_HUMAN	Isoform 2 of Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	318-UNIMOD:21,344-UNIMOD:21	0.06	22.0	3	2	1
PRT	sp|P05455|LA_HUMAN	Lupus La protein OS=Homo sapiens OX=9606 GN=SSB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	366-UNIMOD:21,245-UNIMOD:4	0.08	22.0	2	2	2
PRT	sp|O60313-13|OPA1_HUMAN	Isoform 7 of Dynamin-like 120 kDa protein, mitochondrial OS=Homo sapiens OX=9606 GN=OPA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.01	22.0	1	1	1
PRT	sp|P42167-3|LAP2B_HUMAN	Isoform Zeta of Lamina-associated polypeptide 2, isoforms beta/gamma OS=Homo sapiens OX=9606 GN=TMPO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	74-UNIMOD:21	0.11	22.0	1	1	1
PRT	sp|Q9P2K8-2|E2AK4_HUMAN	Isoform 2 of eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	667-UNIMOD:21	0.01	22.0	3	1	0
PRT	sp|P62244|RS15A_HUMAN	40S ribosomal protein S15a OS=Homo sapiens OX=9606 GN=RPS15A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.12	22.0	2	1	0
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	616-UNIMOD:35,617-UNIMOD:21	0.02	22.0	1	1	1
PRT	sp|Q92729-3|PTPRU_HUMAN	Isoform 3 of Receptor-type tyrosine-protein phosphatase U OS=Homo sapiens OX=9606 GN=PTPRU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	853-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|P09429|HMGB1_HUMAN	High mobility group protein B1 OS=Homo sapiens OX=9606 GN=HMGB1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.07	22.0	2	1	0
PRT	sp|P27824-3|CALX_HUMAN	Isoform 3 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|Q9BQQ3-3|GORS1_HUMAN	Isoform 3 of Golgi reassembly-stacking protein 1 OS=Homo sapiens OX=9606 GN=GORASP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	143-UNIMOD:21	0.16	22.0	1	1	1
PRT	sp|Q96F44-2|TRI11_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase TRIM11 OS=Homo sapiens OX=9606 GN=TRIM11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	85-UNIMOD:21,92-UNIMOD:4	0.04	22.0	1	1	1
PRT	sp|O00512|BCL9_HUMAN	B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	278-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q53GD3-4|CTL4_HUMAN	Isoform 4 of Choline transporter-like protein 4 OS=Homo sapiens OX=9606 GN=SLC44A4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P43243|MATR3_HUMAN	Matrin-3 OS=Homo sapiens OX=9606 GN=MATR3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	188-UNIMOD:21	0.03	22.0	2	1	0
PRT	sp|Q8NFH8-3|REPS2_HUMAN	Isoform 3 of RalBP1-associated Eps domain-containing protein 2 OS=Homo sapiens OX=9606 GN=REPS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	339-UNIMOD:21	0.03	22.0	1	1	1
PRT	sp|A6ND36-2|FA83G_HUMAN	Isoform 2 of Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	386-UNIMOD:21	0.03	22.0	1	1	0
PRT	sp|P62805|H4_HUMAN	Histone H4 OS=Homo sapiens OX=9606 GN=HIST1H4A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	48-UNIMOD:21	0.12	22.0	1	1	1
PRT	sp|Q5JSH3-4|WDR44_HUMAN	Isoform 4 of WD repeat-containing protein 44 OS=Homo sapiens OX=9606 GN=WDR44	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	237-UNIMOD:21	0.01	22.0	1	1	1
PRT	sp|Q00537-2|CDK17_HUMAN	Isoform 2 of Cyclin-dependent kinase 17 OS=Homo sapiens OX=9606 GN=CDK17	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	75-UNIMOD:21,85-UNIMOD:35,87-UNIMOD:35	0.04	22.0	1	1	1
PRT	sp|Q6UUV7-3|CRTC3_HUMAN	Isoform 3 of CREB-regulated transcription coactivator 3 OS=Homo sapiens OX=9606 GN=CRTC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	391-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q8NBR0|P5I13_HUMAN	Tumor protein p53-inducible protein 13 OS=Homo sapiens OX=9606 GN=TP53I13 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	392-UNIMOD:21	0.05	22.0	1	1	1
PRT	sp|P35408|PE2R4_HUMAN	Prostaglandin E2 receptor EP4 subtype OS=Homo sapiens OX=9606 GN=PTGER4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	221-UNIMOD:21	0.04	22.0	1	1	1
PRT	sp|Q15424-2|SAFB1_HUMAN	Isoform 2 of Scaffold attachment factor B1 OS=Homo sapiens OX=9606 GN=SAFB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null		0.02	22.0	1	1	1
PRT	sp|P35606-2|COPB2_HUMAN	Isoform 2 of Coatomer subunit beta' OS=Homo sapiens OX=9606 GN=COPB2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	830-UNIMOD:21	0.03	22.0	2	2	2
PRT	sp|Q06210-2|GFPT1_HUMAN	Isoform 2 of Glutamine--fructose-6-phosphate aminotransferase [isomerizing] 1 OS=Homo sapiens OX=9606 GN=GFPT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22.0	null	244-UNIMOD:21,246-UNIMOD:4	0.02	22.0	1	1	1
PRT	sp|A6ND36|FA83G_HUMAN	Protein FAM83G OS=Homo sapiens OX=9606 GN=FAM83G PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null	634-UNIMOD:21	0.02	22.0	1	1	0
PRT	sp|Q9H4M7|PKHA4_HUMAN	Pleckstrin homology domain-containing family A member 4 OS=Homo sapiens OX=9606 GN=PLEKHA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001583, MaxQuant, ]	22.0	null	329-UNIMOD:21	0.03	22.0	3	1	0
PRT	sp|Q5T4S7-3|UBR4_HUMAN	Isoform 3 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	619-UNIMOD:21	0.00	21.0	1	1	1
PRT	sp|P51858-2|HDGF_HUMAN	Isoform 2 of Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	158-UNIMOD:21	0.06	21.0	2	2	2
PRT	sp|Q15223|NECT1_HUMAN	Nectin-1 OS=Homo sapiens OX=9606 GN=NECTIN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	412-UNIMOD:35,422-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P21333-2|FLNA_HUMAN	Isoform 2 of Filamin-A OS=Homo sapiens OX=9606 GN=FLNA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	2144-UNIMOD:21,2152-UNIMOD:4	0.01	21.0	1	1	1
PRT	sp|Q6PCE3|PGM2L_HUMAN	Glucose 1,6-bisphosphate synthase OS=Homo sapiens OX=9606 GN=PGM2L1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	171-UNIMOD:35,175-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|P13073|COX41_HUMAN	Cytochrome c oxidase subunit 4 isoform 1, mitochondrial OS=Homo sapiens OX=9606 GN=COX4I1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q14498-2|RBM39_HUMAN	Isoform 2 of RNA-binding protein 39 OS=Homo sapiens OX=9606 GN=RBM39	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	136-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q2LD37-2|K1109_HUMAN	Isoform 2 of Transmembrane protein KIAA1109 OS=Homo sapiens OX=9606 GN=KIAA1109	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	2263-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P51531-2|SMCA2_HUMAN	Isoform Short of Probable global transcription activator SNF2L2 OS=Homo sapiens OX=9606 GN=SMARCA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1377-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q15366-6|PCBP2_HUMAN	Isoform 6 of Poly(rC)-binding protein 2 OS=Homo sapiens OX=9606 GN=PCBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	184-UNIMOD:21	0.07	21.0	1	1	1
PRT	sp|P04179-3|SODM_HUMAN	Isoform 3 of Superoxide dismutase [Mn], mitochondrial OS=Homo sapiens OX=9606 GN=SOD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.10	21.0	1	1	1
PRT	sp|O15417-2|TNC18_HUMAN	Isoform 2 of Trinucleotide repeat-containing gene 18 protein OS=Homo sapiens OX=9606 GN=TNRC18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1579-UNIMOD:21,1589-UNIMOD:35	0.01	21.0	1	1	1
PRT	sp|Q9HCI7-2|MSL2_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase MSL2 OS=Homo sapiens OX=9606 GN=MSL2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	370-UNIMOD:35,373-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|O00567|NOP56_HUMAN	Nucleolar protein 56 OS=Homo sapiens OX=9606 GN=NOP56 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	563-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P52799|EFNB2_HUMAN	Ephrin-B2 OS=Homo sapiens OX=9606 GN=EFNB2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	260-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|O14683|P5I11_HUMAN	Tumor protein p53-inducible protein 11 OS=Homo sapiens OX=9606 GN=TP53I11 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	14-UNIMOD:21	0.06	21.0	1	1	1
PRT	sp|Q8N3F8|MILK1_HUMAN	MICAL-like protein 1 OS=Homo sapiens OX=9606 GN=MICALL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	396-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	2	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.03	21.0	1	1	1
PRT	sp|Q8IXM2-2|BAP18_HUMAN	Isoform 2 of Chromatin complexes subunit BAP18 OS=Homo sapiens OX=9606 GN=BAP18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	72-UNIMOD:21	0.23	21.0	1	1	1
PRT	sp|Q96RN5-3|MED15_HUMAN	Isoform 3 of Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	488-UNIMOD:35,492-UNIMOD:21	0.03	21.0	1	1	0
PRT	sp|Q9BZL4-5|PP12C_HUMAN	Isoform 5 of Protein phosphatase 1 regulatory subunit 12C OS=Homo sapiens OX=9606 GN=PPP1R12C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q5TZA2|CROCC_HUMAN	Rootletin OS=Homo sapiens OX=9606 GN=CROCC PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	515-UNIMOD:4,519-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9H9J4-2|UBP42_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens OX=9606 GN=USP42	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	1166-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q9UDY2-3|ZO2_HUMAN	Isoform C1 of Tight junction protein ZO-2 OS=Homo sapiens OX=9606 GN=TJP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	407-UNIMOD:21,408-UNIMOD:21	0.01	21.0	2	1	0
PRT	sp|Q12789-3|TF3C1_HUMAN	Isoform 2 of General transcription factor 3C polypeptide 1 OS=Homo sapiens OX=9606 GN=GTF3C1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q7Z6B7-2|SRGP1_HUMAN	Isoform 2 of SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	894-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|P78312-4|F193A_HUMAN	Isoform 4 of Protein FAM193A OS=Homo sapiens OX=9606 GN=FAM193A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q96AY4|TTC28_HUMAN	Tetratricopeptide repeat protein 28 OS=Homo sapiens OX=9606 GN=TTC28 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	28-UNIMOD:21	0.01	21.0	1	1	1
PRT	sp|Q1KMD3|HNRL2_HUMAN	Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens OX=9606 GN=HNRNPUL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	161-UNIMOD:21	0.02	21.0	1	1	1
PRT	sp|Q9H3F6-3|BACD3_HUMAN	Isoform 3 of BTB/POZ domain-containing adapter for CUL3-mediated RhoA degradation protein 3 OS=Homo sapiens OX=9606 GN=KCTD10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null		0.07	21.0	1	1	1
PRT	sp|Q9C0K0-2|BC11B_HUMAN	Isoform 2 of B-cell lymphoma/leukemia 11B OS=Homo sapiens OX=9606 GN=BCL11B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	341-UNIMOD:35,346-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|Q9UN86-2|G3BP2_HUMAN	Isoform B of Ras GTPase-activating protein-binding protein 2 OS=Homo sapiens OX=9606 GN=G3BP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21.0	null	227-UNIMOD:21	0.05	21.0	1	1	1
PRT	sp|P69905|HBA_HUMAN	Hemoglobin subunit alpha OS=Homo sapiens OX=9606 GN=HBA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.23	21.0	2	2	2
PRT	sp|Q96RN5|MED15_HUMAN	Mediator of RNA polymerase II transcription subunit 15 OS=Homo sapiens OX=9606 GN=MED15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	599-UNIMOD:35,603-UNIMOD:21	0.03	21.0	1	1	0
PRT	sp|Q15418|KS6A1_HUMAN	Ribosomal protein S6 kinase alpha-1 OS=Homo sapiens OX=9606 GN=RPS6KA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	363-UNIMOD:21	0.03	21.0	1	1	1
PRT	sp|P23497|SP100_HUMAN	Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	16-UNIMOD:4,18-UNIMOD:21,24-UNIMOD:35	0.03	21.0	1	1	1
PRT	sp|Q9NPF8-2|ADAP2_HUMAN	Isoform 2 of Arf-GAP with dual PH domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ADAP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	330-UNIMOD:21,333-UNIMOD:21,342-UNIMOD:4,344-UNIMOD:21	0.06	20.0	1	1	1
PRT	sp|Q13595-4|TRA2A_HUMAN	Isoform 4 of Transformer-2 protein homolog alpha OS=Homo sapiens OX=9606 GN=TRA2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	101-UNIMOD:21,108-UNIMOD:35	0.07	20.0	1	1	1
PRT	sp|Q9ULU4-2|PKCB1_HUMAN	Isoform 2 of Protein kinase C-binding protein 1 OS=Homo sapiens OX=9606 GN=ZMYND8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	156-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P06748-3|NPM_HUMAN	Isoform 3 of Nucleophosmin OS=Homo sapiens OX=9606 GN=NPM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	104-UNIMOD:4,125-UNIMOD:21	0.12	20.0	1	1	0
PRT	sp|Q9UNH7-2|SNX6_HUMAN	Isoform 2 of Sorting nexin-6 OS=Homo sapiens OX=9606 GN=SNX6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9Y6R9|CCD61_HUMAN	Coiled-coil domain-containing protein 61 OS=Homo sapiens OX=9606 GN=CCDC61 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	285-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|O95365|ZBT7A_HUMAN	Zinc finger and BTB domain-containing protein 7A OS=Homo sapiens OX=9606 GN=ZBTB7A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|P49588|SYAC_HUMAN	Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.01	20.0	1	1	1
PRT	sp|Q03989-5|ARI5A_HUMAN	Isoform 2 of AT-rich interactive domain-containing protein 5A OS=Homo sapiens OX=9606 GN=ARID5A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	245-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9NR30-2|DDX21_HUMAN	Isoform 2 of Nucleolar RNA helicase 2 OS=Homo sapiens OX=9606 GN=DDX21	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	21-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P25685-2|DNJB1_HUMAN	Isoform 2 of DnaJ homolog subfamily B member 1 OS=Homo sapiens OX=9606 GN=DNAJB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.05	20.0	1	1	1
PRT	sp|Q9BVC5-2|ASHWN_HUMAN	Isoform 2 of Ashwin OS=Homo sapiens OX=9606 GN=C2orf49	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	185-UNIMOD:21	0.10	20.0	1	1	1
PRT	sp|Q8N3D4|EH1L1_HUMAN	EH domain-binding protein 1-like protein 1 OS=Homo sapiens OX=9606 GN=EHBP1L1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ],[MS, MS:1002251, Comet, ]	20.0	null	1257-UNIMOD:21	0.01	20.0	2	1	0
PRT	sp|Q15428|SF3A2_HUMAN	Splicing factor 3A subunit 2 OS=Homo sapiens OX=9606 GN=SF3A2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	214-UNIMOD:35,222-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q9Y2W1|TR150_HUMAN	Thyroid hormone receptor-associated protein 3 OS=Homo sapiens OX=9606 GN=THRAP3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	672-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|Q5SQI0-7|ATAT_HUMAN	Isoform 7 of Alpha-tubulin N-acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ATAT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	238-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|O60749-2|SNX2_HUMAN	Isoform 2 of Sorting nexin-2 OS=Homo sapiens OX=9606 GN=SNX2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	68-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|O60343-2|TBCD4_HUMAN	Isoform 2 of TBC1 domain family member 4 OS=Homo sapiens OX=9606 GN=TBC1D4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	344-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P35613-3|BASI_HUMAN	Isoform 3 of Basigin OS=Homo sapiens OX=9606 GN=BSG	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null		0.11	20.0	1	1	1
PRT	sp|Q92615|LAR4B_HUMAN	La-related protein 4B OS=Homo sapiens OX=9606 GN=LARP4B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	718-UNIMOD:21,722-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q9NQT8|KI13B_HUMAN	Kinesin-like protein KIF13B OS=Homo sapiens OX=9606 GN=KIF13B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1481-UNIMOD:21	0.01	20.0	1	1	1
PRT	sp|P18754|RCC1_HUMAN	Regulator of chromosome condensation OS=Homo sapiens OX=9606 GN=RCC1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	11-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9Y6W5|WASF2_HUMAN	Wiskott-Aldrich syndrome protein family member 2 OS=Homo sapiens OX=9606 GN=WASF2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	292-UNIMOD:21,296-UNIMOD:21	0.05	20.0	1	1	1
PRT	sp|P50548-2|ERF_HUMAN	Isoform 2 of ETS domain-containing transcription factor ERF OS=Homo sapiens OX=9606 GN=ERF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	456-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q8IZ21-3|PHAR4_HUMAN	Isoform 3 of Phosphatase and actin regulator 4 OS=Homo sapiens OX=9606 GN=PHACTR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	328-UNIMOD:21	0.02	20.0	2	1	0
PRT	sp|Q13263-2|TIF1B_HUMAN	Isoform 2 of Transcription intermediary factor 1-beta OS=Homo sapiens OX=9606 GN=TRIM28	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	391-UNIMOD:21,400-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q96T37-4|RBM15_HUMAN	Isoform 4 of RNA-binding protein 15 OS=Homo sapiens OX=9606 GN=RBM15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	213-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|P18887|XRCC1_HUMAN	DNA repair protein XRCC1 OS=Homo sapiens OX=9606 GN=XRCC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	446-UNIMOD:21,453-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|Q07890-2|SOS2_HUMAN	Isoform 2 of Son of sevenless homolog 2 OS=Homo sapiens OX=9606 GN=SOS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	1169-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|P08621-4|RU17_HUMAN	Isoform 4 of U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	130-UNIMOD:21	0.04	20.0	1	1	1
PRT	sp|P40818-2|UBP8_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens OX=9606 GN=USP8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20.0	null	572-UNIMOD:35,577-UNIMOD:35,585-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q8N4C8|MINK1_HUMAN	Misshapen-like kinase 1 OS=Homo sapiens OX=9606 GN=MINK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	733-UNIMOD:21	0.02	20.0	1	1	0
PRT	sp|O75128|COBL_HUMAN	Protein cordon-bleu OS=Homo sapiens OX=9606 GN=COBL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	347-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|O15530|PDPK1_HUMAN	3-phosphoinositide-dependent protein kinase 1 OS=Homo sapiens OX=9606 GN=PDPK1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	513-UNIMOD:21	0.02	20.0	1	1	1
PRT	sp|Q9NZN8|CNOT2_HUMAN	CCR4-NOT transcription complex subunit 2 OS=Homo sapiens OX=9606 GN=CNOT2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	175-UNIMOD:4,176-UNIMOD:35	0.03	20.0	1	1	1
PRT	sp|Q9UJU6|DBNL_HUMAN	Drebrin-like protein OS=Homo sapiens OX=9606 GN=DBNL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20.0	null	289-UNIMOD:28,291-UNIMOD:21	0.03	20.0	1	1	1
PRT	sp|Q9H2U2|IPYR2_HUMAN	Inorganic pyrophosphatase 2, mitochondrial OS=Homo sapiens OX=9606 GN=PPA2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9Y6K1|DNM3A_HUMAN	DNA (cytosine-5)-methyltransferase 3A OS=Homo sapiens OX=9606 GN=DNMT3A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	406-UNIMOD:35	0.02	20.0	1	1	1
PRT	sp|Q969J3|BORC5_HUMAN	BLOC-1-related complex subunit 5 OS=Homo sapiens OX=9606 GN=BORCS5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	21-UNIMOD:21,23-UNIMOD:21	0.09	20.0	1	1	1
PRT	sp|Q9P2K8|E2AK4_HUMAN	eIF-2-alpha kinase GCN2 OS=Homo sapiens OX=9606 GN=EIF2AK4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	667-UNIMOD:21	0.01	20.0	1	1	0
PRT	sp|P55011|S12A2_HUMAN	Solute carrier family 12 member 2 OS=Homo sapiens OX=9606 GN=SLC12A2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	79-UNIMOD:21	0.02	20.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	REDKEDEEDEEDDDVSHVDEEDCLGVQR	1	sp|O75381-2|PEX14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	39	23-UNIMOD:4	ms_run[2]:scan=8124	52.505	3	3390.355	3390.3550	K	E	277	305
PSM	RGSLGEEGSEPPPPPPLPLAR	2	sp|Q14934-18|NFAC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	38	3-UNIMOD:21	ms_run[2]:scan=12056	78.995	2	2232.094	2232.0940	R	D	217	238
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	3	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	37	26-UNIMOD:21	ms_run[2]:scan=8717	56.327	3	3407.6452	3407.6452	R	N	215	246
PSM	DPDAQPGGELMLGGTDSK	4	sp|P07339|CATD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	36	11-UNIMOD:35	ms_run[2]:scan=8400	54.26	2	1802.7993	1802.7993	R	Y	236	254
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	5	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	28-UNIMOD:21	ms_run[2]:scan=8868	57.335	3	3407.6452	3407.6452	R	N	215	246
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	6	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	11-UNIMOD:21	ms_run[2]:scan=13160	86.838	3	2892.3583	2892.3583	K	Q	178	204
PSM	GAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPR	7	sp|O96013-3|PAK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	4-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=13693	90.597	3	3454.6857	3454.6857	R	S	102	138
PSM	TPLDLFAHFGPEPGDHSDPLPPSAPSPTR	8	sp|Q8N1G0-2|ZN687_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	35	26-UNIMOD:21	ms_run[2]:scan=17405	117.36	3	3131.439	3131.4390	K	E	158	187
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	9	sp|P06748|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:385,1-UNIMOD:4,22-UNIMOD:21	ms_run[1]:scan=13293	87.79421666666666	3	3442.4001	3442.4027	K	L	104	135
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	10	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	34	28-UNIMOD:21	ms_run[2]:scan=9019	58.343	3	3407.6452	3407.6452	R	N	215	246
PSM	HYGGLTGLNKAETAAK	11	sp|P15259|PGAM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=5853	37.608	2	1629.8475	1629.8475	R	H	91	107
PSM	IEDVGSDEEDDSGKDK	12	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	6-UNIMOD:21	ms_run[2]:scan=2763	17.595	2	1816.6888	1816.6888	K	K	250	266
PSM	KDDSHSAEDSEDEKEDHK	13	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	10-UNIMOD:21	ms_run[2]:scan=516	4.9716	2	2179.8179	2179.8179	K	N	30	48
PSM	RAAEDDEDDDVDTKK	14	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33		ms_run[2]:scan=924	6.7855	2	1720.7388	1720.7388	K	Q	89	104
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	15	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	33	3-UNIMOD:21	ms_run[2]:scan=13993	92.72	3	2715.4361	2715.4361	K	I	17	42
PSM	GVVDSDDLPLNVSR	16	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=11756	76.942	2	1484.7471	1484.7471	K	E	435	449
PSM	HQSFYIETKLDGER	17	sp|P49917|DNLI4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32		ms_run[2]:scan=9436	61.121	2	1721.8373	1721.8373	K	M	265	279
PSM	PGAEGAPLLPPPLPPPSPPGSGR	18	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	32	17-UNIMOD:21	ms_run[2]:scan=14411	95.731	2	2237.1246	2237.1246	R	G	27	50
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	19	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	26-UNIMOD:21	ms_run[2]:scan=8561	55.324	3	3407.6452	3407.6452	R	N	215	246
PSM	KFNHDGEEEEEDDDYGSR	20	sp|Q6PJT7-10|ZC3HE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=3133	19.858	2	2169.8359	2169.8359	K	T	270	288
PSM	KKDDDDEEIGGPK	21	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31		ms_run[2]:scan=1301	8.5272	2	1444.6682	1444.6682	K	E	627	640
PSM	NTPSQHSHSIQHSPER	22	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	13-UNIMOD:21	ms_run[2]:scan=825	6.3142	2	1920.8228	1920.8228	K	S	254	270
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	23	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	3-UNIMOD:21	ms_run[2]:scan=14133	93.729	3	2715.4361	2715.4361	K	I	17	42
PSM	SQAGHTLHHQESR	24	sp|Q99959-2|PKP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	31	1-UNIMOD:21	ms_run[2]:scan=621	5.4243	2	1566.6689	1566.6689	R	R	172	185
PSM	ALPAAHIPAPPHEGSPR	25	sp|P17029|ZKSC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:21	ms_run[2]:scan=8595	55.545	2	1796.8723	1796.8723	R	D	194	211
PSM	ALPAAHIPAPPHEGSPR	26	sp|P17029|ZKSC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	15-UNIMOD:21	ms_run[2]:scan=8445	54.536	2	1796.8723	1796.8723	R	D	194	211
PSM	DASDDLDDLNFFNQK	27	sp|P20042|IF2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=16902	113.66	2	1755.7588	1755.7588	K	K	65	80
PSM	FADQDDIGNVSFDR	28	sp|Q5H9R7-3|PP6R3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=11544	75.445	2	1597.7009	1597.7009	K	V	489	503
PSM	HHYDSDEKSETR	29	sp|Q9BQ39|DDX50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:21	ms_run[2]:scan=708	5.7986	2	1582.6049	1582.6049	R	E	37	49
PSM	HITDKDDFANNR	30	sp|Q9Y6W3|CAN7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30		ms_run[2]:scan=2662	16.937	2	1444.6695	1444.6695	R	E	592	604
PSM	PSSAHVGLRSPEASASASPHTPR	31	sp|Q8TF72|SHRM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	10-UNIMOD:21	ms_run[2]:scan=4816	30.743	3	2378.1128	2378.1128	R	E	961	984
PSM	RASAPHGPLDMAPFAR	32	sp|Q8N4B1-2|SESQ1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=9671	62.671	3	1788.8131	1788.8131	R	L	88	104
PSM	SLSSSLQAPVVSTVGMQR	33	sp|P35900|K1C20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	3-UNIMOD:21,16-UNIMOD:35	ms_run[2]:scan=13102	86.413	2	1941.9231	1941.9231	R	L	11	29
PSM	VHTECCHGDLLECADDR	34	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	30	5-UNIMOD:4,6-UNIMOD:4,13-UNIMOD:4	ms_run[2]:scan=6348	41.042	2	2085.8303	2085.8303	K	A	265	282
PSM	MHNLHGTKPPPSEGSDEEEEEEDEEDEEER	35	sp|Q9BQ67|GRWD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	1-UNIMOD:35,15-UNIMOD:21	ms_run[1]:scan=4900	31.313075	3	3606.360081	3604.358086	R	K	108	138
PSM	SETAPAETATPAPVEKSPAK	36	sp|P16401|H15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,17-UNIMOD:21	ms_run[1]:scan=6189	39.948735	2	2102.9759	2102.9768	M	K	2	22
PSM	AAEDDEDDDVDTKK	37	sp|P06454-2|PTMA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1086	7.5378	2	1564.6377	1564.6377	R	Q	90	104
PSM	HEHPPNPPVSPGK	38	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	10-UNIMOD:21	ms_run[2]:scan=2691	17.117	2	1471.6609	1471.6609	R	T	663	676
PSM	KQSLGELIGTLNAAK	39	sp|P60174-1|TPIS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=15257	101.78	2	1621.844	1621.8440	R	V	19	34
PSM	RGSNTTSHLHQAVAK	40	sp|P22695|QCR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=1504	9.6406	2	1685.7999	1685.7999	K	A	301	316
PSM	RHDEDEDDSLK	41	sp|O94915|FRYL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29		ms_run[2]:scan=1033	7.2997	2	1357.5746	1357.5746	R	D	1329	1340
PSM	RKTDTVVESSVSGDHSGTLR	42	sp|Q9NXL2-1|ARH38_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=5007	31.959	3	2210.0329	2210.0329	R	R	32	52
PSM	RRSPESLPAGPGAAALEGGTR	43	sp|Q717R9|CYS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21	ms_run[2]:scan=8797	56.873	3	2129.0379	2129.0379	R	R	15	36
PSM	RSSKEEAEMAYK	44	sp|P01833|PIGR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	29	3-UNIMOD:21,9-UNIMOD:35	ms_run[2]:scan=1165	7.8975	2	1523.6327	1523.6327	K	D	733	745
PSM	ESEDKPEIEDVGSDEEEEK	45	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	13-UNIMOD:21	ms_run[2]:scan=6859	44.268	2	2271.8792	2271.8792	K	K	251	270
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	46	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	21-UNIMOD:21	ms_run[2]:scan=13614	90.032	3	2892.3583	2892.3583	K	Q	178	204
PSM	HARPPDPPASAPPDSSSNSASQDTK	47	sp|Q15642-4|CIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	21-UNIMOD:21	ms_run[2]:scan=3433	21.773	3	2596.1191	2596.1191	R	E	430	455
PSM	IHIDPEIQDGSPTTSR	48	sp|P50479-2|PDLI4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	11-UNIMOD:21	ms_run[2]:scan=8617	55.686	2	1844.8306	1844.8306	R	R	102	118
PSM	PGPRPPAGELGSIGDHER	49	sp|P17676-2|CEBPB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	12-UNIMOD:21	ms_run[2]:scan=7865	50.841	3	1920.8843	1920.8843	R	A	31	49
PSM	RAAEDDEDDDVDTKK	50	sp|P06454-2|PTMA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28		ms_run[2]:scan=919	6.7609	3	1720.7388	1720.7388	K	Q	89	104
PSM	RGSIGENQIKDEK	51	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	3-UNIMOD:21	ms_run[2]:scan=2979	18.924	2	1552.7247	1552.7247	K	I	194	207
PSM	RPNEDSDEDEEKGAVVPPVHDIYR	52	sp|Q12996|CSTF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	28	6-UNIMOD:21	ms_run[2]:scan=9371	60.704	3	2845.2556	2845.2556	K	A	686	710
PSM	FRLSEHSSPEEEASPHQR	53	sp|Q9UD71-2|PPR1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	7-UNIMOD:21	ms_run[1]:scan=6065	39.114909999999995	3	2201.9485	2201.9486	L	A	3	21
PSM	ARSPPQPLGELKR	54	sp|Q96FF7|MISP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=7082	45.747	3	1527.7923	1527.7923	R	F	89	102
PSM	GAPSPGVLGPHASEPQLAPPACTPAAPAVPGPPGPR	55	sp|O96013-3|PAK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:21,22-UNIMOD:4	ms_run[2]:scan=13527	89.422	3	3454.6857	3454.6857	R	S	102	138
PSM	GRPPAEKLSPNPPNLTK	56	sp|P51532-5|SMCA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	9-UNIMOD:21	ms_run[2]:scan=7006	45.262	3	1894.9666	1894.9666	R	K	1411	1428
PSM	HQLLEADISAHEDR	57	sp|Q13813-3|SPTN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=6983	45.118	3	1632.7856	1632.7856	K	L	1680	1694
PSM	IGHHSTSDDSSAYR	58	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=1288	8.474	2	1611.6315	1611.6315	R	S	333	347
PSM	IGHHSTSDDSSAYR	59	sp|P12694|ODBA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:21	ms_run[2]:scan=1299	8.5209	3	1611.6315	1611.6315	R	S	333	347
PSM	KDDSHSAEDSEDEKEDHK	60	sp|Q9H1E3-2|NUCKS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	10-UNIMOD:21	ms_run[2]:scan=515	4.9683	3	2179.8179	2179.8179	K	N	30	48
PSM	KKDSLHGSTGAVNATR	61	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	4-UNIMOD:21	ms_run[2]:scan=1362	8.8115	2	1720.8258	1720.8258	K	P	371	387
PSM	KKSPNELVDDLFK	62	sp|Q9UNZ2-4|NSF1C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=13835	91.605	2	1611.7909	1611.7909	R	G	112	125
PSM	KPHDCESSTVSEEDYFSSHR	63	sp|Q9H4H8-2|FA83D_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	5-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=7086	45.766	3	2475.9638	2475.9638	R	D	343	363
PSM	PRPGPELGPQLGLDGGPGDGDR	64	sp|Q6P2E9-2|EDC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=11021	71.893	3	2156.061	2156.0610	R	H	402	424
PSM	PYHPPPLFPPSPQPPDSTPR	65	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	11-UNIMOD:21	ms_run[2]:scan=12669	83.369	3	2303.0776	2303.0776	R	Q	158	178
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	66	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21,25-UNIMOD:35	ms_run[2]:scan=9262	59.999	3	2894.3422	2894.3422	R	-	100	127
PSM	RDQALTEEHAR	67	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27		ms_run[2]:scan=1138	7.7693	2	1324.6484	1324.6484	R	Q	614	625
PSM	RGSLGEEGSEPPPPPPLPLAR	68	sp|Q14934-18|NFAC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	3-UNIMOD:21	ms_run[2]:scan=12153	79.691	3	2232.094	2232.0940	R	D	217	238
PSM	RHPAGPPGEAQEGSAK	69	sp|Q6P1M3-2|L2GL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	14-UNIMOD:21	ms_run[2]:scan=1019	7.2285	3	1667.7417	1667.7417	K	A	667	683
PSM	SGPKPFSAPKPQTSPSPK	70	sp|Q01518-2|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	13-UNIMOD:21	ms_run[2]:scan=5030	32.085	2	1916.9397	1916.9397	R	R	294	312
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	71	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	27	1-UNIMOD:21	ms_run[2]:scan=14283	94.818	3	2715.4361	2715.4361	K	I	17	42
PSM	KIDTHPSPSHSSTVK	72	sp|Q8NI27|THOC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	7-UNIMOD:21	ms_run[1]:scan=1275	8.414383333333333	2	1699.792414	1699.793065	R	D	1411	1426
PSM	DGDDVIIIGVFK	73	sp|P13667|PDIA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=17098	115.07	2	1289.6867	1289.6867	K	G	302	314
PSM	FHFPPLDTHSPTNDVQPGR	74	sp|P41162|ETV3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:21	ms_run[2]:scan=12435	81.687	3	2241.0004	2241.0004	R	F	150	169
PSM	FHFPPLDTHSPTNDVQPGR	75	sp|P41162|ETV3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:21	ms_run[2]:scan=12718	83.699	3	2241.0004	2241.0004	R	F	150	169
PSM	FHQLDIDDLQSIR	76	sp|P16152-2|CBR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=13827	91.555	2	1598.8053	1598.8053	R	A	59	72
PSM	HEHPPNPPVSPGK	77	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	10-UNIMOD:21	ms_run[2]:scan=2537	16.103	2	1471.6609	1471.6609	R	T	663	676
PSM	HRPQVAIICGSGLGGLTDK	78	sp|P00491|PNPH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	9-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=12239	80.314	3	2058.0082	2058.0082	K	L	23	42
PSM	LGLAVIHGEAQCTELDMDDGRHSPPMVK	79	sp|Q14558|KPRA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	12-UNIMOD:4,17-UNIMOD:35,23-UNIMOD:21,26-UNIMOD:35	ms_run[2]:scan=11045	72.061	3	3187.4138	3187.4138	R	N	193	221
PSM	PYHPPPLFPPSPQPPDSTPR	80	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=12388	81.352	3	2303.0776	2303.0776	R	Q	158	178
PSM	PYHPPPLFPPSPQPPDSTPR	81	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	11-UNIMOD:21	ms_run[2]:scan=12529	82.363	3	2303.0776	2303.0776	R	Q	158	178
PSM	RESPSPAPKPR	82	sp|Q8IYB3|SRRM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	3-UNIMOD:21	ms_run[2]:scan=803	6.2133	2	1300.6289	1300.6289	K	K	448	459
PSM	RPGQSFHVNSEVNSVLSPR	83	sp|Q14671-2|PUM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	17-UNIMOD:21	ms_run[2]:scan=10641	69.347	3	2189.0379	2189.0379	R	S	193	212
PSM	RSSLSSHSHQSQIYR	84	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	2-UNIMOD:21	ms_run[2]:scan=2269	14.476	2	1851.8377	1851.8377	R	S	1367	1382
PSM	TPGLHGDCDDDKYR	85	sp|O95159|ZFPL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	8-UNIMOD:4	ms_run[2]:scan=3157	20.012	3	1647.6947	1647.6947	R	R	223	237
PSM	TSNRYSPESQAQSVHHQR	86	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26	6-UNIMOD:21	ms_run[2]:scan=2927	18.567	2	2190.9556	2190.9556	K	P	1994	2012
PSM	VKDRDDFPVVLVGNK	87	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=10342	67.274	3	1699.9257	1699.9257	R	A	129	144
PSM	VNVDEVGGEALGR	88	sp|P68871|HBB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	26		ms_run[2]:scan=9316	60.348	2	1313.6575	1313.6575	K	L	19	32
PSM	KEESEESDDDMGFGLFD	89	sp|P05386|RLA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	7-UNIMOD:21,11-UNIMOD:35	ms_run[1]:scan=14779	98.393125	2	2045.714926	2044.713279	K	-	98	115
PSM	RLGGLRPESPESLTSVSR	90	sp|Q9H6F5|CCD86_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	9-UNIMOD:21	ms_run[1]:scan=9864	63.995491666666666	2	2020.009632	2020.010269	R	T	10	28
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	91	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	28-UNIMOD:21	ms_run[2]:scan=9166	59.347	3	3407.6452	3407.6452	R	N	215	246
PSM	DADDAVYELDGK	92	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8059	52.077	2	1309.5674	1309.5674	R	E	49	61
PSM	DADDAVYELNGK	93	sp|Q13247-2|SRSF6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=8316	53.729	2	1308.5834	1308.5834	R	E	47	59
PSM	FHFPPLDTHSPTNDVQPGR	94	sp|P41162|ETV3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=12577	82.692	3	2241.0004	2241.0004	R	F	150	169
PSM	HARPPDPPASAPPDSSSNSASQDTK	95	sp|Q15642-4|CIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	21-UNIMOD:21	ms_run[2]:scan=3268	20.769	3	2596.1191	2596.1191	R	E	430	455
PSM	KPSVLPAPPEGATPTSPVGHFAK	96	sp|P98177-2|FOXO4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	16-UNIMOD:21	ms_run[2]:scan=11074	72.258	3	2364.1879	2364.1879	K	W	160	183
PSM	KPVGEVHSQFSTGHANSPCTIIIGK	97	sp|P46013-2|KI67_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21,19-UNIMOD:4	ms_run[2]:scan=9713	62.956	3	2743.3153	2743.3153	K	A	337	362
PSM	KQDFDEDDILK	98	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=9179	59.442	2	1364.646	1364.6460	K	E	50	61
PSM	KRPSLPSSPSPGLPK	99	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	10-UNIMOD:21	ms_run[2]:scan=7284	47.123	2	1626.8495	1626.8495	K	A	117	132
PSM	LRSVGAPGGAPTPALGPSAPQKPLR	100	sp|Q9P206|K1522_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=9334	60.456	3	2474.3159	2474.3159	R	R	830	855
PSM	LSSESHHGGSPIHWVLPAGMSAK	101	sp|Q96MU7-2|YTDC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	2-UNIMOD:21	ms_run[2]:scan=12734	83.81	3	2464.1359	2464.1359	R	M	397	420
PSM	MTTTSAAAYGTHLSPHVPHR	102	sp|P16144-4|ITB4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	1-UNIMOD:35,14-UNIMOD:21	ms_run[2]:scan=7375	47.706	2	2229.9991	2229.9991	R	V	1391	1411
PSM	RFDEDDDKSFR	103	sp|Q13136-2|LIPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=4011	25.614	3	1428.627	1428.6270	R	R	1125	1136
PSM	RGESLDNLDSPR	104	sp|Q8WWI1-4|LMO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=6185	39.93	2	1437.6249	1437.6249	R	S	1507	1519
PSM	RHDEDEDDSLK	105	sp|O94915|FRYL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25		ms_run[2]:scan=1034	7.3032	3	1357.5746	1357.5746	R	D	1329	1340
PSM	RHSVDTSPGYHESDSK	106	sp|Q86XR7|TCAM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	3-UNIMOD:21	ms_run[2]:scan=1264	8.3619	2	1880.769	1880.7690	K	K	20	36
PSM	RPGQSFHVNSEVNSVLSPR	107	sp|Q14671-2|PUM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:21	ms_run[2]:scan=10791	70.353	3	2189.0379	2189.0379	R	S	193	212
PSM	RQLSHDHESVGPPSLDAQPNSK	108	sp|Q5T5U3-3|RHG21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	4-UNIMOD:21	ms_run[2]:scan=6037	38.932	3	2478.1289	2478.1289	R	T	843	865
PSM	RTPHVQAVQGPLGSPPK	109	sp|Q15149|PLEC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	14-UNIMOD:21	ms_run[2]:scan=7197	46.535	3	1847.9407	1847.9407	R	R	112	129
PSM	TPGHPPPPEIPSELGACDFEKPESPR	110	sp|Q92538-3|GBF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	25	17-UNIMOD:4,24-UNIMOD:21	ms_run[2]:scan=12712	83.661	3	2920.3103	2920.3103	R	A	1746	1772
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	111	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	3-UNIMOD:21,25-UNIMOD:35	ms_run[1]:scan=9115	58.993181666666665	3	2893.338733	2894.342244	R	-	100	127
PSM	ANSPEKPPEAGAAHKPR	112	sp|Q9UFC0|LRWD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1103	7.6152	3	1835.868	1835.8680	K	A	210	227
PSM	ARPFPDGLAEDIDKGEVSAR	113	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=12547	82.486	3	2142.0705	2142.0705	K	Q	606	626
PSM	AVSREDSARPGAHAK	114	sp|Q13151|ROA0_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=724	5.8714	2	1630.7577	1630.7577	R	V	82	97
PSM	DADDAVYELDGK	115	sp|Q13243-2|SRSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=9373	60.716	2	1309.5674	1309.5674	R	E	49	61
PSM	FPPEDFRHSPEDFR	116	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=10438	67.948	2	1854.7727	1854.7727	R	R	567	581
PSM	FPPEDFRHSPEDFR	117	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=10749	70.073	2	1854.7727	1854.7727	R	R	567	581
PSM	GRPPKPLGGGTPK	118	sp|Q9NTI5-5|PDS5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=1953	12.371	2	1340.6966	1340.6966	R	E	61	74
PSM	GTPKPPGPPAQPPGPPNASSNPDLR	119	sp|Q8N4C8-4|MINK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	20-UNIMOD:21	ms_run[2]:scan=8409	54.315	3	2525.2064	2525.2064	R	R	694	719
PSM	HARPPDPPASAPPDSSSNSASQDTK	120	sp|Q15642-4|CIP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	15-UNIMOD:21	ms_run[2]:scan=3117	19.759	3	2596.1191	2596.1191	R	E	430	455
PSM	HRPSPPATPPPK	121	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1697	10.708	3	1440.6316	1440.6316	R	T	399	411
PSM	KAPSSPPPPPPPLR	122	sp|Q13796|SHRM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	5-UNIMOD:21	ms_run[2]:scan=6514	42.076	2	1516.7803	1516.7803	K	S	309	323
PSM	KFNHDGEEEEEDDDYGSR	123	sp|Q6PJT7-10|ZC3HE_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3120	19.776	3	2169.8359	2169.8359	K	T	270	288
PSM	KKEPAITSQNSPEAR	124	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=1525	9.7511	3	1734.8302	1734.8302	K	E	69	84
PSM	LKDLFDYSPPLHK	125	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	8-UNIMOD:21	ms_run[2]:scan=13370	88.323	2	1651.8011	1651.8011	K	N	503	516
PSM	PGAEGAPLLPPPLPPPSPPGSGR	126	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	17-UNIMOD:21	ms_run[2]:scan=14569	96.862	2	2237.1246	2237.1246	R	G	27	50
PSM	PRSPKPAAPAAPPFSSSSGVLGTGLCELDR	127	sp|O43294-2|TGFI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21,26-UNIMOD:4	ms_run[2]:scan=15533	103.75	3	3101.5005	3101.5005	K	L	49	79
PSM	RDQALTEEHAR	128	sp|P12814-2|ACTN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=1137	7.7658	3	1324.6484	1324.6484	R	Q	614	625
PSM	RKETPPPLVPPAAR	129	sp|Q9BQA1-2|MEP50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	4-UNIMOD:21	ms_run[2]:scan=6527	42.155	3	1607.8549	1607.8549	M	E	2	16
PSM	RLSTSPDVIQGHQPR	130	sp|Q9Y385|UB2J1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=6068	39.133	3	1769.8574	1769.8574	R	D	264	279
PSM	RPTPNDDTLDEGVGLVHSNIATEHIPSPAK	131	sp|Q01581|HMCS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	27-UNIMOD:21	ms_run[2]:scan=13386	88.433	3	3259.551	3259.5510	R	K	469	499
PSM	SGGGGGGGLGSGGSIR	132	sp|P35527|K1C9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=3269	20.773	2	1231.5905	1231.5905	R	S	14	30
PSM	SHSPSASQSGSQLR	133	sp|Q8WWI1-4|LMO7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	3-UNIMOD:21	ms_run[2]:scan=1498	9.6117	2	1507.6416	1507.6416	R	N	1591	1605
PSM	SKEPHELVGSSPHR	134	sp|Q3T8J9-3|GON4L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	11-UNIMOD:21	ms_run[2]:scan=1942	12.314	2	1638.7515	1638.7515	K	E	1886	1900
PSM	TLEHSLPPSPRPLPR	135	sp|Q8TE67|ES8L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	9-UNIMOD:21	ms_run[2]:scan=7750	50.121	2	1775.9084	1775.9084	R	H	197	212
PSM	TSNRYSPESQAQSVHHQR	136	sp|O75376-2|NCOR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24	6-UNIMOD:21	ms_run[2]:scan=2836	18.064	3	2190.9556	2190.9556	K	P	1994	2012
PSM	VREEEIEVDSR	137	sp|Q14978|NOLC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	24		ms_run[2]:scan=4274	27.251	2	1359.663	1359.6630	R	V	628	639
PSM	AIFDGASTPTHHLSLHSDDSSTK	138	sp|Q9BSQ5-4|CCM2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=9473	61.332	3	2503.1017	2503.1017	R	V	174	197
PSM	APTVPPPLPPTPPQPAR	139	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	11-UNIMOD:21	ms_run[2]:scan=10669	69.536	2	1811.9335	1811.9335	R	R	616	633
PSM	DAVEDLESVGK	140	sp|P81605|DCD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=10738	70.005	2	1160.5561	1160.5561	K	G	86	97
PSM	DMESPTKLDVTLAK	141	sp|P27816-5|MAP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	2-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=9442	61.151	2	1642.7525	1642.7525	K	D	277	291
PSM	DRDDFPVVLVGNK	142	sp|P10301|RRAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=12137	79.588	2	1472.7623	1472.7623	K	A	131	144
PSM	HQSFYIETKLDGER	143	sp|P49917|DNLI4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=9414	60.971	3	1721.8373	1721.8373	K	M	265	279
PSM	HRDYETATLSDIK	144	sp|O43707-2|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=6821	44.014	2	1547.758	1547.7580	K	A	219	232
PSM	HRPSPPATPPPK	145	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21	ms_run[2]:scan=2048	13	3	1360.6653	1360.6653	R	T	399	411
PSM	HSTPSNSSNPSGPPSPNSPHR	146	sp|Q9Y5S2|MRCKB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:21	ms_run[2]:scan=1435	9.2609	3	2219.9345	2219.9345	K	S	1676	1697
PSM	HTFMGVVSLGSPSGEVSHPR	147	sp|P02765|FETUA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:35,13-UNIMOD:21	ms_run[2]:scan=10114	65.731	3	2175.9773	2175.9773	R	K	318	338
PSM	IREEELCHHSSSSTPLAADK	148	sp|A8CG34-2|P121C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:4,10-UNIMOD:21	ms_run[2]:scan=4698	29.91	3	2346.0311	2346.0311	K	E	190	210
PSM	IYHLPDAESDEDEDFKEQTR	149	sp|Q15019|SEPT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=10617	69.187	3	2516.0381	2516.0381	K	L	210	230
PSM	KGAGDGSDEEVDGK	150	sp|P35579-2|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=978	7.0396	2	1442.5562	1442.5562	R	A	1359	1373
PSM	KHDSGAADLER	151	sp|Q9NX55-3|HYPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23		ms_run[2]:scan=1194	8.0248	3	1197.5738	1197.5738	R	V	35	46
PSM	KVVVSHSTHR	152	sp|Q7L2H7-2|EIF3M_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=654	5.577	2	1228.6078	1228.6078	R	T	199	209
PSM	RGSIGENQIKDEK	153	sp|Q05682-5|CALD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=2981	18.939	3	1552.7247	1552.7247	K	I	194	207
PSM	RHSSETFSSTTTVTPVSPSFAHNPK	154	sp|Q9Y4H2|IRS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21	ms_run[2]:scan=9324	60.403	3	2781.2759	2781.2759	R	R	1146	1171
PSM	RKPAAPPPSPAAR	155	sp|Q9Y4F5-3|C170B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=1149	7.8253	2	1394.7184	1394.7184	R	E	1010	1023
PSM	RKSQMEEVQDELIHR	156	sp|Q12929-2|EPS8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,5-UNIMOD:35	ms_run[2]:scan=6387	41.298	3	1992.9088	1992.9088	R	L	423	438
PSM	RPHTPTPGIYMGR	157	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4365	27.791	2	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	158	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=8172	52.81	3	1577.7174	1577.7174	K	P	98	111
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	159	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	15-UNIMOD:21	ms_run[2]:scan=5332	34.051	3	2750.1933	2750.1933	R	T	13	39
PSM	RREEGPPPPSPDGASSDAEPEPPSGR	160	sp|Q9NTJ3-2|SMC4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	16-UNIMOD:21	ms_run[2]:scan=5532	35.344	3	2750.1933	2750.1933	R	T	13	39
PSM	RSSDDCHDHQTTPSLGVR	161	sp|Q9P2D6-3|F135A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	3-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=3871	24.72	3	2146.8851	2146.8851	R	T	425	443
PSM	SHSGPSSLPEAPLKPPGPLVPPDQQDK	162	sp|Q08378-4|GOGA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	7-UNIMOD:21	ms_run[2]:scan=12410	81.504	3	2854.3902	2854.3902	R	V	16	43
PSM	SKSPPKVPIVIQDDSLPAGPPPQIR	163	sp|Q7Z422-2|SZRD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	1-UNIMOD:21	ms_run[2]:scan=13849	91.714	3	2715.4361	2715.4361	K	I	17	42
PSM	TLEHSLPPSPRPLPR	164	sp|Q8TE67|ES8L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	23	9-UNIMOD:21	ms_run[2]:scan=8384	54.159	2	1775.9084	1775.9084	R	H	197	212
PSM	HITDKDDFANNR	165	sp|Q9Y6W3|CAN7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=2666	16.95857	3	1445.662248	1444.669505	R	E	592	604
PSM	ALQADSPHSSSGMSEVHSPGEHSGQSQGPPTPPTTPK	166	sp|P48436|SOX9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:35,31-UNIMOD:21	ms_run[2]:scan=5937	38.205	3	3802.653	3802.6530	K	T	206	243
PSM	ALVLIAFAQYLQQCPFEDHVK	167	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:4	ms_run[2]:scan=21788	151.4	3	2489.2777	2489.2777	K	L	45	66
PSM	ANSPEKPPEAGAAHKPR	168	sp|Q9UFC0|LRWD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=1326	8.6307	3	1835.868	1835.8680	K	A	210	227
PSM	APQQQPPPQQPPPPQPPPQQPPPPPSYSPAR	169	sp|Q9BUJ2-5|HNRL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	26-UNIMOD:21	ms_run[2]:scan=8411	54.322	3	3407.6452	3407.6452	R	N	215	246
PSM	APTVPPPLPPTPPQPAR	170	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=10518	68.502	2	1811.9335	1811.9335	R	R	616	633
PSM	DEDDADYKPK	171	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1416	9.1517	2	1194.5041	1194.5041	R	K	141	151
PSM	DTLLALHQHGHSGPFESK	172	sp|Q7Z5L9-2|I2BP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=9581	62.063	3	2052.9419	2052.9419	R	F	307	325
PSM	ENHGQADHSPSMTATHFPR	173	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=3655	23.266	2	2214.8902	2214.8902	R	V	254	273
PSM	ENHGQADHSPSMTATHFPR	174	sp|Q9Y3L3|3BP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=3714	23.699	3	2214.8902	2214.8902	R	V	254	273
PSM	FASDDEHDEHDENGATGPVKR	175	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=3373	21.411	3	2404.9557	2404.9557	K	A	364	385
PSM	GKEHDDIFDK	176	sp|O60313-13|OPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=3415	21.67	2	1202.5568	1202.5568	K	L	654	664
PSM	GPPDFSSDEEREPTPVLGSGAAAAGR	177	sp|P42167-3|LAP2B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	14-UNIMOD:21	ms_run[2]:scan=10620	69.207	3	2649.1708	2649.1708	K	S	61	87
PSM	HERPAGPGTPPPDSGPLAK	178	sp|Q9P2K8-2|E2AK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	9-UNIMOD:21	ms_run[2]:scan=4536	28.856	3	1959.9204	1959.9204	R	D	659	678
PSM	HGYIGEFEIIDDHR	179	sp|P62244|RS15A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=11742	76.839	3	1699.7954	1699.7954	K	A	44	58
PSM	HKMSPPPSGFGER	180	sp|Q8IY67-2|RAVR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:35,4-UNIMOD:21	ms_run[2]:scan=2807	17.888	3	1521.6436	1521.6436	R	S	614	627
PSM	HRDYETATLSDIK	181	sp|O43707-2|ACTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=6810	43.945	3	1547.758	1547.7580	K	A	219	232
PSM	HRPSPPATPPPK	182	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=1896	11.982	3	1360.6653	1360.6653	R	T	399	411
PSM	HRPSPPATPPPK	183	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=2454	15.593	3	1360.6653	1360.6653	R	T	399	411
PSM	IEDVGSDEEDDSGK	184	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=3336	21.191	2	1573.5669	1573.5669	K	D	250	264
PSM	IEDVGSDEEDDSGKDKK	185	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=1877	11.863	2	1944.7837	1944.7837	K	K	250	267
PSM	KAPSSPPPPPPPLR	186	sp|Q13796|SHRM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=6352	41.065	2	1516.7803	1516.7803	K	S	309	323
PSM	KGSPYHTGQLHPAVR	187	sp|Q92729-3|PTPRU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=3894	24.856	3	1726.8305	1726.8305	R	V	851	866
PSM	KHPDASVNFSEFSK	188	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=8334	53.845	3	1591.7631	1591.7631	K	K	30	44
PSM	KPEDWDERPK	189	sp|P27824-3|CALX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=2777	17.688	3	1298.6255	1298.6255	R	I	175	185
PSM	KPPGTPPPSALPLGAPPPDALPPGPTPEDSPSLETGSR	190	sp|Q9BQQ3-3|GORS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21	ms_run[2]:scan=14796	98.511	3	3773.8553	3773.8553	K	Q	139	177
PSM	LHPPSPVPQGVCPAHR	191	sp|Q96F44-2|TRI11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	5-UNIMOD:21,12-UNIMOD:4	ms_run[2]:scan=7115	45.961	2	1827.8604	1827.8604	R	E	81	97
PSM	MRKETPPPLVPPAAR	192	sp|Q9BQA1-2|MEP50_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	1-UNIMOD:35,5-UNIMOD:21	ms_run[2]:scan=6732	43.45	3	1754.8903	1754.8903	-	E	1	16
PSM	PAAPPRPLDRESPGVENK	193	sp|O00512|BCL9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	12-UNIMOD:21	ms_run[2]:scan=5017	32.019	2	2008.9732	2008.9732	K	L	267	285
PSM	PYHPPPLFPPSPQPPDSTPR	194	sp|P54259|ATN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=12812	84.376	3	2303.0776	2303.0776	R	Q	158	178
PSM	QRDEDDEAYGKPVK	195	sp|Q53GD3-4|CTL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=1664	10.524	2	1648.7693	1648.7693	K	Y	5	19
PSM	RDSFDDRGPSLNPVLDYDHGSR	196	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=11415	74.58	3	2597.1296	2597.1296	R	S	186	208
PSM	RGEDPPTPPPRPQK	197	sp|Q8NFH8-3|REPS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	7-UNIMOD:21	ms_run[2]:scan=2625	16.71	2	1650.7879	1650.7879	K	T	333	347
PSM	RGSIGENQIK	198	sp|Q05682-5|CALD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2892	18.354	2	1180.5602	1180.5602	K	D	194	204
PSM	RHSEQVANGPTPPPR	199	sp|A6ND36-2|FA83G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=2106	13.411	3	1721.7999	1721.7999	R	R	384	399
PSM	RISGLIYEETR	200	sp|P62805|H4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=11137	72.696	2	1415.681	1415.6810	K	G	46	57
PSM	RKETPPPLVPPAAR	201	sp|Q9BQA1-2|MEP50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=6364	41.146	3	1607.8549	1607.8549	M	E	2	16
PSM	RKETPPPLVPPAAR	202	sp|Q9BQA1-2|MEP50_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=6580	42.468	2	1607.8549	1607.8549	M	E	2	16
PSM	RKPSPEPEGEVGPPK	203	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21	ms_run[2]:scan=3322	21.111	3	1682.8029	1682.8029	K	I	341	356
PSM	RKSELEFETLK	204	sp|Q5JSH3-4|WDR44_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	3-UNIMOD:21	ms_run[2]:scan=8405	54.286	3	1458.712	1458.7120	K	T	235	246
PSM	RPHSVIGGSLGSFMAMPR	205	sp|Q00537-2|CDK17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,14-UNIMOD:35,16-UNIMOD:35	ms_run[2]:scan=9947	64.555	3	2010.9169	2010.9169	R	N	72	90
PSM	RPHTPTPGIYMGR	206	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=8944	57.851	3	1577.7174	1577.7174	K	P	98	111
PSM	RQPPVSPLTLSPGPEAHQGFSR	207	sp|Q6UUV7-3|CRTC3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	6-UNIMOD:21	ms_run[2]:scan=10699	69.734	3	2437.1904	2437.1904	R	Q	386	408
PSM	RRPLLPPTPDSGPEGESSE	208	sp|Q8NBR0|P5I13_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	18-UNIMOD:21	ms_run[2]:scan=8887	57.472	3	2099.9525	2099.9525	R	-	375	394
PSM	RTSLGTEQHHAAAAASVASR	209	sp|P35408|PE2R4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	2-UNIMOD:21	ms_run[2]:scan=4696	29.898	3	2099.9862	2099.9862	R	G	220	240
PSM	SKDQDDQKPGPSER	210	sp|Q15424-2|SAFB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22		ms_run[2]:scan=625	5.4388	2	1585.7332	1585.7332	K	S	467	481
PSM	SKEPHELVGSSPHR	211	sp|Q3T8J9-3|GON4L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	11-UNIMOD:21	ms_run[2]:scan=2071	13.161	3	1638.7515	1638.7515	K	E	1886	1900
PSM	STAQQELDGKPASPTPVIVASHTANK	212	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	13-UNIMOD:21	ms_run[2]:scan=8498	54.895	3	2726.3276	2726.3276	R	E	818	844
PSM	VDSTTCLFPVEEK	213	sp|Q06210-2|GFPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	22	4-UNIMOD:21,6-UNIMOD:4	ms_run[2]:scan=12823	84.447	2	1603.6841	1603.6841	R	A	241	254
PSM	RHSEQVANGPTPPPR	214	sp|A6ND36|FA83G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	3-UNIMOD:21	ms_run[1]:scan=2173	13.897695	3	1721.789566	1721.799882	R	R	632	647
PSM	TQAHSGSPTYLQLPPRPPGTR	215	sp|Q9H4M7|PKHA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	7-UNIMOD:21	ms_run[1]:scan=10948	71.385715	3	2341.137574	2340.137594	R	A	323	344
PSM	AAPPPPPPPPPLESSPR	216	sp|Q5T4S7-3|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:21	ms_run[2]:scan=8460	54.636	3	1782.8706	1782.8706	K	V	606	623
PSM	AGDLLEDSPK	217	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=6391	41.317	2	1123.4798	1123.4798	R	R	151	161
PSM	AGIPQHHPPMAQNLQYPDDSDDEKK	218	sp|Q15223|NECT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:35,20-UNIMOD:21	ms_run[2]:scan=6546	42.262	3	2926.2593	2926.2593	K	A	403	428
PSM	ALPAAHIPAPPHEGSPR	219	sp|P17029|ZKSC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	15-UNIMOD:21	ms_run[2]:scan=8283	53.528	2	1796.8723	1796.8723	R	D	194	211
PSM	APSVANVGSHCDLSLK	220	sp|P21333-2|FLNA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,11-UNIMOD:4	ms_run[2]:scan=9471	61.32	2	1733.7808	1733.7808	R	I	2142	2158
PSM	ARPFPDGLAEDIDKGEVSAR	221	sp|P13639|EF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=12353	81.105	3	2142.0705	2142.0705	K	Q	606	626
PSM	AVAGVMITASHNR	222	sp|Q6PCE3|PGM2L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=5051	32.22	2	1421.6486	1421.6486	K	K	166	179
PSM	DHPLPEVAHVK	223	sp|P13073|COX41_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=4884	31.209	3	1240.6564	1240.6564	R	H	43	54
PSM	DKSPVREPIDNLTPEER	224	sp|Q14498-2|RBM39_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=8636	55.818	3	2073.9732	2073.9732	K	D	134	151
PSM	FSGDLDDQTCR	225	sp|P05455|LA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:4	ms_run[2]:scan=5171	32.98	2	1312.5354	1312.5354	K	E	236	247
PSM	GIHPYHSLSYTSGDTATDSPVHVGR	226	sp|Q2LD37-2|K1109_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=9618	62.318	3	2733.2184	2733.2184	K	A	2254	2279
PSM	GRPPAEKLSPNPPK	227	sp|P51531-2|SMCA2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=3537	22.433	3	1566.7919	1566.7919	R	L	1369	1383
PSM	GVTIPYRPKPSSSPVIFAGGQDR	228	sp|Q15366-6|PCBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:21	ms_run[2]:scan=11834	77.455	3	2508.2526	2508.2526	K	Y	173	196
PSM	HEHPPNPPVSPGK	229	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=2516	15.948	3	1471.6609	1471.6609	R	T	663	676
PSM	HEHPPNPPVSPGK	230	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	10-UNIMOD:21	ms_run[2]:scan=2671	16.981	3	1471.6609	1471.6609	R	T	663	676
PSM	HERPAGPGTPPPDSGPLAK	231	sp|Q9P2K8-2|E2AK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=4838	30.886	3	1959.9204	1959.9204	R	D	659	678
PSM	HGYIGEFEIIDDHR	232	sp|P62244|RS15A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=12086	79.221	3	1699.7954	1699.7954	K	A	44	58
PSM	HHAAYVNNLNVTEEK	233	sp|P04179-3|SODM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=5466	34.901	2	1737.8434	1737.8434	K	Y	54	69
PSM	HKGSEEEHDALIGMGK	234	sp|O15417-2|TNC18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,14-UNIMOD:35	ms_run[2]:scan=3007	19.086	3	1832.7764	1832.7764	R	A	1576	1592
PSM	HRPSPPATPPPK	235	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1514	9.6906	3	1440.6316	1440.6316	R	T	399	411
PSM	HRPSPPATPPPK	236	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=1861	11.751	2	1360.6653	1360.6653	R	T	399	411
PSM	IPSHHFMPGSPTK	237	sp|Q9HCI7-2|MSL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:35,10-UNIMOD:21	ms_run[2]:scan=3592	22.829	2	1530.669	1530.6691	K	T	364	377
PSM	KFSKEEPVSSGPEEAVGK	238	sp|O00567|NOP56_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=6156	39.732	3	1983.9191	1983.9191	R	S	561	579
PSM	KHPDASVNFSEFSK	239	sp|P09429|HMGB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=8350	53.949	2	1591.7631	1591.7631	K	K	30	44
PSM	KHSPQHTTTLSLSTLATPK	240	sp|P52799|EFNB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=9548	61.829	3	2127.0725	2127.0725	R	R	258	277
PSM	KHSQTDLVSR	241	sp|O14683|P5I11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=1652	10.468	3	1249.5816	1249.5816	K	L	12	22
PSM	KKDDDDEEIGGPK	242	sp|Q9BXJ9|NAA15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=1300	8.5236	3	1444.6682	1444.6682	K	E	627	640
PSM	KKDSLHGSTGAVNATR	243	sp|Q9HBL0|TENS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=1357	8.7855	3	1720.8258	1720.8258	K	P	371	387
PSM	KKPAPLPPSSSPGPPSQDSR	244	sp|Q8N3F8|MILK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	16-UNIMOD:21	ms_run[2]:scan=3745	23.921	3	2109.0256	2109.0256	K	Q	381	401
PSM	KLDPELHLDIK	245	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=10136	65.889	3	1319.7449	1319.7449	R	V	186	197
PSM	KNHEEEISTLR	246	sp|P08727|K1C19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=3227	20.499	3	1354.6841	1354.6841	K	G	216	227
PSM	KRPSLPSSPSPGLPK	247	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=7808	50.476	2	1626.8495	1626.8495	K	A	117	132
PSM	KVASGVLSPPPAAPPPSSSSVPEAGGPPIKK	248	sp|Q8IXM2-2|BAP18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=10323	67.147	3	2985.5576	2985.5576	K	Q	69	100
PSM	KVVVSHSTHR	249	sp|Q7L2H7-2|EIF3M_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=657	5.5875	3	1228.6078	1228.6078	R	T	199	209
PSM	LKDLFDYSPPLHK	250	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	8-UNIMOD:21	ms_run[2]:scan=13553	89.595	2	1651.8011	1651.8011	K	N	503	516
PSM	LKNDMAVPTPPPPPVPPTK	251	sp|Q96RN5-3|MED15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	5-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=9126	59.063	3	2091.0476	2091.0476	K	Q	484	503
PSM	NKPGPNIESGNEDDDASFK	252	sp|O60841|IF2P_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=6945	44.868	3	2112.8637	2112.8637	K	I	206	225
PSM	RAEEELLLHDTR	253	sp|Q9BZL4-5|PP12C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=6743	43.528	3	1480.7634	1480.7634	K	C	125	137
PSM	RASAPHGPLDMAPFAR	254	sp|Q8N4B1-2|SESQ1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=9523	61.661	3	1788.8131	1788.8131	R	L	88	104
PSM	RGPSPACSDSSTLALIHSALHK	255	sp|Q5TZA2|CROCC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:4,11-UNIMOD:21	ms_run[2]:scan=13365	88.288	3	2384.1308	2384.1308	R	R	509	531
PSM	RHDSVENSDSHVEK	256	sp|Q9H9J4-2|UBP42_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21	ms_run[2]:scan=758	6.0128	3	1717.7057	1717.7057	R	K	1163	1177
PSM	RHPAGPPGEAQEGSAK	257	sp|Q6P1M3-2|L2GL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	14-UNIMOD:21	ms_run[2]:scan=1026	7.2681	2	1667.7417	1667.7417	K	A	667	683
PSM	RHQYSDYDYHSSSEK	258	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	11-UNIMOD:21	ms_run[2]:scan=2543	16.141	3	1980.7639	1980.7639	R	L	397	412
PSM	RHSVDTSPGYHESDSK	259	sp|Q86XR7|TCAM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=1256	8.3253	3	1880.769	1880.7690	K	K	20	36
PSM	RKPAAPPPSPAAR	260	sp|Q9Y4F5-3|C170B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	9-UNIMOD:21	ms_run[2]:scan=930	6.816	2	1394.7184	1394.7184	R	E	1010	1023
PSM	RNDHDDDEDEEVISK	261	sp|Q12789-3|TF3C1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=2677	17.017	3	1814.7555	1814.7555	K	T	341	356
PSM	RPGHGSLTNISR	262	sp|Q7Z6B7-2|SRGP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=3104	19.674	2	1373.6565	1373.6565	R	H	889	901
PSM	RPHTPTPGIYMGR	263	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=5579	35.666	3	1577.7174	1577.7174	K	P	98	111
PSM	RREEEEDEEEEEDR	264	sp|P78312-4|F193A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=994	7.1122	3	1877.7511	1877.7511	R	F	757	771
PSM	RREPESPPASAPIPLFGADTIGQR	265	sp|Q96AY4|TTC28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	6-UNIMOD:21	ms_run[2]:scan=14529	96.573	3	2641.3014	2641.3014	R	S	23	47
PSM	RSSLSSHSHQSQIYR	266	sp|O15027-2|SC16A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=2259	14.422	3	1851.8377	1851.8377	R	S	1367	1382
PSM	SGDETPGSEVPGDK	267	sp|Q1KMD3|HNRL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21	ms_run[2]:scan=3821	24.4	2	1453.561	1453.5610	R	A	161	175
PSM	SHHLDEDEER	268	sp|Q9H3F6-3|BACD3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21		ms_run[2]:scan=931	6.8195	2	1265.5273	1265.5273	R	E	124	134
PSM	SPFLSTPPLPPMPPGGTPPPQPPAK	269	sp|Q9C0K0-2|BC11B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	12-UNIMOD:35,17-UNIMOD:21	ms_run[2]:scan=14329	95.154	3	2600.275	2600.2750	K	S	330	355
PSM	STAQQELDGKPASPTPVIVASHTANKEEK	270	sp|P35606-2|COPB2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	13-UNIMOD:21	ms_run[2]:scan=8083	52.23	3	3112.5078	3112.5078	R	S	818	847
PSM	STTPPPAEPVSLPQEPPKPR	271	sp|Q9UN86-2|G3BP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	3-UNIMOD:21	ms_run[2]:scan=9439	61.136	3	2204.0878	2204.0878	K	V	225	245
PSM	TQAHSGSPTYLQLPPRPPGTR	272	sp|Q9H4M7|PKHA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	7-UNIMOD:21	ms_run[2]:scan=10624	69.229	3	2340.1376	2340.1376	R	A	323	344
PSM	YSPSQNSPIHHIPSR	273	sp|Q9NYF8-2|BCLF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	21	1-UNIMOD:21,7-UNIMOD:21	ms_run[2]:scan=6683	43.12	2	1878.7815	1878.7815	R	R	282	297
PSM	TYFPHFDLSHGSAQVK	274	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=12049	78.94915166666667	3	1832.884193	1832.884583	K	G	42	58
PSM	SGDHLHNDSQIEADFR	275	sp|P11387|TOP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,9-UNIMOD:21	ms_run[1]:scan=10346	67.30106166666667	3	1962.7932	1961.7902	M	L	2	18
PSM	LKNDMAVPTPPPPPVPPTK	276	sp|Q96RN5|MED15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:35,9-UNIMOD:21	ms_run[1]:scan=9409	60.94526333333333	3	2092.036146	2091.047566	K	Q	595	614
PSM	TPKDSPGIPPSAGAHQLFR	277	sp|Q15418|KS6A1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	5-UNIMOD:21	ms_run[1]:scan=9448	61.18133	3	2054.995062	2054.993890	R	G	359	378
PSM	LNECISPVANEMNHLPAHSHDLQR	278	sp|P23497|SP100_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	4-UNIMOD:4,6-UNIMOD:21,12-UNIMOD:35	ms_run[1]:scan=8139	52.604744999999994	3	2878.250512	2877.268762	R	M	13	37
PSM	AGDLLEDSPKRPK	279	sp|P51858-2|HDGF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21	ms_run[2]:scan=4519	28.764	2	1504.7287	1504.7287	R	E	151	164
PSM	AGLTIVTPERRFVLTCPSEK	280	sp|Q9NPF8-2|ADAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,7-UNIMOD:21,16-UNIMOD:4,18-UNIMOD:21	ms_run[2]:scan=7412	47.926	3	2513.1192	2513.1192	K	E	327	347
PSM	AHTPTPGIYMGR	281	sp|Q13595-4|TRA2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,10-UNIMOD:35	ms_run[2]:scan=5021	32.039	3	1395.6006	1395.6006	R	P	99	111
PSM	AKPSPHPIKDK	282	sp|Q9ULU4-2|PKCB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=868	6.5113	2	1296.6591	1296.6591	K	L	153	164
PSM	ALPAAHIPAPPHEGSPR	283	sp|P17029|ZKSC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	15-UNIMOD:21	ms_run[2]:scan=8534	55.131	3	1796.8723	1796.8723	R	D	194	211
PSM	CGSGPVHISGQHLVAVEEDAESEDEEEEDVK	284	sp|P06748-3|NPM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:4,22-UNIMOD:21	ms_run[2]:scan=11522	75.281	3	3459.4297	3459.4297	K	L	104	135
PSM	DKEVSDDEAEEK	285	sp|P07900|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=1087	7.5414	2	1472.5556	1472.5556	R	E	227	239
PSM	DVDDFFEHER	286	sp|Q9UNH7-2|SNX6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11244	73.436	2	1307.5418	1307.5418	K	T	89	99
PSM	EEEDKDDEEKPK	287	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=553	5.1336	2	1489.642	1489.6420	K	I	238	250
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	288	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	17-UNIMOD:21	ms_run[2]:scan=12730	83.788	3	2892.3583	2892.3583	K	Q	178	204
PSM	EVHDELEDLPSPPPPLSPPPTTSPHK	289	sp|Q9NQX3|GEPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	21-UNIMOD:21	ms_run[2]:scan=13472	89.028	3	2892.3583	2892.3583	K	Q	178	204
PSM	FPPEDFRHSPEDFR	290	sp|Q8IXT5|RB12B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=10853	70.763	2	1854.7727	1854.7727	R	R	567	581
PSM	GRRTPPVQPPPTR	291	sp|Q9Y6R9|CCD61_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=2761	17.589	3	1537.7879	1537.7879	R	E	282	295
PSM	GVVDSDDLPLNVSR	292	sp|P14625|ENPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=11796	77.2	3	1484.7471	1484.7471	K	E	435	449
PSM	HEHPPNPPVSPGK	293	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=2353	14.943	3	1471.6609	1471.6609	R	T	663	676
PSM	HEHPPNPPVSPGK	294	sp|Q6VMQ6-2|MCAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21	ms_run[2]:scan=2381	15.099	2	1471.6609	1471.6609	R	T	663	676
PSM	HERPAGPGTPPPDSGPLAK	295	sp|Q9P2K8-2|E2AK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=4998	31.907	3	1959.9204	1959.9204	R	D	659	678
PSM	HFKDEDEDEDVASPDGLGR	296	sp|O95365|ZBT7A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=6833	44.096	3	2129.9138	2129.9138	K	L	537	556
PSM	HNDLDDVGK	297	sp|P49588|SYAC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=2419	15.34	2	1011.4621	1011.4621	K	D	82	91
PSM	HRLTPQEGLQAPGGSLR	298	sp|Q03989-5|ARI5A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=7739	50.052	3	1895.9367	1895.9367	R	E	242	259
PSM	HRPSPPATPPPK	299	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1579	10.053	2	1440.6316	1440.6316	R	T	399	411
PSM	HRPSPPATPPPK	300	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=1753	11.061	2	1440.6316	1440.6316	R	T	399	411
PSM	HRPSPPATPPPK	301	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,8-UNIMOD:21	ms_run[2]:scan=2009	12.735	3	1440.6316	1440.6316	R	T	399	411
PSM	HRPSPPATPPPK	302	sp|Q8IYB3|SRRM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=1561	9.9575	3	1360.6653	1360.6653	R	T	399	411
PSM	KKEEPSQNDISPK	303	sp|Q9NR30-2|DDX21_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=1306	8.5454	2	1578.7291	1578.7291	K	T	11	24
PSM	KKEPAITSQNSPEAR	304	sp|P23193-2|TCEA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:21	ms_run[2]:scan=1707	10.764	3	1734.8302	1734.8302	K	E	69	84
PSM	KLDPELHLDIK	305	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10161	66.057	2	1319.7449	1319.7449	R	V	186	197
PSM	KQDPPVTHDLR	306	sp|P25685-2|DNJB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=2126	13.552	3	1304.6837	1304.6837	K	V	59	70
PSM	KRPSLPSSPSPGLPK	307	sp|O43294-2|TGFI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=7818	50.537	3	1626.8495	1626.8495	K	A	117	132
PSM	KSPSGPVKSPPLSPVGTTPVK	308	sp|Q9BVC5-2|ASHWN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	9-UNIMOD:21	ms_run[2]:scan=8088	52.261	3	2139.1341	2139.1341	R	L	177	198
PSM	LRRPSVNGEPGSVPPPR	309	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	5-UNIMOD:21	ms_run[2]:scan=6132	39.579	3	1893.9574	1893.9574	R	A	1253	1270
PSM	MEKPPAPPSLPAGPPGVK	310	sp|Q15428|SF3A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:35,9-UNIMOD:21	ms_run[2]:scan=10291	66.937	3	1864.9158	1864.9158	K	R	214	232
PSM	NKKSPEIHR	311	sp|Q9Y2W1|TR150_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=648	5.5516	2	1187.5812	1187.5812	K	R	669	678
PSM	NTPSQHSHSIQHSPER	312	sp|Q9NYF8-2|BCLF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	13-UNIMOD:21	ms_run[2]:scan=823	6.3079	3	1920.8228	1920.8228	K	S	254	270
PSM	PGAEGAPLLPPPLPPPSPPGSGR	313	sp|Q9H3P7|GCP60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	17-UNIMOD:21	ms_run[2]:scan=14461	96.077	3	2237.1246	2237.1246	R	G	27	50
PSM	RATPPAHPPPR	314	sp|Q5SQI0-7|ATAT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=1280	8.4389	3	1275.6238	1275.6238	R	S	236	247
PSM	RDSFDDRGPSLNPVLDYDHGSR	315	sp|P43243|MATR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=11728	76.736	3	2597.1296	2597.1296	R	S	186	208
PSM	RFSDFLGLHSK	316	sp|O60749-2|SNX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=12935	85.246	2	1385.6493	1385.6493	R	L	66	77
PSM	RHASAPSHVQPSDSEK	317	sp|O60343-2|TBCD4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=1001	7.1441	2	1811.7952	1811.7952	R	N	338	354
PSM	RHPDYSVVLLLR	318	sp|P02768|ALBU_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=13067	86.157	3	1466.8358	1466.8358	R	L	361	373
PSM	RHQYSDYDYHSSSEK	319	sp|Q9UDY2-3|ZO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	12-UNIMOD:21	ms_run[2]:scan=2770	17.628	2	1980.7639	1980.7639	R	L	397	412
PSM	RKPEDVLDDDDAGSAPLK	320	sp|P35613-3|BASI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=7909	51.103	3	1939.9487	1939.9487	R	S	140	158
PSM	RKPSPEPEGEVGPPK	321	sp|Q7Z5L9-2|I2BP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=3219	20.443	2	1682.8029	1682.8029	K	I	341	356
PSM	RPAGGRPSPSAMGK	322	sp|Q92615|LAR4B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=681	5.6864	2	1463.6704	1463.6704	R	R	711	725
PSM	RPHTPTPGIYMGR	323	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4172	26.587	3	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	324	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=4650	29.616	3	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	325	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=5117	32.639	3	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	326	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=5272	33.647	3	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	327	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=6005	38.702	3	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	328	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=8329	53.818	3	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	329	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21,11-UNIMOD:35	ms_run[2]:scan=7699	49.789	3	1577.7174	1577.7174	K	P	98	111
PSM	RPHTPTPGIYMGR	330	sp|P62995-3|TRA2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	4-UNIMOD:21	ms_run[2]:scan=6594	42.559	2	1561.7225	1561.7225	K	P	98	111
PSM	RPSPLAHQPVPR	331	sp|Q9NQT8|KI13B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=4498	28.619	3	1433.7293	1433.7293	K	I	1479	1491
PSM	RRSPPADAIPK	332	sp|P18754|RCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=2882	18.275	3	1286.6496	1286.6496	K	S	9	20
PSM	RRSPQEGPTWSR	333	sp|Q9Y4F5-3|C170B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=3423	21.721	3	1535.6994	1535.6994	R	G	700	712
PSM	RSSVVSPSHPPPAPPLGSPPGPK	334	sp|Q9Y6W5|WASF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	2-UNIMOD:21,6-UNIMOD:21	ms_run[2]:scan=9237	59.823	3	2404.1342	2404.1342	K	P	291	314
PSM	RVSSDLQHATAQLSLEHR	335	sp|P50548-2|ERF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10547	68.701	3	2127.0222	2127.0222	R	D	454	472
PSM	SPSPPLPTHIPPEPPR	336	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=10919	71.205	3	1797.8815	1797.8815	R	T	326	342
PSM	SPSPPLPTHIPPEPPR	337	sp|Q8IZ21-3|PHAR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21	ms_run[2]:scan=11067	72.211	3	1797.8815	1797.8815	R	T	326	342
PSM	SRSGEGEVSGLMR	338	sp|Q13263-2|TIF1B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	3-UNIMOD:21,12-UNIMOD:35	ms_run[2]:scan=3978	25.409	2	1459.6127	1459.6127	R	K	389	402
PSM	SRSPLDKDTYPPSASVVGASVGGHR	339	sp|Q96T37-4|RBM15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	1-UNIMOD:21	ms_run[2]:scan=8956	57.932	3	2619.2442	2619.2442	R	H	213	238
PSM	TKPTQAAGPSSPQKPPTPEETK	340	sp|P18887|XRCC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	10-UNIMOD:21,17-UNIMOD:21	ms_run[2]:scan=3429	21.754	3	2436.0975	2436.0975	K	A	437	459
PSM	TPGLHGDCDDDKYR	341	sp|O95159|ZFPL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:4	ms_run[2]:scan=3153	19.99	2	1647.6947	1647.6947	R	R	223	237
PSM	TQAHSGSPTYLQLPPRPPGTR	342	sp|Q9H4M7|PKHA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	7-UNIMOD:21	ms_run[2]:scan=10178	66.181	3	2340.1376	2340.1376	R	A	323	344
PSM	VKDRDDFPVVLVGNK	343	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10192	66.265	3	1699.9257	1699.9257	R	A	129	144
PSM	VKDRDDFPVVLVGNK	344	sp|P10301|RRAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20		ms_run[2]:scan=10200	66.32	2	1699.9257	1699.9257	R	A	129	144
PSM	VPVPTGAFDGPLHSPPPPPPR	345	sp|Q07890-2|SOS2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	14-UNIMOD:21	ms_run[2]:scan=12626	83.057	3	2211.0878	2211.0878	R	D	1156	1177
PSM	YDERPGPSPLPHR	346	sp|P08621-4|RU17_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	8-UNIMOD:21	ms_run[2]:scan=4693	29.884	3	1599.7195	1599.7195	R	D	123	136
PSM	YYHSPTNTVHMYPPEMAPSSAPPSTPPTHK	347	sp|P40818-2|UBP8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001583, MaxQuant, ]	20	11-UNIMOD:35,16-UNIMOD:35,24-UNIMOD:21	ms_run[2]:scan=6879	44.408	3	3433.4785	3433.4785	R	A	562	592
PSM	GTPKPPGPPAQPPGPPNASSNPDLR	348	sp|Q8N4C8|MINK1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	20-UNIMOD:21	ms_run[1]:scan=8782	56.78415833333334	3	2527.198419	2525.206402	R	R	714	739
PSM	VGAHAGEYGAEALER	349	sp|P69905|HBA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=6484	41.883131666666664	3	1528.725434	1528.727020	K	M	18	33
PSM	APAPPPPQPPPPSPLIPNR	350	sp|O75128|COBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	13-UNIMOD:21	ms_run[1]:scan=10223	66.47826166666667	3	2019.035763	2019.034298	R	T	335	354
PSM	LRRPSVNGEPGSVPPPR	351	sp|Q8N3D4|EH1L1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	5-UNIMOD:21	ms_run[1]:scan=6283	40.59916333333334	3	1894.942283	1893.957445	R	A	1253	1270
PSM	NFKTFFVHTPNR	352	sp|O15530|PDPK1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	4-UNIMOD:21	ms_run[1]:scan=12105	79.34780833333333	2	1587.743164	1586.739513	K	T	510	522
PSM	SSPSIICMPKQQPSR	353	sp|Q9NZN8|CNOT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	7-UNIMOD:4,8-UNIMOD:35	ms_run[1]:scan=663	5.60867	2	1730.8192	1730.8442	R	Q	169	184
PSM	QLTQPETHFGR	354	sp|Q9UJU6|DBNL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28,3-UNIMOD:21	ms_run[1]:scan=10105	65.67307	2	1375.5909	1375.5917	K	E	289	300
PSM	FHDIDDVKK	355	sp|Q9H2U2|IPYR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=3008	19.090196666666667	2	1114.560902	1115.561124	K	F	217	226
PSM	PMIEWALGGFQPSGPK	356	sp|Q9Y6K1|DNM3A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:35	ms_run[1]:scan=663	5.60867	2	1730.819665	1729.849778	K	G	405	421
PSM	PNDLNSSVTPSPAKHR	357	sp|Q969J3|BORC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:21,11-UNIMOD:21	ms_run[1]:scan=1330	8.644906666666667	2	1877.795154	1878.802658	R	A	13	29
PSM	HERPAGPGTPPPDSGPLAK	358	sp|Q9P2K8|E2AK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	9-UNIMOD:21	ms_run[1]:scan=4602	29.276735	2	1959.918773	1959.920391	R	D	659	678
PSM	HSPEEDFRQSPQEHFR	359	sp|Q8IXT5|RB12B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:21	ms_run[1]:scan=6516	42.08650166666666	3	2104.875204	2104.875232	R	R	709	725
PSM	DGGGVRDEGPAAAGDGLGRPLGPTPSQSR	360	sp|P55011|S12A2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	28-UNIMOD:21	ms_run[1]:scan=9182	59.45648666666667	3	2826.304775	2826.304613	R	F	52	81
PSM	RATLGPTPTTPPQPPDPSQPPPGPMQH	361	sp|O60927|PP1RB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	3-UNIMOD:21,25-UNIMOD:35	ms_run[1]:scan=9487	61.425369999999994	3	2895.336672	2894.342244	R	-	100	127