MTD	mzTab-version	1.0
MTD	mzTab-mode	Complete
MTD	mzTab-type	Identification
MTD	description	120124ry_414C2-43_JPST000083
MTD	ms_run[1]-location	D:\JobRequest\ResultFiles\20191004\20191004085747383040^10.242.103.245^taba@jp\Psearch.ProteinPilotExecV5\120124ry_414C2-43_1_5.pilotFin.txt
MTD	software[1]	[MS, MS:1000663, ProteinPilot, 5.0.0.0, 4767]
MTD	software[1]-setting	FASTA=sprot_human_20181121.fasta
MTD	software[1]-setting	PARAGON_VERSION=5.0.0.0, 4767
MTD	software[1]-setting	UI_SAMPLE_TYPE=Identification
MTD	software[1]-setting	UI_CYS_ALKYLATION=Iodoacetamide
MTD	software[1]-setting	UI_DIGESTION=Trypsin + Lys C
MTD	software[1]-setting	UI_INSTRUMENT=TripleTOF 5600
MTD	software[1]-setting	UI_SEARCH_EFFORT=Thorough
MTD	software[1]-setting	UI_ID_FOCUS=Biological modifications
MTD	software[1]-setting	UI_MIN_UNUSED_PROTSCORE=0.0458
MTD	software[1]-setting	MSTOLERANCE=0.05
MTD	software[1]-setting	MSTOLERANCE_U=Daltons
MTD	software[1]-setting	MSMSTOLERANCE=0.1
MTD	software[1]-setting	MSMSTOLERANCE_U=Daltons
MTD	software[2]	[MS, MS:1001207, Mascot, 2.6.1]
MTD	software[2]-setting	DB=sprot_human_mix
MTD	software[2]-setting	DTAXONOMYB=All entries
MTD	software[2]-setting	CLE=Trypsin+Lys-C
MTD	software[2]-setting	MODS=Carbamidomethyl (C)
MTD	software[2]-setting	IT_MODS=Oxidation (M)
MTD	software[2]-setting	CHARGE=2+ and 3+
MTD	software[2]-setting	TOL=20
MTD	software[2]-setting	TOLU=ppm
MTD	software[2]-setting	ITOL=0.1
MTD	software[2]-setting	ITOLU=Da
MTD	software[2]-setting	PEP_ISOTOPE_ERRORLE=0
MTD	software[2]-setting	PFA=1
MTD	software[2]-setting	MASS=Monoisotopic
MTD	software[2]-setting	INSTRUMENT=ESI-QUAD-TOF
MTD	software[3]	[MS, MS:1001476, X!Tandem, 2015.04.01.1]
MTD	software[3]-setting	DB=userFasta.sprot_human_mix_20181121
MTD	software[3]-setting	CLE=[R]|{P},[K]|{}
MTD	software[3]-setting	MODS=Carbamidomethyl (C)
MTD	software[3]-setting	IT_MODS=Oxidation (M)
MTD	software[3]-setting	TOL(-)=20
MTD	software[3]-setting	TOL(+)=20
MTD	software[3]-setting	TOLU=ppm
MTD	software[3]-setting	ITOL=0.1
MTD	software[3]-setting	ITOLU=Daltons
MTD	software[3]-setting	PEP_ISOTOPE_ERROR=yes
MTD	software[3]-setting	PFA=1
MTD	software[4]	[MS, MS:1002251, Comet, 2015.02 rev. 0]
MTD	software[4]-setting	Taxon=userFasta.sprot_human_mix_20181121
MTD	software[4]-setting	search_enzyme_number=2
MTD	software[4]-setting	FixMod=Carbamidomethyl (C)
MTD	software[4]-setting	VarMod=Oxidation (M)
MTD	software[4]-setting	max_variable_mods_in_peptide=5
MTD	software[4]-setting	allowed_missed_cleavage=1
MTD	software[4]-setting	peptide_mass_tolerance=20
MTD	software[4]-setting	peptide_mass_units=2
MTD	software[4]-setting	fragment_bin_tol=0.02
MTD	software[4]-setting	fragment_bin_offset=0.0
MTD	fixed_mod[1]	[UNIMOD, UNIMOD:4, Carbamidomethyl,]
MTD	fixed_mod[1]-site	C
MTD	fixed_mod[1]-position	Anywhere
MTD	variable_mod[1]	[UNIMOD, UNIMOD:35, Oxidation,]
MTD	variable_mod[1]-site	M
MTD	variable_mod[1]-position	Anywhere
MTD	protein_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]
MTD	psm_search_engine_score[1]	[http://rdf.jpostdb.org/ontology/jpost.owl#JpostScore]

PRH	accession	description	taxid	species	database	database_version	search_engine	best_search_engine_score[1]	ambiguity_members	modifications	protein_coverage	search_engine_score[1]_ms_run[1]	num_psms_ms_run[1]	num_peptides_distinct_ms_run[1]	num_peptides_unique_ms_run[1]
PRT	sp|P08238|HS90B_HUMAN	Heat shock protein HSP 90-beta OS=Homo sapiens OX=9606 GN=HSP90AB1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	66.0	null	412-UNIMOD:385,412-UNIMOD:4	0.12	66.0	56	4	1
PRT	sp|P46782|RS5_HUMAN	40S ribosomal protein S5 OS=Homo sapiens OX=9606 GN=RPS5 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	55.0	null		0.17	55.0	3	2	1
PRT	sp|P50454|SERPH_HUMAN	Serpin H1 OS=Homo sapiens OX=9606 GN=SERPINH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	53.0	null		0.06	53.0	17	1	0
PRT	sp|Q71DI3|H32_HUMAN	Histone H3.2 OS=Homo sapiens OX=9606 GN=HIST2H3A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	53.0	null	111-UNIMOD:4,91-UNIMOD:35	0.24	53.0	34	1	0
PRT	sp|P68431|H31_HUMAN	Histone H3.1 OS=Homo sapiens OX=9606 GN=HIST1H3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	52.0	null	97-UNIMOD:4,111-UNIMOD:4,91-UNIMOD:35	0.24	52.0	87	1	0
PRT	sp|Q9H9B4|SFXN1_HUMAN	Sideroflexin-1 OS=Homo sapiens OX=9606 GN=SFXN1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	52.0	null		0.11	52.0	7	1	0
PRT	sp|O43809|CPSF5_HUMAN	Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens OX=9606 GN=NUDT21 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51.0	null		0.13	51.0	6	1	0
PRT	sp|P84243|H33_HUMAN	Histone H3.3 OS=Homo sapiens OX=9606 GN=H3F3A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	51.0	null	111-UNIMOD:4	0.24	51.0	45	1	0
PRT	sp|Q5VTE0|EF1A3_HUMAN	Putative elongation factor 1-alpha-like 3 OS=Homo sapiens OX=9606 GN=EEF1A1P5 PE=5 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50.0	null	111-UNIMOD:4	0.06	50.0	27	1	0
PRT	sp|P56545-2|CTBP2_HUMAN	Isoform 2 of C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50.0	null	664-UNIMOD:4,680-UNIMOD:4	0.03	50.0	8	1	0
PRT	sp|Q9NSC2-2|SALL1_HUMAN	Isoform 2 of Sal-like protein 1 OS=Homo sapiens OX=9606 GN=SALL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50.0	null		0.03	50.0	3	1	0
PRT	sp|Q6FI13|H2A2A_HUMAN	Histone H2A type 2-A OS=Homo sapiens OX=9606 GN=HIST2H2AA3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50.0	null		0.23	50.0	2	1	0
PRT	sp|P09543-2|CN37_HUMAN	Isoform CNPI of 2',3'-cyclic-nucleotide 3'-phosphodiesterase OS=Homo sapiens OX=9606 GN=CNP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49.0	null	315-UNIMOD:4	0.06	49.0	4	1	0
PRT	sp|P0C0S8|H2A1_HUMAN	Histone H2A type 1 OS=Homo sapiens OX=9606 GN=HIST1H2AG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49.0	null		0.23	49.0	2	1	0
PRT	sp|P50991-2|TCPD_HUMAN	Isoform 2 of T-complex protein 1 subunit delta OS=Homo sapiens OX=9606 GN=CCT4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49.0	null		0.06	49.0	7	2	1
PRT	sp|P56545|CTBP2_HUMAN	C-terminal-binding protein 2 OS=Homo sapiens OX=9606 GN=CTBP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	49.0	null	124-UNIMOD:4,140-UNIMOD:4	0.08	49.0	2	1	0
PRT	sp|P0C0S5|H2AZ_HUMAN	Histone H2A.Z OS=Homo sapiens OX=9606 GN=H2AFZ PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48.0	null		0.23	48.0	2	1	0
PRT	sp|P22314-2|UBA1_HUMAN	Isoform 2 of Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47.0	null	866-UNIMOD:4	0.11	47.0	10	4	1
PRT	sp|P07237|PDIA1_HUMAN	Protein disulfide-isomerase OS=Homo sapiens OX=9606 GN=P4HB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47.0	null		0.06	47.0	9	1	0
PRT	sp|P60709|ACTB_HUMAN	Actin, cytoplasmic 1 OS=Homo sapiens OX=9606 GN=ACTB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	47.0	null	217-UNIMOD:4,119-UNIMOD:35,2-UNIMOD:1,17-UNIMOD:4,355-UNIMOD:35	0.29	47.0	49	6	1
PRT	sp|P49327|FAS_HUMAN	Fatty acid synthase OS=Homo sapiens OX=9606 GN=FASN PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46.0	null	2359-UNIMOD:4,2369-UNIMOD:4,2091-UNIMOD:4	0.07	46.0	29	6	1
PRT	sp|P13010|XRCC5_HUMAN	X-ray repair cross-complementing protein 5 OS=Homo sapiens OX=9606 GN=XRCC5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	46.0	null	670-UNIMOD:28,157-UNIMOD:385,157-UNIMOD:4,633-UNIMOD:35	0.13	46.0	16	6	2
PRT	sp|Q99832-2|TCPH_HUMAN	Isoform 2 of T-complex protein 1 subunit eta OS=Homo sapiens OX=9606 GN=CCT7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46.0	null	307-UNIMOD:4	0.07	46.0	9	1	0
PRT	sp|P31939-2|PUR9_HUMAN	Isoform 2 of Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46.0	null	240-UNIMOD:4	0.05	46.0	3	1	0
PRT	sp|Q71U36-2|TBA1A_HUMAN	Isoform 2 of Tubulin alpha-1A chain OS=Homo sapiens OX=9606 GN=TUBA1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46.0	null		0.11	46.0	4	2	0
PRT	sp|P54819-2|KAD2_HUMAN	Isoform 2 of Adenylate kinase 2, mitochondrial OS=Homo sapiens OX=9606 GN=AK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null		0.11	45.0	5	1	0
PRT	sp|Q15274|NADC_HUMAN	Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Homo sapiens OX=9606 GN=QPRT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null	202-UNIMOD:4	0.14	45.0	10	1	0
PRT	sp|P09874|PARP1_HUMAN	Poly [ADP-ribose] polymerase 1 OS=Homo sapiens OX=9606 GN=PARP1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	45.0	null	908-UNIMOD:4,929-UNIMOD:35	0.03	45.0	6	1	0
PRT	sp|P13797-2|PLST_HUMAN	Isoform 2 of Plastin-3 OS=Homo sapiens OX=9606 GN=PLS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null	187-UNIMOD:4	0.06	45.0	9	1	0
PRT	sp|P52209-2|6PGD_HUMAN	Isoform 2 of 6-phosphogluconate dehydrogenase, decarboxylating OS=Homo sapiens OX=9606 GN=PGD	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null		0.09	45.0	5	2	1
PRT	sp|P35221-3|CTNA1_HUMAN	Isoform 3 of Catenin alpha-1 OS=Homo sapiens OX=9606 GN=CTNNA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null		0.05	45.0	4	1	0
PRT	sp|P55060-3|XPO2_HUMAN	Isoform 3 of Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null		0.15	45.0	17	6	3
PRT	sp|P52292|IMA1_HUMAN	Importin subunit alpha-1 OS=Homo sapiens OX=9606 GN=KPNA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	45.0	null	223-UNIMOD:4,367-UNIMOD:28	0.23	45.0	27	5	0
PRT	sp|P68363|TBA1B_HUMAN	Tubulin alpha-1B chain OS=Homo sapiens OX=9606 GN=TUBA1B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45.0	null		0.06	45.0	4	1	0
PRT	sp|P04844-2|RPN2_HUMAN	Isoform 2 of Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 OS=Homo sapiens OX=9606 GN=RPN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null		0.05	44.0	5	1	0
PRT	sp|Q99714-2|HCD2_HUMAN	Isoform 2 of 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens OX=9606 GN=HSD17B10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null		0.11	44.0	5	1	0
PRT	sp|Q14974-2|IMB1_HUMAN	Isoform 2 of Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null	544-UNIMOD:4,440-UNIMOD:4,291-UNIMOD:4,310-UNIMOD:4	0.11	44.0	19	4	0
PRT	sp|Q13200-2|PSMD2_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 2 OS=Homo sapiens OX=9606 GN=PSMD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null	126-UNIMOD:4	0.10	44.0	11	3	2
PRT	sp|P40227-2|TCPZ_HUMAN	Isoform 2 of T-complex protein 1 subunit zeta OS=Homo sapiens OX=9606 GN=CCT6A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44.0	null		0.05	44.0	3	2	1
PRT	sp|O14980|XPO1_HUMAN	Exportin-1 OS=Homo sapiens OX=9606 GN=XPO1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	44.0	null	327-UNIMOD:4	0.05	44.0	13	2	1
PRT	sp|P02768|ALBU_HUMAN	Serum albumin OS=Homo sapiens OX=9606 GN=ALB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	44.0	null	313-UNIMOD:4	0.05	44.0	4	1	0
PRT	sp|P08727|K1C19_HUMAN	Keratin, type I cytoskeletal 19 OS=Homo sapiens OX=9606 GN=KRT19 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	43.0	null		0.06	43.0	7	1	0
PRT	sp|P26640|SYVC_HUMAN	Valine--tRNA ligase OS=Homo sapiens OX=9606 GN=VARS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	43.0	null		0.03	43.0	7	1	0
PRT	sp|P10809|CH60_HUMAN	60 kDa heat shock protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPD1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	43.0	null	40-UNIMOD:35,55-UNIMOD:35	0.09	43.0	21	3	0
PRT	sp|P16435|NCPR_HUMAN	NADPH--cytochrome P450 reductase OS=Homo sapiens OX=9606 GN=POR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.04	43.0	2	1	0
PRT	sp|Q96RP9-2|EFGM_HUMAN	Isoform 2 of Elongation factor G, mitochondrial OS=Homo sapiens OX=9606 GN=GFM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.04	43.0	5	1	0
PRT	sp|P26599-2|PTBP1_HUMAN	Isoform 2 of Polypyrimidine tract-binding protein 1 OS=Homo sapiens OX=9606 GN=PTBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.05	43.0	2	2	2
PRT	sp|Q9NTI5-2|PDS5B_HUMAN	Isoform 2 of Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.04	43.0	12	2	0
PRT	sp|Q6P2Q9|PRP8_HUMAN	Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens OX=9606 GN=PRPF8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.02	43.0	7	2	0
PRT	sp|P58107|EPIPL_HUMAN	Epiplakin OS=Homo sapiens OX=9606 GN=EPPK1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43.0	null		0.03	43.0	5	1	0
PRT	sp|P11142|HSP7C_HUMAN	Heat shock cognate 71 kDa protein OS=Homo sapiens OX=9606 GN=HSPA8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	43.0	null		0.09	43.0	3	2	1
PRT	sp|Q12905|ILF2_HUMAN	Interleukin enhancer-binding factor 2 OS=Homo sapiens OX=9606 GN=ILF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	43.0	null	271-UNIMOD:385,271-UNIMOD:4,291-UNIMOD:4	0.15	43.0	3	2	1
PRT	sp|Q13838|DX39B_HUMAN	Spliceosome RNA helicase DDX39B OS=Homo sapiens OX=9606 GN=DDX39B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ]	43.0	null	300-UNIMOD:385,300-UNIMOD:4	0.12	43.0	7	2	1
PRT	sp|P05783|K1C18_HUMAN	Keratin, type I cytoskeletal 18 OS=Homo sapiens OX=9606 GN=KRT18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	42.0	null	335-UNIMOD:35	0.06	42.0	9	1	0
PRT	sp|Q13363-2|CTBP1_HUMAN	Isoform 2 of C-terminal-binding protein 1 OS=Homo sapiens OX=9606 GN=CTBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null	107-UNIMOD:4,123-UNIMOD:4	0.08	42.0	5	1	0
PRT	sp|P07355-2|ANXA2_HUMAN	Isoform 2 of Annexin A2 OS=Homo sapiens OX=9606 GN=ANXA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null	280-UNIMOD:4	0.07	42.0	5	1	0
PRT	sp|P20700|LMNB1_HUMAN	Lamin-B1 OS=Homo sapiens OX=9606 GN=LMNB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null		0.04	42.0	5	1	0
PRT	sp|Q00610-2|CLH1_HUMAN	Isoform 2 of Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null	328-UNIMOD:4	0.03	42.0	5	2	0
PRT	sp|P61981|1433G_HUMAN	14-3-3 protein gamma OS=Homo sapiens OX=9606 GN=YWHAG PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42.0	null	97-UNIMOD:4	0.08	42.0	11	1	0
PRT	sp|O76003|GLRX3_HUMAN	Glutaredoxin-3 OS=Homo sapiens OX=9606 GN=GLRX3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	42.0	null	2-UNIMOD:1	0.08	42.0	1	1	1
PRT	sp|P25705|ATPA_HUMAN	ATP synthase subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	42.0	null	442-UNIMOD:27	0.04	42.0	1	1	1
PRT	sp|P18206-2|VINC_HUMAN	Isoform 1 of Vinculin OS=Homo sapiens OX=9606 GN=VCL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.02	41.0	2	1	0
PRT	sp|Q9NRH3|TBG2_HUMAN	Tubulin gamma-2 chain OS=Homo sapiens OX=9606 GN=TUBG2 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.06	41.0	5	1	0
PRT	sp|O43175|SERA_HUMAN	D-3-phosphoglycerate dehydrogenase OS=Homo sapiens OX=9606 GN=PHGDH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	41.0	null	200-UNIMOD:4,225-UNIMOD:4,421-UNIMOD:4	0.29	41.0	11	4	3
PRT	sp|P62314|SMD1_HUMAN	Small nuclear ribonucleoprotein Sm D1 OS=Homo sapiens OX=9606 GN=SNRPD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	41.0	null		0.18	41.0	11	1	0
PRT	sp|P23381|SYWC_HUMAN	Tryptophan--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=WARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.05	41.0	8	1	0
PRT	sp|P40925-3|MDHC_HUMAN	Isoform 3 of Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.08	41.0	5	1	0
PRT	sp|Q9UBT2-2|SAE2_HUMAN	Isoform 2 of SUMO-activating enzyme subunit 2 OS=Homo sapiens OX=9606 GN=UBA2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.05	41.0	8	1	0
PRT	sp|Q15233-2|NONO_HUMAN	Isoform 2 of Non-POU domain-containing octamer-binding protein OS=Homo sapiens OX=9606 GN=NONO	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.06	41.0	2	1	0
PRT	sp|P41250|GARS_HUMAN	Glycine--tRNA ligase OS=Homo sapiens OX=9606 GN=GARS PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.04	41.0	9	1	0
PRT	sp|Q9BWF3|RBM4_HUMAN	RNA-binding protein 4 OS=Homo sapiens OX=9606 GN=RBM4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41.0	null		0.13	41.0	4	1	0
PRT	sp|P11388-2|TOP2A_HUMAN	Isoform 2 of DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null	431-UNIMOD:4	0.03	40.0	3	2	1
PRT	sp|P27824-2|CALX_HUMAN	Isoform 2 of Calnexin OS=Homo sapiens OX=9606 GN=CANX	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null		0.07	40.0	7	1	0
PRT	sp|Q96AB3-2|ISOC2_HUMAN	Isoform 2 of Isochorismatase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ISOC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null		0.12	40.0	4	1	0
PRT	sp|Q6IS14|IF5AL_HUMAN	Eukaryotic translation initiation factor 5A-1-like OS=Homo sapiens OX=9606 GN=EIF5AL1 PE=2 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null	129-UNIMOD:4	0.16	40.0	2	1	0
PRT	sp|O75694-2|NU155_HUMAN	Isoform 2 of Nuclear pore complex protein Nup155 OS=Homo sapiens OX=9606 GN=NUP155	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null	645-UNIMOD:4	0.02	40.0	6	1	0
PRT	sp|Q9UBF2|COPG2_HUMAN	Coatomer subunit gamma-2 OS=Homo sapiens OX=9606 GN=COPG2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	40.0	null	810-UNIMOD:4	0.05	40.0	7	2	0
PRT	sp|P09936|UCHL1_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L1 OS=Homo sapiens OX=9606 GN=UCHL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40.0	null	47-UNIMOD:4	0.17	40.0	2	1	0
PRT	sp|P68104|EF1A1_HUMAN	Elongation factor 1-alpha 1 OS=Homo sapiens OX=9606 GN=EEF1A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	40.0	null	111-UNIMOD:4	0.06	40.0	6	1	0
PRT	sp|P11388|TOP2A_HUMAN	DNA topoisomerase 2-alpha OS=Homo sapiens OX=9606 GN=TOP2A PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	40.0	null		0.02	40.0	2	1	0
PRT	sp|P50453|SPB9_HUMAN	Serpin B9 OS=Homo sapiens OX=9606 GN=SERPINB9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	39.0	null	20-UNIMOD:4,30-UNIMOD:4	0.08	39.0	5	1	0
PRT	sp|P52565-2|GDIR1_HUMAN	Isoform 2 of Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null	79-UNIMOD:4	0.26	39.0	5	1	0
PRT	sp|O75506|HSBP1_HUMAN	Heat shock factor-binding protein 1 OS=Homo sapiens OX=9606 GN=HSBP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.26	39.0	7	1	0
PRT	sp|P37802-2|TAGL2_HUMAN	Isoform 2 of Transgelin-2 OS=Homo sapiens OX=9606 GN=TAGLN2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null	59-UNIMOD:4	0.09	39.0	5	1	0
PRT	sp|O00232-2|PSD12_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 12 OS=Homo sapiens OX=9606 GN=PSMD12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.06	39.0	1	1	1
PRT	sp|Q7Z6Z7-2|HUWE1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase HUWE1 OS=Homo sapiens OX=9606 GN=HUWE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null	821-UNIMOD:4,828-UNIMOD:4	0.02	39.0	5	3	1
PRT	sp|P25789|PSA4_HUMAN	Proteasome subunit alpha type-4 OS=Homo sapiens OX=9606 GN=PSMA4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null	34-UNIMOD:4	0.13	39.0	2	1	0
PRT	sp|O00303|EIF3F_HUMAN	Eukaryotic translation initiation factor 3 subunit F OS=Homo sapiens OX=9606 GN=EIF3F PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.06	39.0	2	1	0
PRT	sp|P62841|RS15_HUMAN	40S ribosomal protein S15 OS=Homo sapiens OX=9606 GN=RPS15 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39.0	null		0.16	39.0	2	1	0
PRT	sp|Q96P70|IPO9_HUMAN	Importin-9 OS=Homo sapiens OX=9606 GN=IPO9 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	39.0	null		0.06	39.0	6	2	1
PRT	sp|Q9H2W6|RM46_HUMAN	39S ribosomal protein L46, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL46 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	39.0	null		0.08	39.0	4	1	0
PRT	sp|O00410|IPO5_HUMAN	Importin-5 OS=Homo sapiens OX=9606 GN=IPO5 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.02	39.0	1	1	1
PRT	sp|Q9UHD8-5|SEPT9_HUMAN	Isoform 5 of Septin-9 OS=Homo sapiens OX=9606 GN=SEPT9	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39.0	null	2-UNIMOD:1	0.04	39.0	5	1	0
PRT	sp|P29401-2|TKT_HUMAN	Isoform 2 of Transketolase OS=Homo sapiens OX=9606 GN=TKT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.03	38.0	3	1	0
PRT	sp|Q92504|S39A7_HUMAN	Zinc transporter SLC39A7 OS=Homo sapiens OX=9606 GN=SLC39A7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|P42704|LPPRC_HUMAN	Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens OX=9606 GN=LRPPRC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	38.0	null	1277-UNIMOD:4,361-UNIMOD:4	0.07	38.0	11	5	3
PRT	sp|Q9BZX2-2|UCK2_HUMAN	Isoform 2 of Uridine-cytidine kinase 2 OS=Homo sapiens OX=9606 GN=UCK2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.23	38.0	1	1	1
PRT	sp|Q9UKA9-2|PTBP2_HUMAN	Isoform 2 of Polypyrimidine tract-binding protein 2 OS=Homo sapiens OX=9606 GN=PTBP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.11	38.0	2	2	2
PRT	sp|Q07021|C1QBP_HUMAN	Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens OX=9606 GN=C1QBP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ]	38.0	null	186-UNIMOD:4	0.21	38.0	4	2	1
PRT	sp|O60684|IMA7_HUMAN	Importin subunit alpha-7 OS=Homo sapiens OX=9606 GN=KPNA6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null	208-UNIMOD:4	0.04	38.0	2	1	0
PRT	sp|P09211|GSTP1_HUMAN	Glutathione S-transferase P OS=Homo sapiens OX=9606 GN=GSTP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	38.0	null	170-UNIMOD:4	0.30	38.0	28	2	0
PRT	sp|Q9UBE0|SAE1_HUMAN	SUMO-activating enzyme subunit 1 OS=Homo sapiens OX=9606 GN=SAE1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.06	38.0	1	1	1
PRT	sp|P07195|LDHB_HUMAN	L-lactate dehydrogenase B chain OS=Homo sapiens OX=9606 GN=LDHB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	38.0	null	132-UNIMOD:4,36-UNIMOD:4	0.24	38.0	22	4	1
PRT	sp|P52815|RM12_HUMAN	39S ribosomal protein L12, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL12 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38.0	null		0.13	38.0	1	1	1
PRT	sp|Q9UQ80|PA2G4_HUMAN	Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38.0	null		0.08	38.0	2	1	0
PRT	sp|Q96T76-5|MMS19_HUMAN	Isoform 4 of MMS19 nucleotide excision repair protein homolog OS=Homo sapiens OX=9606 GN=MMS19	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.03	37.0	1	1	1
PRT	sp|Q8WUM4-2|PDC6I_HUMAN	Isoform 2 of Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.02	37.0	3	1	0
PRT	sp|Q9NVM6|DJC17_HUMAN	DnaJ homolog subfamily C member 17 OS=Homo sapiens OX=9606 GN=DNAJC17 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.07	37.0	3	1	0
PRT	sp|P50897|PPT1_HUMAN	Palmitoyl-protein thioesterase 1 OS=Homo sapiens OX=9606 GN=PPT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	96-UNIMOD:4	0.09	37.0	2	1	0
PRT	sp|Q06830|PRDX1_HUMAN	Peroxiredoxin-1 OS=Homo sapiens OX=9606 GN=PRDX1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	52-UNIMOD:4	0.13	37.0	1	1	1
PRT	sp|P51665|PSMD7_HUMAN	26S proteasome non-ATPase regulatory subunit 7 OS=Homo sapiens OX=9606 GN=PSMD7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.10	37.0	3	2	1
PRT	sp|Q9GZS3|WDR61_HUMAN	WD repeat-containing protein 61 OS=Homo sapiens OX=9606 GN=WDR61 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.07	37.0	3	1	0
PRT	sp|Q08211|DHX9_HUMAN	ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	37.0	null	1059-UNIMOD:35	0.08	37.0	9	4	2
PRT	sp|P45974-2|UBP5_HUMAN	Isoform Short of Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	335-UNIMOD:4	0.03	37.0	5	1	0
PRT	sp|O75533|SF3B1_HUMAN	Splicing factor 3B subunit 1 OS=Homo sapiens OX=9606 GN=SF3B1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null		0.06	37.0	11	3	1
PRT	sp|P47756-2|CAPZB_HUMAN	Isoform 2 of F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37.0	null	36-UNIMOD:4	0.10	37.0	1	1	0
PRT	sp|P62937|PPIA_HUMAN	Peptidyl-prolyl cis-trans isomerase A OS=Homo sapiens OX=9606 GN=PPIA PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37.0	null	2-UNIMOD:1	0.12	37.0	32	1	0
PRT	sp|O43347|MSI1H_HUMAN	RNA-binding protein Musashi homolog 1 OS=Homo sapiens OX=9606 GN=MSI1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	37.0	null		0.10	37.0	3	1	0
PRT	sp|P13804-2|ETFA_HUMAN	Isoform 2 of Electron transfer flavoprotein subunit alpha, mitochondrial OS=Homo sapiens OX=9606 GN=ETFA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.16	36.0	3	2	1
PRT	sp|Q15084-2|PDIA6_HUMAN	Isoform 2 of Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.05	36.0	22	1	0
PRT	sp|Q9H583|HEAT1_HUMAN	HEAT repeat-containing protein 1 OS=Homo sapiens OX=9606 GN=HEATR1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.02	36.0	3	2	1
PRT	sp|Q7L1Q6-2|BZW1_HUMAN	Isoform 2 of Basic leucine zipper and W2 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=BZW1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	35-UNIMOD:4	0.08	36.0	4	1	0
PRT	sp|Q15003|CND2_HUMAN	Condensin complex subunit 2 OS=Homo sapiens OX=9606 GN=NCAPH PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	714-UNIMOD:4	0.06	36.0	4	2	1
PRT	sp|P23588|IF4B_HUMAN	Eukaryotic translation initiation factor 4B OS=Homo sapiens OX=9606 GN=EIF4B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.05	36.0	2	1	0
PRT	sp|Q92499-2|DDX1_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.03	36.0	8	1	0
PRT	sp|Q9H299|SH3L3_HUMAN	SH3 domain-binding glutamic acid-rich-like protein 3 OS=Homo sapiens OX=9606 GN=SH3BGRL3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null	71-UNIMOD:4	0.37	36.0	3	1	0
PRT	sp|P36871|PGM1_HUMAN	Phosphoglucomutase-1 OS=Homo sapiens OX=9606 GN=PGM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	36.0	null		0.10	36.0	10	2	0
PRT	sp|O00629|IMA3_HUMAN	Importin subunit alpha-3 OS=Homo sapiens OX=9606 GN=KPNA4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.09	36.0	2	2	2
PRT	sp|P06576|ATPB_HUMAN	ATP synthase subunit beta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	36.0	null		0.03	36.0	10	1	0
PRT	sp|O75643-2|U520_HUMAN	Isoform 2 of U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens OX=9606 GN=SNRNP200	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.03	36.0	1	1	1
PRT	sp|P38646|GRP75_HUMAN	Stress-70 protein, mitochondrial OS=Homo sapiens OX=9606 GN=HSPA9 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36.0	null		0.07	36.0	1	1	1
PRT	sp|P39687|AN32A_HUMAN	Acidic leucine-rich nuclear phosphoprotein 32 family member A OS=Homo sapiens OX=9606 GN=ANP32A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	36.0	null		0.14	36.0	3	1	0
PRT	sp|Q9UI26|IPO11_HUMAN	Importin-11 OS=Homo sapiens OX=9606 GN=IPO11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1000663, ProteinPilot, ]	36.0	null	621-UNIMOD:385,621-UNIMOD:4	0.02	36.0	2	1	0
PRT	sp|Q92973-2|TNPO1_HUMAN	Isoform 2 of Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36.0	null	1-UNIMOD:1	0.02	36.0	2	1	0
PRT	sp|P36542-2|ATPG_HUMAN	Isoform Heart of ATP synthase subunit gamma, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.11	35.0	4	1	0
PRT	sp|O43818|U3IP2_HUMAN	U3 small nucleolar RNA-interacting protein 2 OS=Homo sapiens OX=9606 GN=RRP9 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	35.0	null	399-UNIMOD:4,416-UNIMOD:4	0.11	35.0	5	2	0
PRT	sp|Q92616|GCN1_HUMAN	eIF-2-alpha kinase activator GCN1 OS=Homo sapiens OX=9606 GN=GCN1 PE=1 SV=6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.02	35.0	10	3	0
PRT	sp|Q9UQ80-2|PA2G4_HUMAN	Isoform 2 of Proliferation-associated protein 2G4 OS=Homo sapiens OX=9606 GN=PA2G4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.09	35.0	6	1	0
PRT	sp|P56192-2|SYMC_HUMAN	Isoform 2 of Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	287-UNIMOD:4	0.06	35.0	5	1	0
PRT	sp|O15067|PUR4_HUMAN	Phosphoribosylformylglycinamidine synthase OS=Homo sapiens OX=9606 GN=PFAS PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	35.0	null	905-UNIMOD:4,918-UNIMOD:4,928-UNIMOD:4	0.03	35.0	1	1	1
PRT	sp|P27348|1433T_HUMAN	14-3-3 protein theta OS=Homo sapiens OX=9606 GN=YWHAQ PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	189-UNIMOD:4	0.11	35.0	8	1	0
PRT	sp|P11310-2|ACADM_HUMAN	Isoform 2 of Medium-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.08	35.0	5	1	0
PRT	sp|Q92621|NU205_HUMAN	Nuclear pore complex protein Nup205 OS=Homo sapiens OX=9606 GN=NUP205 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null	877-UNIMOD:4	0.01	35.0	5	1	0
PRT	sp|O75369-2|FLNB_HUMAN	Isoform 2 of Filamin-B OS=Homo sapiens OX=9606 GN=FLNB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35.0	null		0.01	35.0	2	1	0
PRT	sp|Q562R1|ACTBL_HUMAN	Beta-actin-like protein 2 OS=Homo sapiens OX=9606 GN=ACTBL2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	35.0	null	124-UNIMOD:35,133-UNIMOD:35,120-UNIMOD:35	0.09	35.0	2	2	2
PRT	sp|P31483|TIA1_HUMAN	Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35.0	null	33-UNIMOD:4	0.05	35.0	2	1	0
PRT	sp|P53985-2|MOT1_HUMAN	Isoform 2 of Monocarboxylate transporter 1 OS=Homo sapiens OX=9606 GN=SLC16A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.05	34.0	5	2	0
PRT	sp|P20618|PSB1_HUMAN	Proteasome subunit beta type-1 OS=Homo sapiens OX=9606 GN=PSMB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	34.0	null	111-UNIMOD:35,119-UNIMOD:35	0.08	34.0	5	1	0
PRT	sp|Q9C005|DPY30_HUMAN	Protein dpy-30 homolog OS=Homo sapiens OX=9606 GN=DPY30 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	34.0	null		0.37	34.0	10	2	1
PRT	sp|O43592|XPOT_HUMAN	Exportin-T OS=Homo sapiens OX=9606 GN=XPOT PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	915-UNIMOD:4,938-UNIMOD:4	0.04	34.0	4	1	0
PRT	sp|P60842-2|IF4A1_HUMAN	Isoform 2 of Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.05	34.0	15	1	0
PRT	sp|Q9UI26-2|IPO11_HUMAN	Isoform 2 of Importin-11 OS=Homo sapiens OX=9606 GN=IPO11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	661-UNIMOD:4,561-UNIMOD:4	0.04	34.0	3	2	1
PRT	sp|P78527|PRKDC_HUMAN	DNA-dependent protein kinase catalytic subunit OS=Homo sapiens OX=9606 GN=PRKDC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	34.0	null	1525-UNIMOD:4,931-UNIMOD:4,1255-UNIMOD:4,1266-UNIMOD:4,1942-UNIMOD:4,1947-UNIMOD:4,1953-UNIMOD:4,1954-UNIMOD:4,2857-UNIMOD:4,2863-UNIMOD:4,2880-UNIMOD:4,2807-UNIMOD:28,729-UNIMOD:4	0.07	34.0	17	11	5
PRT	sp|P63208-2|SKP1_HUMAN	Isoform 2 of S-phase kinase-associated protein 1 OS=Homo sapiens OX=9606 GN=SKP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.13	34.0	5	1	0
PRT	sp|O95747|OXSR1_HUMAN	Serine/threonine-protein kinase OSR1 OS=Homo sapiens OX=9606 GN=OXSR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.04	34.0	2	1	0
PRT	sp|Q14204|DYHC1_HUMAN	Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens OX=9606 GN=DYNC1H1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.01	34.0	3	1	0
PRT	sp|O75251|NDUS7_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	183-UNIMOD:4	0.13	34.0	3	1	0
PRT	sp|Q9UJZ1-2|STML2_HUMAN	Isoform 2 of Stomatin-like protein 2, mitochondrial OS=Homo sapiens OX=9606 GN=STOML2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.10	34.0	4	1	0
PRT	sp|Q86VP6|CAND1_HUMAN	Cullin-associated NEDD8-dissociated protein 1 OS=Homo sapiens OX=9606 GN=CAND1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null	592-UNIMOD:4,598-UNIMOD:4	0.05	34.0	9	2	0
PRT	sp|P52294|IMA5_HUMAN	Importin subunit alpha-5 OS=Homo sapiens OX=9606 GN=KPNA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	34.0	null	337-UNIMOD:4,210-UNIMOD:4	0.10	34.0	6	2	0
PRT	sp|Q7L190|DPPA4_HUMAN	Developmental pluripotency-associated protein 4 OS=Homo sapiens OX=9606 GN=DPPA4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.18	34.0	4	1	0
PRT	sp|Q8NFU3-3|TSTD1_HUMAN	Isoform 3 of Thiosulfate:glutathione sulfurtransferase OS=Homo sapiens OX=9606 GN=TSTD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34.0	null		0.38	34.0	1	1	0
PRT	sp|Q96HR8|NAF1_HUMAN	H/ACA ribonucleoprotein complex non-core subunit NAF1 OS=Homo sapiens OX=9606 GN=NAF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	1-UNIMOD:1	0.03	34.0	2	1	0
PRT	sp|P61970|NTF2_HUMAN	Nuclear transport factor 2 OS=Homo sapiens OX=9606 GN=NUTF2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	2-UNIMOD:1	0.20	34.0	2	1	0
PRT	sp|P63279|UBC9_HUMAN	SUMO-conjugating enzyme UBC9 OS=Homo sapiens OX=9606 GN=UBE2I PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34.0	null	111-UNIMOD:28,138-UNIMOD:4	0.20	34.0	6	1	0
PRT	sp|Q15477|SKIV2_HUMAN	Helicase SKI2W OS=Homo sapiens OX=9606 GN=SKIV2L PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.01	33.0	5	1	0
PRT	sp|Q5JTH9-2|RRP12_HUMAN	Isoform 2 of RRP12-like protein OS=Homo sapiens OX=9606 GN=RRP12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	663-UNIMOD:4	0.02	33.0	3	1	0
PRT	sp|P55957-2|BID_HUMAN	Isoform 2 of BH3-interacting domain death agonist OS=Homo sapiens OX=9606 GN=BID	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.07	33.0	2	1	0
PRT	sp|Q9BSJ8-2|ESYT1_HUMAN	Isoform 2 of Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	900-UNIMOD:4	0.05	33.0	8	2	0
PRT	sp|P43246|MSH2_HUMAN	DNA mismatch repair protein Msh2 OS=Homo sapiens OX=9606 GN=MSH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	176-UNIMOD:4	0.03	33.0	9	1	0
PRT	sp|Q99961-2|SH3G1_HUMAN	Isoform 2 of Endophilin-A2 OS=Homo sapiens OX=9606 GN=SH3GL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.11	33.0	1	1	1
PRT	sp|Q9H0A0-2|NAT10_HUMAN	Isoform 2 of RNA cytidine acetyltransferase OS=Homo sapiens OX=9606 GN=NAT10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.03	33.0	7	1	0
PRT	sp|Q96EY1-2|DNJA3_HUMAN	Isoform 2 of DnaJ homolog subfamily A member 3, mitochondrial OS=Homo sapiens OX=9606 GN=DNAJA3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.05	33.0	4	1	0
PRT	sp|P05166-2|PCCB_HUMAN	Isoform 2 of Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null	401-UNIMOD:4	0.06	33.0	2	1	0
PRT	sp|Q9UI95|MD2L2_HUMAN	Mitotic spindle assembly checkpoint protein MAD2B OS=Homo sapiens OX=9606 GN=MAD2L2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.13	33.0	1	1	1
PRT	sp|Q16630-2|CPSF6_HUMAN	Isoform 2 of Cleavage and polyadenylation specificity factor subunit 6 OS=Homo sapiens OX=9606 GN=CPSF6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33.0	null		0.04	33.0	2	1	0
PRT	sp|Q9Y5B9|SP16H_HUMAN	FACT complex subunit SPT16 OS=Homo sapiens OX=9606 GN=SUPT16H PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	33.0	null	291-UNIMOD:35	0.03	33.0	5	1	0
PRT	sp|Q9H3U1|UN45A_HUMAN	Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33.0	null		0.03	33.0	1	1	0
PRT	sp|Q14980|NUMA1_HUMAN	Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33.0	null	462-UNIMOD:28	0.01	33.0	1	1	1
PRT	sp|Q96DA6|TIM14_HUMAN	Mitochondrial import inner membrane translocase subunit TIM14 OS=Homo sapiens OX=9606 GN=DNAJC19 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33.0	null	2-UNIMOD:1	0.17	33.0	1	1	1
PRT	sp|P23368|MAOM_HUMAN	NAD-dependent malic enzyme, mitochondrial OS=Homo sapiens OX=9606 GN=ME2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	481-UNIMOD:4	0.05	32.0	4	1	0
PRT	sp|Q9Y490|TLN1_HUMAN	Talin-1 OS=Homo sapiens OX=9606 GN=TLN1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	32.0	null	2243-UNIMOD:4	0.03	32.0	9	3	2
PRT	sp|Q99943|PLCA_HUMAN	1-acyl-sn-glycerol-3-phosphate acyltransferase alpha OS=Homo sapiens OX=9606 GN=AGPAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.08	32.0	2	1	0
PRT	sp|P15311|EZRI_HUMAN	Ezrin OS=Homo sapiens OX=9606 GN=EZR PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	44	1	0
PRT	sp|P07384|CAN1_HUMAN	Calpain-1 catalytic subunit OS=Homo sapiens OX=9606 GN=CAPN1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	677-UNIMOD:4,678-UNIMOD:4	0.03	32.0	4	1	0
PRT	sp|P46459-2|NSF_HUMAN	Isoform 2 of Vesicle-fusing ATPase OS=Homo sapiens OX=9606 GN=NSF	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.02	32.0	2	1	0
PRT	sp|P35222|CTNB1_HUMAN	Catenin beta-1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	32.0	null		0.03	32.0	6	1	0
PRT	sp|Q6ZNJ1|NBEL2_HUMAN	Neurobeachin-like protein 2 OS=Homo sapiens OX=9606 GN=NBEAL2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	32.0	null	245-UNIMOD:4	0.01	32.0	1	1	1
PRT	sp|Q9NU22|MDN1_HUMAN	Midasin OS=Homo sapiens OX=9606 GN=MDN1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null	1839-UNIMOD:4	0.01	32.0	2	2	2
PRT	sp|P49720|PSB3_HUMAN	Proteasome subunit beta type-3 OS=Homo sapiens OX=9606 GN=PSMB3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32.0	null		0.08	32.0	2	1	0
PRT	sp|P05386|RLA1_HUMAN	60S acidic ribosomal protein P1 OS=Homo sapiens OX=9606 GN=RPLP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	2-UNIMOD:1,9-UNIMOD:4	0.24	32.0	19	1	0
PRT	sp|P52565|GDIR1_HUMAN	Rho GDP-dissociation inhibitor 1 OS=Homo sapiens OX=9606 GN=ARHGDIA PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null	79-UNIMOD:4	0.21	32.0	1	1	0
PRT	sp|P20290|BTF3_HUMAN	Transcription factor BTF3 OS=Homo sapiens OX=9606 GN=BTF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	142-UNIMOD:28	0.12	32.0	5	2	1
PRT	sp|Q9NVP1|DDX18_HUMAN	ATP-dependent RNA helicase DDX18 OS=Homo sapiens OX=9606 GN=DDX18 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32.0	null	597-UNIMOD:28	0.03	32.0	3	1	0
PRT	sp|Q9H061|T126A_HUMAN	Transmembrane protein 126A OS=Homo sapiens OX=9606 GN=TMEM126A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32.0	null		0.14	32.0	1	1	0
PRT	sp|Q8TCT9-2|HM13_HUMAN	Isoform 2 of Minor histocompatibility antigen H13 OS=Homo sapiens OX=9606 GN=HM13	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	326-UNIMOD:4	0.06	31.0	5	1	0
PRT	sp|Q5VYK3|ECM29_HUMAN	Proteasome adapter and scaffold protein ECM29 OS=Homo sapiens OX=9606 GN=ECPAS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ]	31.0	null		0.04	31.0	10	4	1
PRT	sp|P24539|AT5F1_HUMAN	ATP synthase F(0) complex subunit B1, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5PB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.06	31.0	4	1	0
PRT	sp|Q96HY6|DDRGK_HUMAN	DDRGK domain-containing protein 1 OS=Homo sapiens OX=9606 GN=DDRGK1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.06	31.0	1	1	1
PRT	sp|Q12955-4|ANK3_HUMAN	Isoform 2 of Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.01	31.0	2	1	0
PRT	sp|P31483-2|TIA1_HUMAN	Isoform Short of Nucleolysin TIA-1 isoform p40 OS=Homo sapiens OX=9606 GN=TIA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	33-UNIMOD:4	0.05	31.0	1	1	0
PRT	sp|Q9UPN3-2|MACF1_HUMAN	Isoform 2 of Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens OX=9606 GN=MACF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|O75155-2|CAND2_HUMAN	Isoform 2 of Cullin-associated NEDD8-dissociated protein 2 OS=Homo sapiens OX=9606 GN=CAND2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.02	31.0	1	1	1
PRT	sp|Q99497|PARK7_HUMAN	Protein/nucleic acid deglycase DJ-1 OS=Homo sapiens OX=9606 GN=PARK7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.11	31.0	7	1	0
PRT	sp|P55196-1|AFAD_HUMAN	Isoform 2 of Afadin OS=Homo sapiens OX=9606 GN=AFDN	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.01	31.0	1	1	1
PRT	sp|Q01085-2|TIAR_HUMAN	Isoform 2 of Nucleolysin TIAR OS=Homo sapiens OX=9606 GN=TIAL1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	35-UNIMOD:4	0.05	31.0	3	1	0
PRT	sp|P07900-2|HS90A_HUMAN	Isoform 2 of Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.03	31.0	1	1	1
PRT	sp|P32119-2|PRDX2_HUMAN	Isoform 2 of Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null	51-UNIMOD:4	0.20	31.0	5	2	0
PRT	sp|P51114-2|FXR1_HUMAN	Isoform 2 of Fragile X mental retardation syndrome-related protein 1 OS=Homo sapiens OX=9606 GN=FXR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.03	31.0	5	1	0
PRT	sp|P49588-2|SYAC_HUMAN	Isoform 2 of Alanine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=AARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31.0	null		0.06	31.0	8	2	0
PRT	sp|P32119|PRDX2_HUMAN	Peroxiredoxin-2 OS=Homo sapiens OX=9606 GN=PRDX2 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null	51-UNIMOD:4	0.14	31.0	1	1	0
PRT	sp|Q8WXH0|SYNE2_HUMAN	Nesprin-2 OS=Homo sapiens OX=9606 GN=SYNE2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31.0	null	6551-UNIMOD:28	0.00	31.0	1	1	1
PRT	sp|Q92499|DDX1_HUMAN	ATP-dependent RNA helicase DDX1 OS=Homo sapiens OX=9606 GN=DDX1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31.0	null		0.02	31.0	2	1	0
PRT	sp|P08621|RU17_HUMAN	U1 small nuclear ribonucleoprotein 70 kDa OS=Homo sapiens OX=9606 GN=SNRNP70 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31.0	null	2-UNIMOD:1	0.04	31.0	3	1	0
PRT	sp|P30153|2AAA_HUMAN	Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A alpha isoform OS=Homo sapiens OX=9606 GN=PPP2R1A PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	31.0	null	399-UNIMOD:28,228-UNIMOD:4	0.08	31.0	6	2	0
PRT	sp|Q14676-2|MDC1_HUMAN	Isoform 2 of Mediator of DNA damage checkpoint protein 1 OS=Homo sapiens OX=9606 GN=MDC1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.01	30.0	4	1	0
PRT	sp|O95983-2|MBD3_HUMAN	Isoform 2 of Methyl-CpG-binding domain protein 3 OS=Homo sapiens OX=9606 GN=MBD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	140-UNIMOD:4	0.15	30.0	2	1	0
PRT	sp|O43156|TTI1_HUMAN	TELO2-interacting protein 1 homolog OS=Homo sapiens OX=9606 GN=TTI1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.02	30.0	2	1	0
PRT	sp|Q96EB1-2|ELP4_HUMAN	Isoform 2 of Elongator complex protein 4 OS=Homo sapiens OX=9606 GN=ELP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.04	30.0	1	1	1
PRT	sp|P42356|PI4KA_HUMAN	Phosphatidylinositol 4-kinase alpha OS=Homo sapiens OX=9606 GN=PI4KA PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.01	30.0	1	1	1
PRT	sp|Q7Z4S6-2|KI21A_HUMAN	Isoform 2 of Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	299-UNIMOD:4	0.01	30.0	1	1	1
PRT	sp|Q6L8Q7-2|PDE12_HUMAN	Isoform 2 of 2',5'-phosphodiesterase 12 OS=Homo sapiens OX=9606 GN=PDE12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.04	30.0	2	1	0
PRT	sp|P40937-2|RFC5_HUMAN	Isoform 2 of Replication factor C subunit 5 OS=Homo sapiens OX=9606 GN=RFC5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.07	30.0	3	1	0
PRT	sp|Q9Y4R8|TELO2_HUMAN	Telomere length regulation protein TEL2 homolog OS=Homo sapiens OX=9606 GN=TELO2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.03	30.0	2	1	0
PRT	sp|Q6QNY1-2|BL1S2_HUMAN	Isoform 2 of Biogenesis of lysosome-related organelles complex 1 subunit 2 OS=Homo sapiens OX=9606 GN=BLOC1S2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.28	30.0	4	1	0
PRT	sp|Q9H3U1-2|UN45A_HUMAN	Isoform 2 of Protein unc-45 homolog A OS=Homo sapiens OX=9606 GN=UNC45A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.05	30.0	3	2	1
PRT	sp|Q15797|SMAD1_HUMAN	Mothers against decapentaplegic homolog 1 OS=Homo sapiens OX=9606 GN=SMAD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.06	30.0	1	1	1
PRT	sp|P55884-2|EIF3B_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 3 subunit B OS=Homo sapiens OX=9606 GN=EIF3B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.03	30.0	4	1	0
PRT	sp|P68402-2|PA1B2_HUMAN	Isoform 2 of Platelet-activating factor acetylhydrolase IB subunit beta OS=Homo sapiens OX=9606 GN=PAFAH1B2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.21	30.0	1	1	1
PRT	sp|Q9BQ52-2|RNZ2_HUMAN	Isoform 2 of Zinc phosphodiesterase ELAC protein 2 OS=Homo sapiens OX=9606 GN=ELAC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	347-UNIMOD:4	0.06	30.0	4	1	0
PRT	sp|P14625|ENPL_HUMAN	Endoplasmin OS=Homo sapiens OX=9606 GN=HSP90B1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.02	30.0	1	1	1
PRT	sp|P07437|TBB5_HUMAN	Tubulin beta chain OS=Homo sapiens OX=9606 GN=TUBB PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1000663, ProteinPilot, ]	30.0	null	201-UNIMOD:4,211-UNIMOD:4	0.20	30.0	8	3	1
PRT	sp|Q5T4S7-2|UBR4_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.02	30.0	7	4	2
PRT	sp|Q9UBQ7|GRHPR_HUMAN	Glyoxylate reductase/hydroxypyruvate reductase OS=Homo sapiens OX=9606 GN=GRHPR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	123-UNIMOD:4	0.08	30.0	1	1	1
PRT	sp|P04406|G3P_HUMAN	Glyceraldehyde-3-phosphate dehydrogenase OS=Homo sapiens OX=9606 GN=GAPDH PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null	46-UNIMOD:35	0.09	30.0	6	1	0
PRT	sp|P49459-2|UBE2A_HUMAN	Isoform 2 of Ubiquitin-conjugating enzyme E2 A OS=Homo sapiens OX=9606 GN=UBE2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30.0	null		0.34	30.0	3	1	0
PRT	sp|Q96B26|EXOS8_HUMAN	Exosome complex component RRP43 OS=Homo sapiens OX=9606 GN=EXOSC8 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ],[MS, MS:1001476, X!Tandem, ]	30.0	null		0.10	30.0	6	1	0
PRT	sp|P55072|TERA_HUMAN	Transitional endoplasmic reticulum ATPase OS=Homo sapiens OX=9606 GN=VCP PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30.0	null	568-UNIMOD:28,572-UNIMOD:4	0.02	30.0	5	1	0
PRT	sp|O75351|VPS4B_HUMAN	Vacuolar protein sorting-associated protein 4B OS=Homo sapiens OX=9606 GN=VPS4B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|Q8WX92|NELFB_HUMAN	Negative elongation factor B OS=Homo sapiens OX=9606 GN=NELFB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	306-UNIMOD:4	0.05	29.0	1	1	1
PRT	sp|Q9UKF6|CPSF3_HUMAN	Cleavage and polyadenylation specificity factor subunit 3 OS=Homo sapiens OX=9606 GN=CPSF3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|Q01970-2|PLCB3_HUMAN	Isoform 2 of 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-3 OS=Homo sapiens OX=9606 GN=PLCB3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.02	29.0	2	1	0
PRT	sp|P52789|HXK2_HUMAN	Hexokinase-2 OS=Homo sapiens OX=9606 GN=HK2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	133-UNIMOD:4	0.02	29.0	3	1	0
PRT	sp|P61204-2|ARF3_HUMAN	Isoform 2 of ADP-ribosylation factor 3 OS=Homo sapiens OX=9606 GN=ARF3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	122-UNIMOD:4	0.19	29.0	3	1	0
PRT	sp|Q8WUX9-2|CHMP7_HUMAN	Isoform 2 of Charged multivesicular body protein 7 OS=Homo sapiens OX=9606 GN=CHMP7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.10	29.0	2	1	0
PRT	sp|P35580-2|MYH10_HUMAN	Isoform 2 of Myosin-10 OS=Homo sapiens OX=9606 GN=MYH10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.01	29.0	1	1	1
PRT	sp|Q9H9S3-2|S61A2_HUMAN	Isoform 2 of Protein transport protein Sec61 subunit alpha isoform 2 OS=Homo sapiens OX=9606 GN=SEC61A2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.05	29.0	2	1	0
PRT	sp|Q8IY67|RAVR1_HUMAN	Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	29.0	null		0.06	29.0	1	1	0
PRT	sp|P02768-2|ALBU_HUMAN	Isoform 2 of Serum albumin OS=Homo sapiens OX=9606 GN=ALB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	121-UNIMOD:4	0.07	29.0	8	1	0
PRT	sp|Q9BQG0-2|MBB1A_HUMAN	Isoform 2 of Myb-binding protein 1A OS=Homo sapiens OX=9606 GN=MYBBP1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.04	29.0	2	2	2
PRT	sp|P06733-2|ENOA_HUMAN	Isoform MBP-1 of Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null	296-UNIMOD:4	0.13	29.0	5	2	0
PRT	sp|P22695|QCR2_HUMAN	Cytochrome b-c1 complex subunit 2, mitochondrial OS=Homo sapiens OX=9606 GN=UQCRC2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.09	29.0	2	1	0
PRT	sp|P00338-3|LDHA_HUMAN	Isoform 3 of L-lactate dehydrogenase A chain OS=Homo sapiens OX=9606 GN=LDHA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.10	29.0	8	2	0
PRT	sp|Q14008-2|CKAP5_HUMAN	Isoform 2 of Cytoskeleton-associated protein 5 OS=Homo sapiens OX=9606 GN=CKAP5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29.0	null		0.03	29.0	5	2	1
PRT	sp|P60842|IF4A1_HUMAN	Eukaryotic initiation factor 4A-I OS=Homo sapiens OX=9606 GN=EIF4A1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null		0.04	29.0	2	1	0
PRT	sp|Q9Y6C9|MTCH2_HUMAN	Mitochondrial carrier homolog 2 OS=Homo sapiens OX=9606 GN=MTCH2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	2-UNIMOD:1	0.08	29.0	2	1	0
PRT	sp|Q9P1F3|ABRAL_HUMAN	Costars family protein ABRACL OS=Homo sapiens OX=9606 GN=ABRACL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	39-UNIMOD:385,39-UNIMOD:4	0.17	29.0	3	1	0
PRT	sp|Q14671|PUM1_HUMAN	Pumilio homolog 1 OS=Homo sapiens OX=9606 GN=PUM1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29.0	null	977-UNIMOD:385,977-UNIMOD:4,980-UNIMOD:4	0.02	29.0	1	1	1
PRT	sp|Q96AB3|ISOC2_HUMAN	Isochorismatase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=ISOC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null		0.13	29.0	2	1	0
PRT	sp|P30048|PRDX3_HUMAN	Thioredoxin-dependent peroxide reductase, mitochondrial OS=Homo sapiens OX=9606 GN=PRDX3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29.0	null	108-UNIMOD:4	0.10	29.0	1	1	1
PRT	sp|P29401|TKT_HUMAN	Transketolase OS=Homo sapiens OX=9606 GN=TKT PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ],[MS, MS:1002251, Comet, ]	28.0	null	266-UNIMOD:35	0.03	28.0	2	1	0
PRT	sp|P61916|NPC2_HUMAN	NPC intracellular cholesterol transporter 2 OS=Homo sapiens OX=9606 GN=NPC2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	140-UNIMOD:4	0.12	28.0	2	1	0
PRT	sp|Q01518|CAP1_HUMAN	Adenylyl cyclase-associated protein 1 OS=Homo sapiens OX=9606 GN=CAP1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.09	28.0	2	2	2
PRT	sp|Q9BUA3|SPNDC_HUMAN	Spindlin interactor and repressor of chromatin-binding protein OS=Homo sapiens OX=9606 GN=SPINDOC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.05	28.0	3	1	0
PRT	sp|Q9P2I0|CPSF2_HUMAN	Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens OX=9606 GN=CPSF2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.02	28.0	2	1	0
PRT	sp|P31943|HNRH1_HUMAN	Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens OX=9606 GN=HNRNPH1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	122-UNIMOD:4	0.08	28.0	2	1	0
PRT	sp|Q9H061-2|T126A_HUMAN	Isoform 2 of Transmembrane protein 126A OS=Homo sapiens OX=9606 GN=TMEM126A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.22	28.0	1	1	0
PRT	sp|Q6DKI1|RL7L_HUMAN	60S ribosomal protein L7-like 1 OS=Homo sapiens OX=9606 GN=RPL7L1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	184-UNIMOD:4	0.08	28.0	4	1	0
PRT	sp|Q9H490-2|PIGU_HUMAN	Isoform 2 of Phosphatidylinositol glycan anchor biosynthesis class U protein OS=Homo sapiens OX=9606 GN=PIGU	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	134-UNIMOD:4	0.05	28.0	2	1	0
PRT	sp|Q9Y295|DRG1_HUMAN	Developmentally-regulated GTP-binding protein 1 OS=Homo sapiens OX=9606 GN=DRG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null	142-UNIMOD:4	0.05	28.0	1	1	1
PRT	sp|Q9HCC0-2|MCCB_HUMAN	Isoform 2 of Methylcrotonoyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=MCCC2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	1	1	1
PRT	sp|Q13619-2|CUL4A_HUMAN	Isoform 2 of Cullin-4A OS=Homo sapiens OX=9606 GN=CUL4A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.03	28.0	2	1	0
PRT	sp|O95372|LYPA2_HUMAN	Acyl-protein thioesterase 2 OS=Homo sapiens OX=9606 GN=LYPLA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null	135-UNIMOD:4,147-UNIMOD:4	0.17	28.0	3	1	0
PRT	sp|Q9H4A6|GOLP3_HUMAN	Golgi phosphoprotein 3 OS=Homo sapiens OX=9606 GN=GOLPH3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	28.0	null		0.14	28.0	5	2	1
PRT	sp|Q9NQC3-6|RTN4_HUMAN	Isoform 6 of Reticulon-4 OS=Homo sapiens OX=9606 GN=RTN4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28.0	null		0.04	28.0	2	1	0
PRT	sp|Q9UL46|PSME2_HUMAN	Proteasome activator complex subunit 2 OS=Homo sapiens OX=9606 GN=PSME2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28.0	null	118-UNIMOD:385,118-UNIMOD:4,22-UNIMOD:28	0.12	28.0	5	2	0
PRT	sp|Q9HAV4|XPO5_HUMAN	Exportin-5 OS=Homo sapiens OX=9606 GN=XPO5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1001207, Mascot, ]	28.0	null	646-UNIMOD:385,646-UNIMOD:4	0.01	28.0	2	1	0
PRT	sp|P47756|CAPZB_HUMAN	F-actin-capping protein subunit beta OS=Homo sapiens OX=9606 GN=CAPZB PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null	36-UNIMOD:4	0.09	28.0	2	1	0
PRT	sp|Q9BTC8|MTA3_HUMAN	Metastasis-associated protein MTA3 OS=Homo sapiens OX=9606 GN=MTA3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28.0	null	109-UNIMOD:385,109-UNIMOD:4	0.03	28.0	3	1	0
PRT	sp|Q9UQE7|SMC3_HUMAN	Structural maintenance of chromosomes protein 3 OS=Homo sapiens OX=9606 GN=SMC3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28.0	null	1134-UNIMOD:385,1134-UNIMOD:4	0.02	28.0	3	1	0
PRT	sp|O14976|GAK_HUMAN	Cyclin-G-associated kinase OS=Homo sapiens OX=9606 GN=GAK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28.0	null	2-UNIMOD:1	0.02	28.0	1	1	1
PRT	sp|P43686|PRS6B_HUMAN	26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null		0.08	28.0	1	1	0
PRT	sp|P78347|GTF2I_HUMAN	General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28.0	null		0.03	28.0	3	1	0
PRT	sp|Q01658|NC2B_HUMAN	Protein Dr1 OS=Homo sapiens OX=9606 GN=DR1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null		0.14	27.0	4	1	0
PRT	sp|P48163-2|MAOX_HUMAN	Isoform 2 of NADP-dependent malic enzyme OS=Homo sapiens OX=9606 GN=ME1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q8NF37|PCAT1_HUMAN	Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	4	1	0
PRT	sp|Q7L2E3-2|DHX30_HUMAN	Isoform 2 of ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.02	27.0	3	1	0
PRT	sp|O15305-2|PMM2_HUMAN	Isoform 2 of Phosphomannomutase 2 OS=Homo sapiens OX=9606 GN=PMM2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	103-UNIMOD:4	0.22	27.0	2	1	0
PRT	sp|Q8IUR7-2|ARMC8_HUMAN	Isoform 2 of Armadillo repeat-containing protein 8 OS=Homo sapiens OX=9606 GN=ARMC8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	90-UNIMOD:4	0.06	27.0	5	2	1
PRT	sp|Q9P0J7|KCMF1_HUMAN	E3 ubiquitin-protein ligase KCMF1 OS=Homo sapiens OX=9606 GN=KCMF1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.05	27.0	3	1	0
PRT	sp|Q9UIA9|XPO7_HUMAN	Exportin-7 OS=Homo sapiens OX=9606 GN=XPO7 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	194-UNIMOD:4	0.02	27.0	2	1	0
PRT	sp|Q8N1G4|LRC47_HUMAN	Leucine-rich repeat-containing protein 47 OS=Homo sapiens OX=9606 GN=LRRC47 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	27.0	null	164-UNIMOD:4,190-UNIMOD:4	0.07	27.0	9	1	0
PRT	sp|Q14160-2|SCRIB_HUMAN	Isoform 2 of Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.02	27.0	2	1	0
PRT	sp|P07942|LAMB1_HUMAN	Laminin subunit beta-1 OS=Homo sapiens OX=9606 GN=LAMB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.01	27.0	1	1	1
PRT	sp|Q16836-2|HCDH_HUMAN	Isoform 2 of Hydroxyacyl-coenzyme A dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=HADH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.08	27.0	1	1	1
PRT	sp|Q8IY67-2|RAVR1_HUMAN	Isoform 2 of Ribonucleoprotein PTB-binding 1 OS=Homo sapiens OX=9606 GN=RAVER1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|P14866-2|HNRPL_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	82-UNIMOD:4,85-UNIMOD:4	0.08	27.0	2	1	0
PRT	sp|Q8NC51-2|PAIRB_HUMAN	Isoform 2 of Plasminogen activator inhibitor 1 RNA-binding protein OS=Homo sapiens OX=9606 GN=SERBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.04	27.0	6	1	0
PRT	sp|Q15042-3|RB3GP_HUMAN	Isoform 2 of Rab3 GTPase-activating protein catalytic subunit OS=Homo sapiens OX=9606 GN=RAB3GAP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null	322-UNIMOD:4	0.02	27.0	2	1	0
PRT	sp|Q9UDR5|AASS_HUMAN	Alpha-aminoadipic semialdehyde synthase, mitochondrial OS=Homo sapiens OX=9606 GN=AASS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	27.0	null	547-UNIMOD:28	0.07	27.0	5	3	2
PRT	sp|Q96SK2-2|TM209_HUMAN	Isoform 2 of Transmembrane protein 209 OS=Homo sapiens OX=9606 GN=TMEM209	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27.0	null		0.05	27.0	2	1	0
PRT	sp|P22314|UBA1_HUMAN	Ubiquitin-like modifier-activating enzyme 1 OS=Homo sapiens OX=9606 GN=UBA1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.05	27.0	7	3	0
PRT	sp|P31939|PUR9_HUMAN	Bifunctional purine biosynthesis protein PURH OS=Homo sapiens OX=9606 GN=ATIC PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	241-UNIMOD:4	0.05	27.0	3	1	0
PRT	sp|P27824|CALX_HUMAN	Calnexin OS=Homo sapiens OX=9606 GN=CANX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	27.0	null		0.07	27.0	2	1	0
PRT	sp|Q92820|GGH_HUMAN	Gamma-glutamyl hydrolase OS=Homo sapiens OX=9606 GN=GGH PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	27.0	null		0.08	27.0	2	1	0
PRT	sp|P13861|KAP2_HUMAN	cAMP-dependent protein kinase type II-alpha regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null		0.04	27.0	1	1	1
PRT	sp|Q8IWA0|WDR75_HUMAN	WD repeat-containing protein 75 OS=Homo sapiens OX=9606 GN=WDR75 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27.0	null	683-UNIMOD:28	0.02	27.0	1	1	1
PRT	sp|Q9P0M6|H2AW_HUMAN	Core histone macro-H2A.2 OS=Homo sapiens OX=9606 GN=H2AFY2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27.0	null	49-UNIMOD:35	0.08	27.0	1	1	1
PRT	sp|Q9H900-2|ZWILC_HUMAN	Isoform 2 of Protein zwilch homolog OS=Homo sapiens OX=9606 GN=ZWILCH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	2	1	0
PRT	sp|Q96G03|PGM2_HUMAN	Phosphoglucomutase-2 OS=Homo sapiens OX=9606 GN=PGM2 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.06	26.0	2	1	0
PRT	sp|Q8TDD1-2|DDX54_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX54 OS=Homo sapiens OX=9606 GN=DDX54	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	3	1	0
PRT	sp|Q9P2B4|CT2NL_HUMAN	CTTNBP2 N-terminal-like protein OS=Homo sapiens OX=9606 GN=CTTNBP2NL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|P06400|RB_HUMAN	Retinoblastoma-associated protein OS=Homo sapiens OX=9606 GN=RB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	1	1	1
PRT	sp|Q96T60-2|PNKP_HUMAN	Isoform 2 of Bifunctional polynucleotide phosphatase/kinase OS=Homo sapiens OX=9606 GN=PNKP	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.09	26.0	3	2	1
PRT	sp|O95071-2|UBR5_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens OX=9606 GN=UBR5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.01	26.0	2	1	0
PRT	sp|Q7Z7C8-2|TAF8_HUMAN	Isoform 2 of Transcription initiation factor TFIID subunit 8 OS=Homo sapiens OX=9606 GN=TAF8	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.06	26.0	1	1	1
PRT	sp|P62258-2|1433E_HUMAN	Isoform SV of 14-3-3 protein epsilon OS=Homo sapiens OX=9606 GN=YWHAE	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.09	26.0	3	1	0
PRT	sp|Q9NVI1-1|FANCI_HUMAN	Isoform 1 of Fanconi anemia group I protein OS=Homo sapiens OX=9606 GN=FANCI	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null		0.03	26.0	2	2	2
PRT	sp|P09960-2|LKHA4_HUMAN	Isoform 2 of Leukotriene A-4 hydrolase OS=Homo sapiens OX=9606 GN=LTA4H	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26.0	null	200-UNIMOD:4	0.04	26.0	1	1	1
PRT	sp|Q15392|DHC24_HUMAN	Delta(24)-sterol reductase OS=Homo sapiens OX=9606 GN=DHCR24 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26.0	null	393-UNIMOD:385,393-UNIMOD:4,413-UNIMOD:4	0.07	26.0	3	1	0
PRT	sp|P56192|SYMC_HUMAN	Methionine--tRNA ligase, cytoplasmic OS=Homo sapiens OX=9606 GN=MARS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26.0	null	287-UNIMOD:4	0.04	26.0	1	1	0
PRT	sp|P21399|ACOC_HUMAN	Cytoplasmic aconitate hydratase OS=Homo sapiens OX=9606 GN=ACO1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	26.0	null		0.02	26.0	5	1	0
PRT	sp|P62736|ACTA_HUMAN	Actin, aortic smooth muscle OS=Homo sapiens OX=9606 GN=ACTA2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	26.0	null	121-UNIMOD:35	0.08	26.0	2	1	0
PRT	sp|Q5JWF2-2|GNAS1_HUMAN	Isoform XLas-2 of Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas OS=Homo sapiens OX=9606 GN=GNAS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	2	1	0
PRT	sp|Q86V81|THOC4_HUMAN	THO complex subunit 4 OS=Homo sapiens OX=9606 GN=ALYREF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.11	25.0	1	1	1
PRT	sp|Q6PKG0-3|LARP1_HUMAN	Isoform 2 of La-related protein 1 OS=Homo sapiens OX=9606 GN=LARP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.02	25.0	2	1	0
PRT	sp|Q99538|LGMN_HUMAN	Legumain OS=Homo sapiens OX=9606 GN=LGMN PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.05	25.0	1	1	1
PRT	sp|Q96EY7-2|PTCD3_HUMAN	Isoform 2 of Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	169-UNIMOD:4	0.08	25.0	1	1	0
PRT	sp|Q9BTY7|HGH1_HUMAN	Protein HGH1 homolog OS=Homo sapiens OX=9606 GN=HGH1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|P49756|RBM25_HUMAN	RNA-binding protein 25 OS=Homo sapiens OX=9606 GN=RBM25 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	25.0	null		0.03	25.0	3	1	0
PRT	sp|Q32P41|TRM5_HUMAN	tRNA (guanine(37)-N1)-methyltransferase OS=Homo sapiens OX=9606 GN=TRMT5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.06	25.0	1	1	1
PRT	sp|O96013-2|PAK4_HUMAN	Isoform 2 of Serine/threonine-protein kinase PAK 4 OS=Homo sapiens OX=9606 GN=PAK4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	256-UNIMOD:4	0.07	25.0	2	1	0
PRT	sp|Q8NCN5|PDPR_HUMAN	Pyruvate dehydrogenase phosphatase regulatory subunit, mitochondrial OS=Homo sapiens OX=9606 GN=PDPR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null		0.03	25.0	3	1	0
PRT	sp|O15118|NPC1_HUMAN	NPC intracellular cholesterol transporter 1 OS=Homo sapiens OX=9606 GN=NPC1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25.0	null	97-UNIMOD:4,100-UNIMOD:4,109-UNIMOD:4,113-UNIMOD:4	0.02	25.0	2	1	0
PRT	sp|Q00610|CLH1_HUMAN	Clathrin heavy chain 1 OS=Homo sapiens OX=9606 GN=CLTC PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1000663, ProteinPilot, ]	25.0	null	328-UNIMOD:4	0.02	25.0	2	1	0
PRT	sp|P30049|ATPD_HUMAN	ATP synthase subunit delta, mitochondrial OS=Homo sapiens OX=9606 GN=ATP5F1D PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	57-UNIMOD:28	0.24	25.0	4	1	0
PRT	sp|P35637|FUS_HUMAN	RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25.0	null		0.06	25.0	1	1	0
PRT	sp|O14653|GOSR2_HUMAN	Golgi SNAP receptor complex member 2 OS=Homo sapiens OX=9606 GN=GOSR2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25.0	null	28-UNIMOD:28	0.10	25.0	1	1	1
PRT	sp|Q9C0K3|ARP3C_HUMAN	Actin-related protein 3C OS=Homo sapiens OX=9606 GN=ACTR3C PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.06	24.0	3	1	0
PRT	sp|Q9Y3T9|NOC2L_HUMAN	Nucleolar complex protein 2 homolog OS=Homo sapiens OX=9606 GN=NOC2L PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	442-UNIMOD:4	0.04	24.0	4	1	0
PRT	sp|P54619-2|AAKG1_HUMAN	Isoform 2 of 5'-AMP-activated protein kinase subunit gamma-1 OS=Homo sapiens OX=9606 GN=PRKAG1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.07	24.0	2	1	0
PRT	sp|Q8NI27|THOC2_HUMAN	THO complex subunit 2 OS=Homo sapiens OX=9606 GN=THOC2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.01	24.0	1	1	1
PRT	sp|Q15392-2|DHC24_HUMAN	Isoform 2 of Delta(24)-sterol reductase OS=Homo sapiens OX=9606 GN=DHCR24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.04	24.0	2	1	0
PRT	sp|Q9UNX4|WDR3_HUMAN	WD repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=WDR3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	2	1	0
PRT	sp|O60716-10|CTND1_HUMAN	Isoform 2AB of Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	1	1	0
PRT	sp|P82932|RT06_HUMAN	28S ribosomal protein S6, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS6 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.20	24.0	2	1	0
PRT	sp|Q7KZF4|SND1_HUMAN	Staphylococcal nuclease domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SND1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.02	24.0	1	1	1
PRT	sp|P62312|LSM6_HUMAN	U6 snRNA-associated Sm-like protein LSm6 OS=Homo sapiens OX=9606 GN=LSM6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	36-UNIMOD:4	0.34	24.0	1	1	1
PRT	sp|Q01105-2|SET_HUMAN	Isoform 2 of Protein SET OS=Homo sapiens OX=9606 GN=SET	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.11	24.0	2	1	0
PRT	sp|Q15021|CND1_HUMAN	Condensin complex subunit 1 OS=Homo sapiens OX=9606 GN=NCAPD2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	439-UNIMOD:4	0.01	24.0	1	1	1
PRT	sp|P63010-2|AP2B1_HUMAN	Isoform 2 of AP-2 complex subunit beta OS=Homo sapiens OX=9606 GN=AP2B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	832-UNIMOD:4	0.03	24.0	1	1	1
PRT	sp|O00299|CLIC1_HUMAN	Chloride intracellular channel protein 1 OS=Homo sapiens OX=9606 GN=CLIC1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null	59-UNIMOD:4,89-UNIMOD:4	0.15	24.0	1	1	1
PRT	sp|Q92974-2|ARHG2_HUMAN	Isoform 2 of Rho guanine nucleotide exchange factor 2 OS=Homo sapiens OX=9606 GN=ARHGEF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	2	1	0
PRT	sp|P07900|HS90A_HUMAN	Heat shock protein HSP 90-alpha OS=Homo sapiens OX=9606 GN=HSP90AA1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	420-UNIMOD:385,420-UNIMOD:4	0.02	24.0	43	1	0
PRT	sp|P46940|IQGA1_HUMAN	Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens OX=9606 GN=IQGAP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	24.0	null		0.03	24.0	5	2	1
PRT	sp|Q15084|PDIA6_HUMAN	Protein disulfide-isomerase A6 OS=Homo sapiens OX=9606 GN=PDIA6 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.06	24.0	6	1	0
PRT	sp|Q5SRE5|NU188_HUMAN	Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	1685-UNIMOD:28	0.01	24.0	2	1	0
PRT	sp|Q9Y224|RTRAF_HUMAN	RNA transcription, translation and transport factor protein OS=Homo sapiens OX=9606 GN=RTRAF PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24.0	null	77-UNIMOD:28	0.06	24.0	1	1	1
PRT	sp|P36955|PEDF_HUMAN	Pigment epithelium-derived factor OS=Homo sapiens OX=9606 GN=SERPINF1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24.0	null		0.07	24.0	1	1	1
PRT	sp|P49643|PRI2_HUMAN	DNA primase large subunit OS=Homo sapiens OX=9606 GN=PRIM2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q96F86|EDC3_HUMAN	Enhancer of mRNA-decapping protein 3 OS=Homo sapiens OX=9606 GN=EDC3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	23.0	null	410-UNIMOD:4,413-UNIMOD:4	0.05	23.0	2	1	0
PRT	sp|P78347-2|GTF2I_HUMAN	Isoform 2 of General transcription factor II-I OS=Homo sapiens OX=9606 GN=GTF2I	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	4	1	0
PRT	sp|Q8N8S7-2|ENAH_HUMAN	Isoform 2 of Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|P46379-2|BAG6_HUMAN	Isoform 2 of Large proline-rich protein BAG6 OS=Homo sapiens OX=9606 GN=BAG6	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	4	1	0
PRT	sp|Q9UI12-2|VATH_HUMAN	Isoform 2 of V-type proton ATPase subunit H OS=Homo sapiens OX=9606 GN=ATP6V1H	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	1	1	1
PRT	sp|Q96KR1|ZFR_HUMAN	Zinc finger RNA-binding protein OS=Homo sapiens OX=9606 GN=ZFR PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	2	1	0
PRT	sp|Q13574-2|DGKZ_HUMAN	Isoform 2 of Diacylglycerol kinase zeta OS=Homo sapiens OX=9606 GN=DGKZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	351-UNIMOD:4	0.02	23.0	1	1	1
PRT	sp|Q9UJ14|GGT7_HUMAN	Glutathione hydrolase 7 OS=Homo sapiens OX=9606 GN=GGT7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	1	1	1
PRT	sp|P40763-2|STAT3_HUMAN	Isoform Del-701 of Signal transducer and activator of transcription 3 OS=Homo sapiens OX=9606 GN=STAT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	251-UNIMOD:4,259-UNIMOD:4	0.04	23.0	1	1	1
PRT	sp|P38919|IF4A3_HUMAN	Eukaryotic initiation factor 4A-III OS=Homo sapiens OX=9606 GN=EIF4A3 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	23.0	null	269-UNIMOD:4,284-UNIMOD:4	0.06	23.0	3	1	0
PRT	sp|Q9Y2D4-2|EXC6B_HUMAN	Isoform 2 of Exocyst complex component 6B OS=Homo sapiens OX=9606 GN=EXOC6B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.03	23.0	2	1	0
PRT	sp|Q52LJ0-2|FA98B_HUMAN	Isoform 2 of Protein FAM98B OS=Homo sapiens OX=9606 GN=FAM98B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null	63-UNIMOD:4	0.07	23.0	1	1	1
PRT	sp|Q00613-2|HSF1_HUMAN	Isoform Short of Heat shock factor protein 1 OS=Homo sapiens OX=9606 GN=HSF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.04	23.0	1	1	1
PRT	sp|Q9Y3I1-2|FBX7_HUMAN	Isoform 2 of F-box only protein 7 OS=Homo sapiens OX=9606 GN=FBXO7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.05	23.0	2	1	0
PRT	sp|Q9UKN8|TF3C4_HUMAN	General transcription factor 3C polypeptide 4 OS=Homo sapiens OX=9606 GN=GTF3C4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23.0	null		0.02	23.0	1	1	1
PRT	sp|Q5T4S7|UBR4_HUMAN	E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens OX=9606 GN=UBR4 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2613-UNIMOD:28,2618-UNIMOD:4,2619-UNIMOD:4,381-UNIMOD:385,381-UNIMOD:4	0.01	23.0	2	2	2
PRT	sp|Q6NXG1|ESRP1_HUMAN	Epithelial splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=ESRP1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.03	23.0	1	1	1
PRT	sp|O75489|NDUS3_HUMAN	NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=NDUFS3 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	57-UNIMOD:28	0.06	23.0	2	1	0
PRT	sp|P36915|GNL1_HUMAN	Guanine nucleotide-binding protein-like 1 OS=Homo sapiens OX=9606 GN=GNL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	424-UNIMOD:28	0.05	23.0	1	1	1
PRT	sp|Q8N668|COMD1_HUMAN	COMM domain-containing protein 1 OS=Homo sapiens OX=9606 GN=COMMD1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	2-UNIMOD:1	0.19	23.0	1	1	1
PRT	sp|O00148|DX39A_HUMAN	ATP-dependent RNA helicase DDX39A OS=Homo sapiens OX=9606 GN=DDX39A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23.0	null	299-UNIMOD:385,299-UNIMOD:4	0.05	23.0	2	1	0
PRT	sp|P61586|RHOA_HUMAN	Transforming protein RhoA OS=Homo sapiens OX=9606 GN=RHOA PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.13	23.0	1	1	1
PRT	sp|O75367|H2AY_HUMAN	Core histone macro-H2A.1 OS=Homo sapiens OX=9606 GN=H2AFY PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null	49-UNIMOD:35	0.08	23.0	2	1	0
PRT	sp|P0DN79|CBSL_HUMAN	Cystathionine beta-synthase-like protein OS=Homo sapiens OX=9606 GN=CBSL PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23.0	null		0.06	23.0	1	1	1
PRT	sp|Q96HW7-2|INT4_HUMAN	Isoform 2 of Integrator complex subunit 4 OS=Homo sapiens OX=9606 GN=INTS4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O43929-2|ORC4_HUMAN	Isoform 2 of Origin recognition complex subunit 4 OS=Homo sapiens OX=9606 GN=ORC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	68-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|P55265-2|DSRAD_HUMAN	Isoform 2 of Double-stranded RNA-specific adenosine deaminase OS=Homo sapiens OX=9606 GN=ADAR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|P26641-2|EF1G_HUMAN	Isoform 2 of Elongation factor 1-gamma OS=Homo sapiens OX=9606 GN=EEF1G	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.08	22.0	1	1	1
PRT	sp|Q14651|PLSI_HUMAN	Plastin-1 OS=Homo sapiens OX=9606 GN=PLS1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.03	22.0	3	1	0
PRT	sp|Q6NXG1-2|ESRP1_HUMAN	Isoform 2 of Epithelial splicing regulatory protein 1 OS=Homo sapiens OX=9606 GN=ESRP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	2	1	0
PRT	sp|Q9BY44-2|EIF2A_HUMAN	Isoform 2 of Eukaryotic translation initiation factor 2A OS=Homo sapiens OX=9606 GN=EIF2A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.07	22.0	2	1	0
PRT	sp|Q66K74-2|MAP1S_HUMAN	Isoform 2 of Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	143-UNIMOD:4	0.04	22.0	2	1	0
PRT	sp|O95373|IPO7_HUMAN	Importin-7 OS=Homo sapiens OX=9606 GN=IPO7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.02	22.0	2	1	0
PRT	sp|Q9H0H0|INT2_HUMAN	Integrator complex subunit 2 OS=Homo sapiens OX=9606 GN=INTS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	582-UNIMOD:4	0.03	22.0	2	1	0
PRT	sp|Q15417-3|CNN3_HUMAN	Isoform 3 of Calponin-3 OS=Homo sapiens OX=9606 GN=CNN3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.11	22.0	1	1	1
PRT	sp|Q969H4-2|CNKR1_HUMAN	Isoform 2 of Connector enhancer of kinase suppressor of ras 1 OS=Homo sapiens OX=9606 GN=CNKSR1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	100-UNIMOD:4,104-UNIMOD:4	0.05	22.0	1	1	1
PRT	sp|Q09028-2|RBBP4_HUMAN	Isoform 2 of Histone-binding protein RBBP4 OS=Homo sapiens OX=9606 GN=RBBP4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.08	22.0	3	1	0
PRT	sp|Q15397|PUM3_HUMAN	Pumilio homolog 3 OS=Homo sapiens OX=9606 GN=PUM3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	508-UNIMOD:4	0.06	22.0	1	1	1
PRT	sp|Q99460-2|PSMD1_HUMAN	Isoform 2 of 26S proteasome non-ATPase regulatory subunit 1 OS=Homo sapiens OX=9606 GN=PSMD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	3	1	0
PRT	sp|P18858|DNLI1_HUMAN	DNA ligase 1 OS=Homo sapiens OX=9606 GN=LIG1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O75390|CISY_HUMAN	Citrate synthase, mitochondrial OS=Homo sapiens OX=9606 GN=CS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ],[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	4	1	0
PRT	sp|O43747-2|AP1G1_HUMAN	Isoform 2 of AP-1 complex subunit gamma-1 OS=Homo sapiens OX=9606 GN=AP1G1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.05	22.0	4	2	1
PRT	sp|Q10567-2|AP1B1_HUMAN	Isoform B of AP-1 complex subunit beta-1 OS=Homo sapiens OX=9606 GN=AP1B1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|P16219|ACADS_HUMAN	Short-chain specific acyl-CoA dehydrogenase, mitochondrial OS=Homo sapiens OX=9606 GN=ACADS PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null	289-UNIMOD:4	0.06	22.0	3	1	0
PRT	sp|Q9NTZ6|RBM12_HUMAN	RNA-binding protein 12 OS=Homo sapiens OX=9606 GN=RBM12 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22.0	null		0.04	22.0	1	1	1
PRT	sp|O43747|AP1G1_HUMAN	AP-1 complex subunit gamma-1 OS=Homo sapiens OX=9606 GN=AP1G1 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.03	22.0	1	1	0
PRT	sp|P57740|NU107_HUMAN	Nuclear pore complex protein Nup107 OS=Homo sapiens OX=9606 GN=NUP107 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22.0	null	265-UNIMOD:28	0.02	22.0	1	1	1
PRT	sp|Q9H936|GHC1_HUMAN	Mitochondrial glutamate carrier 1 OS=Homo sapiens OX=9606 GN=SLC25A22 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22.0	null		0.07	22.0	2	1	0
PRT	sp|P12429|ANXA3_HUMAN	Annexin A3 OS=Homo sapiens OX=9606 GN=ANXA3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	246-UNIMOD:4	0.06	21.0	1	1	1
PRT	sp|Q6ZSZ5-1|ARHGI_HUMAN	Isoform 5 of Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|E9PAV3-2|NACAM_HUMAN	Isoform skNAC-2 of Nascent polypeptide-associated complex subunit alpha, muscle-specific form OS=Homo sapiens OX=9606 GN=NACA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|O60841|IF2P_HUMAN	Eukaryotic translation initiation factor 5B OS=Homo sapiens OX=9606 GN=EIF5B PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	2	1	0
PRT	sp|Q6NUK1-2|SCMC1_HUMAN	Isoform 2 of Calcium-binding mitochondrial carrier protein SCaMC-1 OS=Homo sapiens OX=9606 GN=SLC25A24	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.04	21.0	1	1	1
PRT	sp|Q9Y2X3|NOP58_HUMAN	Nucleolar protein 58 OS=Homo sapiens OX=9606 GN=NOP58 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.03	21.0	3	1	0
PRT	sp|Q92626|PXDN_HUMAN	Peroxidasin homolog OS=Homo sapiens OX=9606 GN=PXDN PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|Q15029-2|U5S1_HUMAN	Isoform 2 of 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens OX=9606 GN=EFTUD2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	1	1	1
PRT	sp|P08708|RS17_HUMAN	40S ribosomal protein S17 OS=Homo sapiens OX=9606 GN=RPS17 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.17	21.0	6	1	0
PRT	sp|Q9BXJ9-4|NAA15_HUMAN	Isoform 2 of N-alpha-acetyltransferase 15, NatA auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA15	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|Q8NBU5-2|ATAD1_HUMAN	Isoform 2 of ATPase family AAA domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ATAD1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.06	21.0	1	1	1
PRT	sp|O75691|UTP20_HUMAN	Small subunit processome component 20 homolog OS=Homo sapiens OX=9606 GN=UTP20 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.01	21.0	1	1	1
PRT	sp|Q9NUU7-2|DD19A_HUMAN	Isoform 2 of ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	234-UNIMOD:4,249-UNIMOD:4	0.06	21.0	2	1	0
PRT	sp|P42285|MTREX_HUMAN	Exosome RNA helicase MTR4 OS=Homo sapiens OX=9606 GN=MTREX PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null		0.02	21.0	2	1	0
PRT	sp|O14578-2|CTRO_HUMAN	Isoform 2 of Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21.0	null	343-UNIMOD:4	0.04	21.0	2	1	0
PRT	sp|P45974|UBP5_HUMAN	Ubiquitin carboxyl-terminal hydrolase 5 OS=Homo sapiens OX=9606 GN=USP5 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	433-UNIMOD:28	0.02	21.0	1	1	1
PRT	sp|O60716|CTND1_HUMAN	Catenin delta-1 OS=Homo sapiens OX=9606 GN=CTNND1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ],[MS, MS:1002251, Comet, ]	21.0	null	365-UNIMOD:28	0.04	21.0	2	2	1
PRT	sp|P31946|1433B_HUMAN	14-3-3 protein beta/alpha OS=Homo sapiens OX=9606 GN=YWHAB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.09	21.0	2	1	0
PRT	sp|Q13428|TCOF_HUMAN	Treacle protein OS=Homo sapiens OX=9606 GN=TCOF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	38-UNIMOD:385,38-UNIMOD:4	0.02	21.0	1	1	1
PRT	sp|P61204|ARF3_HUMAN	ADP-ribosylation factor 3 OS=Homo sapiens OX=9606 GN=ARF3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null	159-UNIMOD:4	0.15	21.0	1	1	0
PRT	sp|P14618-2|KPYM_HUMAN	Isoform M1 of Pyruvate kinase PKM OS=Homo sapiens OX=9606 GN=PKM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21.0	null	423-UNIMOD:385,423-UNIMOD:4	0.03	21.0	1	1	1
PRT	sp|Q16576|RBBP7_HUMAN	Histone-binding protein RBBP7 OS=Homo sapiens OX=9606 GN=RBBP7 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21.0	null		0.08	21.0	1	1	1
PRT	sp|Q8N3U4|STAG2_HUMAN	Cohesin subunit SA-2 OS=Homo sapiens OX=9606 GN=STAG2 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q12768|WASC5_HUMAN	WASH complex subunit 5 OS=Homo sapiens OX=9606 GN=WASHC5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	3	1	0
PRT	sp|Q14694-2|UBP10_HUMAN	Isoform 2 of Ubiquitin carboxyl-terminal hydrolase 10 OS=Homo sapiens OX=9606 GN=USP10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9UBD5-2|ORC3_HUMAN	Isoform 2 of Origin recognition complex subunit 3 OS=Homo sapiens OX=9606 GN=ORC3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.02	20.0	3	1	0
PRT	sp|Q9UPY3-2|DICER_HUMAN	Isoform 2 of Endoribonuclease Dicer OS=Homo sapiens OX=9606 GN=DICER1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	1562-UNIMOD:4,1569-UNIMOD:4,1574-UNIMOD:4	0.01	20.0	1	1	1
PRT	sp|O43707-2|ACTN4_HUMAN	Isoform ACTN4ISO of Alpha-actinin-4 OS=Homo sapiens OX=9606 GN=ACTN4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	1	1	1
PRT	sp|Q9NTI5|PDS5B_HUMAN	Sister chromatid cohesion protein PDS5 homolog B OS=Homo sapiens OX=9606 GN=PDS5B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20.0	null		0.02	20.0	1	1	0
PRT	sp|Q96N64|PWP2A_HUMAN	PWWP domain-containing protein 2A OS=Homo sapiens OX=9606 GN=PWWP2A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.04	20.0	2	1	0
PRT	sp|Q14980-2|NUMA1_HUMAN	Isoform 2 of Nuclear mitotic apparatus protein 1 OS=Homo sapiens OX=9606 GN=NUMA1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null	33-UNIMOD:4	0.02	20.0	2	1	0
PRT	sp|P35637-2|FUS_HUMAN	Isoform Short of RNA-binding protein FUS OS=Homo sapiens OX=9606 GN=FUS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.06	20.0	1	1	0
PRT	sp|Q9HCJ6|VAT1L_HUMAN	Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens OX=9606 GN=VAT1L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q9Y2Z4|SYYM_HUMAN	Tyrosine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=YARS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	78-UNIMOD:4	0.08	20.0	1	1	1
PRT	sp|O94874|UFL1_HUMAN	E3 UFM1-protein ligase 1 OS=Homo sapiens OX=9606 GN=UFL1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.03	20.0	1	1	1
PRT	sp|Q8NFU3|TSTD1_HUMAN	Thiosulfate:glutathione sulfurtransferase OS=Homo sapiens OX=9606 GN=TSTD1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.36	20.0	1	1	0
PRT	sp|Q14974|IMB1_HUMAN	Importin subunit beta-1 OS=Homo sapiens OX=9606 GN=KPNB1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null	689-UNIMOD:4,693-UNIMOD:35	0.03	20.0	1	1	0
PRT	sp|Q13885|TBB2A_HUMAN	Tubulin beta-2A chain OS=Homo sapiens OX=9606 GN=TUBB2A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20.0	null		0.04	20.0	1	1	0
PRT	sp|Q9H4Z3|PCIF1_HUMAN	Phosphorylated CTD-interacting factor 1 OS=Homo sapiens OX=9606 GN=PCIF1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P63104-2|1433Z_HUMAN	Isoform 2 of 14-3-3 protein zeta/delta OS=Homo sapiens OX=9606 GN=YWHAZ	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.12	19.0	3	1	0
PRT	sp|Q6P2I3|FAH2B_HUMAN	Fumarylacetoacetate hydrolase domain-containing protein 2B OS=Homo sapiens OX=9606 GN=FAHD2B PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.08	19.0	2	1	0
PRT	sp|Q8NFV4-2|ABHDB_HUMAN	Isoform 2 of Protein ABHD11 OS=Homo sapiens OX=9606 GN=ABHD11	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.22	19.0	1	1	1
PRT	sp|Q04917|1433F_HUMAN	14-3-3 protein eta OS=Homo sapiens OX=9606 GN=YWHAH PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	194-UNIMOD:4	0.11	19.0	2	1	0
PRT	sp|Q9UKG1|DP13A_HUMAN	DCC-interacting protein 13-alpha OS=Homo sapiens OX=9606 GN=APPL1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.04	19.0	2	1	0
PRT	sp|Q9P2D3-3|HTR5B_HUMAN	Isoform 3 of HEAT repeat-containing protein 5B OS=Homo sapiens OX=9606 GN=HEATR5B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|P31942-2|HNRH3_HUMAN	Isoform 2 of Heterogeneous nuclear ribonucleoprotein H3 OS=Homo sapiens OX=9606 GN=HNRNPH3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	27-UNIMOD:4	0.11	19.0	1	1	1
PRT	sp|Q8IYD1|ERF3B_HUMAN	Eukaryotic peptide chain release factor GTP-binding subunit ERF3B OS=Homo sapiens OX=9606 GN=GSPT2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	405-UNIMOD:4	0.04	19.0	3	1	0
PRT	sp|Q9HBF4-2|ZFYV1_HUMAN	Isoform 2 of Zinc finger FYVE domain-containing protein 1 OS=Homo sapiens OX=9606 GN=ZFYVE1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.07	19.0	1	1	1
PRT	sp|Q6ZN55-2|ZN574_HUMAN	Isoform 2 of Zinc finger protein 574 OS=Homo sapiens OX=9606 GN=ZNF574	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.03	19.0	1	1	1
PRT	sp|P04075-2|ALDOA_HUMAN	Isoform 2 of Fructose-bisphosphate aldolase A OS=Homo sapiens OX=9606 GN=ALDOA	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.07	19.0	2	1	0
PRT	sp|Q9UPU5|UBP24_HUMAN	Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens OX=9606 GN=USP24 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.01	19.0	1	1	1
PRT	sp|Q14697-2|GANAB_HUMAN	Isoform 2 of Neutral alpha-glucosidase AB OS=Homo sapiens OX=9606 GN=GANAB	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	655-UNIMOD:4,666-UNIMOD:4	0.03	19.0	1	1	1
PRT	sp|P43686-2|PRS6B_HUMAN	Isoform 2 of 26S proteasome regulatory subunit 6B OS=Homo sapiens OX=9606 GN=PSMC4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.09	19.0	2	1	0
PRT	sp|P47897-2|SYQ_HUMAN	Isoform 2 of Glutamine--tRNA ligase OS=Homo sapiens OX=9606 GN=QARS	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	719-UNIMOD:4	0.05	19.0	1	1	1
PRT	sp|Q9NTG7-2|SIR3_HUMAN	Isoform 2 of NAD-dependent protein deacetylase sirtuin-3, mitochondrial OS=Homo sapiens OX=9606 GN=SIRT3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null		0.13	19.0	1	1	1
PRT	sp|Q9UJQ4-2|SALL4_HUMAN	Isoform SALL4B of Sal-like protein 4 OS=Homo sapiens OX=9606 GN=SALL4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19.0	null	220-UNIMOD:4	0.07	19.0	1	1	1
PRT	sp|Q9BSJ8|ESYT1_HUMAN	Extended synaptotagmin-1 OS=Homo sapiens OX=9606 GN=ESYT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|P40925|MDHC_HUMAN	Malate dehydrogenase, cytoplasmic OS=Homo sapiens OX=9606 GN=MDH1 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.08	19.0	1	1	0
PRT	sp|Q14160|SCRIB_HUMAN	Protein scribble homolog OS=Homo sapiens OX=9606 GN=SCRIB PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null		0.02	19.0	1	1	0
PRT	sp|O15397|IPO8_HUMAN	Importin-8 OS=Homo sapiens OX=9606 GN=IPO8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	757-UNIMOD:4	0.02	19.0	2	1	0
PRT	sp|Q7Z2T5|TRM1L_HUMAN	TRMT1-like protein OS=Homo sapiens OX=9606 GN=TRMT1L PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19.0	null	261-UNIMOD:28,265-UNIMOD:4	0.02	19.0	1	1	1
PRT	sp|Q9NUU7|DD19A_HUMAN	ATP-dependent RNA helicase DDX19A OS=Homo sapiens OX=9606 GN=DDX19A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19.0	null	324-UNIMOD:4,339-UNIMOD:4	0.05	19.0	1	1	0
PRT	sp|Q8TBC3-2|SHKB1_HUMAN	Isoform 2 of SH3KBP1-binding protein 1 OS=Homo sapiens OX=9606 GN=SHKBP1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.08	18.0	1	1	1
PRT	sp|Q6P3W7|SCYL2_HUMAN	SCY1-like protein 2 OS=Homo sapiens OX=9606 GN=SCYL2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q6UWE0-2|LRSM1_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase LRSAM1 OS=Homo sapiens OX=9606 GN=LRSAM1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|O75427|LRCH4_HUMAN	Leucine-rich repeat and calponin homology domain-containing protein 4 OS=Homo sapiens OX=9606 GN=LRCH4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null	571-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q96C90|PP14B_HUMAN	Protein phosphatase 1 regulatory subunit 14B OS=Homo sapiens OX=9606 GN=PPP1R14B PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.10	18.0	1	1	1
PRT	sp|P17858-2|PFKAL_HUMAN	Isoform 2 of ATP-dependent 6-phosphofructokinase, liver type OS=Homo sapiens OX=9606 GN=PFKL	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.03	18.0	2	1	0
PRT	sp|Q9Y5J1|UTP18_HUMAN	U3 small nucleolar RNA-associated protein 18 homolog OS=Homo sapiens OX=9606 GN=UTP18 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|Q9H2U1-2|DHX36_HUMAN	Isoform 2 of ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null	963-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|Q9UKZ1|CNO11_HUMAN	CCR4-NOT transcription complex subunit 11 OS=Homo sapiens OX=9606 GN=CNOT11 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.06	18.0	1	1	1
PRT	sp|Q8NEY8-3|PPHLN_HUMAN	Isoform 3 of Periphilin-1 OS=Homo sapiens OX=9606 GN=PPHLN1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null	422-UNIMOD:4	0.06	18.0	1	1	1
PRT	sp|O14782|KIF3C_HUMAN	Kinesin-like protein KIF3C OS=Homo sapiens OX=9606 GN=KIF3C PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.03	18.0	1	1	1
PRT	sp|P24928|RPB1_HUMAN	DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens OX=9606 GN=POLR2A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.01	18.0	1	1	1
PRT	sp|P00390-2|GSHR_HUMAN	Isoform Cytoplasmic of Glutathione reductase, mitochondrial OS=Homo sapiens OX=9606 GN=GSR	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null	285-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|Q9Y4E1|WAC2C_HUMAN	WASH complex subunit 2C OS=Homo sapiens OX=9606 GN=WASHC2C PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	18.0	null		0.02	18.0	1	1	1
PRT	sp|Q03001|DYST_HUMAN	Dystonin OS=Homo sapiens OX=9606 GN=DST PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.00	18.0	1	1	1
PRT	sp|P05556-2|ITB1_HUMAN	Isoform 2 of Integrin beta-1 OS=Homo sapiens OX=9606 GN=ITGB1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null	462-UNIMOD:4,464-UNIMOD:4,466-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|O75431-2|MTX2_HUMAN	Isoform 2 of Metaxin-2 OS=Homo sapiens OX=9606 GN=MTX2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.12	18.0	1	1	1
PRT	sp|Q5SQI0-3|ATAT_HUMAN	Isoform 3 of Alpha-tubulin N-acetyltransferase 1 OS=Homo sapiens OX=9606 GN=ATAT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null		0.04	18.0	1	1	1
PRT	sp|Q9NSE4|SYIM_HUMAN	Isoleucine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=IARS2 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null	364-UNIMOD:4	0.04	18.0	1	1	1
PRT	sp|P61201-2|CSN2_HUMAN	Isoform 2 of COP9 signalosome complex subunit 2 OS=Homo sapiens OX=9606 GN=COPS2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18.0	null	399-UNIMOD:4	0.06	18.0	1	1	1
PRT	sp|P55060|XPO2_HUMAN	Exportin-2 OS=Homo sapiens OX=9606 GN=CSE1L PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18.0	null	769-UNIMOD:28	0.01	18.0	1	1	1
PRT	sp|Q66K74|MAP1S_HUMAN	Microtubule-associated protein 1S OS=Homo sapiens OX=9606 GN=MAP1S PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null	169-UNIMOD:4	0.04	18.0	1	1	0
PRT	sp|Q12849|GRSF1_HUMAN	G-rich sequence factor 1 OS=Homo sapiens OX=9606 GN=GRSF1 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ],[MS, MS:1001207, Mascot, ]	18.0	null	161-UNIMOD:4,173-UNIMOD:4	0.05	18.0	2	1	0
PRT	sp|P54725|RD23A_HUMAN	UV excision repair protein RAD23 homolog A OS=Homo sapiens OX=9606 GN=RAD23A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18.0	null	246-UNIMOD:28	0.09	18.0	1	1	1
PRT	sp|O75391|SPAG7_HUMAN	Sperm-associated antigen 7 OS=Homo sapiens OX=9606 GN=SPAG7 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18.0	null	2-UNIMOD:1	0.11	18.0	1	1	1
PRT	sp|A4D0V7|CPED1_HUMAN	Cadherin-like and PC-esterase domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CPED1 PE=2 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18.0	null	173-UNIMOD:4	0.01	18.0	1	1	1
PRT	sp|P14866|HNRPL_HUMAN	Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens OX=9606 GN=HNRNPL PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18.0	null		0.05	18.0	1	1	1
PRT	sp|P13489|RINI_HUMAN	Ribonuclease inhibitor OS=Homo sapiens OX=9606 GN=RNH1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	17.0	null	134-UNIMOD:4,142-UNIMOD:4	0.07	17.0	1	1	1
PRT	sp|Q14CX7-2|NAA25_HUMAN	Isoform 2 of N-alpha-acetyltransferase 25, NatB auxiliary subunit OS=Homo sapiens OX=9606 GN=NAA25	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.03	17.0	2	1	0
PRT	sp|Q14669-2|TRIPC_HUMAN	Isoform 2 of E3 ubiquitin-protein ligase TRIP12 OS=Homo sapiens OX=9606 GN=TRIP12	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null	1900-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|P52597|HNRPF_HUMAN	Heterogeneous nuclear ribonucleoprotein F OS=Homo sapiens OX=9606 GN=HNRNPF PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null	122-UNIMOD:4	0.08	17.0	1	1	1
PRT	sp|Q8IUR0|TPPC5_HUMAN	Trafficking protein particle complex subunit 5 OS=Homo sapiens OX=9606 GN=TRAPPC5 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null	40-UNIMOD:4	0.12	17.0	1	1	1
PRT	sp|Q96CS2-2|HAUS1_HUMAN	Isoform 2 of HAUS augmin-like complex subunit 1 OS=Homo sapiens OX=9606 GN=HAUS1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|Q9NRR5|UBQL4_HUMAN	Ubiquilin-4 OS=Homo sapiens OX=9606 GN=UBQLN4 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.06	17.0	1	1	1
PRT	sp|P34932|HSP74_HUMAN	Heat shock 70 kDa protein 4 OS=Homo sapiens OX=9606 GN=HSPA4 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.04	17.0	1	1	1
PRT	sp|P51946|CCNH_HUMAN	Cyclin-H OS=Homo sapiens OX=9606 GN=CCNH PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|P06733|ENOA_HUMAN	Alpha-enolase OS=Homo sapiens OX=9606 GN=ENO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	389-UNIMOD:4	0.10	17.0	2	2	0
PRT	sp|Q9NP92|RT30_HUMAN	39S ribosomal protein S30, mitochondrial OS=Homo sapiens OX=9606 GN=MRPS30 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.05	17.0	1	1	1
PRT	sp|Q99873-2|ANM1_HUMAN	Isoform 2 of Protein arginine N-methyltransferase 1 OS=Homo sapiens OX=9606 GN=PRMT1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|Q9UKR5|ERG28_HUMAN	Probable ergosterol biosynthetic protein 28 OS=Homo sapiens OX=9606 GN=ERG28 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.10	17.0	1	1	1
PRT	sp|Q92879-2|CELF1_HUMAN	Isoform 2 of CUGBP Elav-like family member 1 OS=Homo sapiens OX=9606 GN=CELF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.08	17.0	1	1	1
PRT	sp|P62745|RHOB_HUMAN	Rho-related GTP-binding protein RhoB OS=Homo sapiens OX=9606 GN=RHOB PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null		0.13	17.0	1	1	1
PRT	sp|Q99687-2|MEIS3_HUMAN	Isoform 2 of Homeobox protein Meis3 OS=Homo sapiens OX=9606 GN=MEIS3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null	298-UNIMOD:4	0.05	17.0	2	1	0
PRT	sp|Q13972-3|RGRF1_HUMAN	Isoform 3 of Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens OX=9606 GN=RASGRF1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17.0	null	447-UNIMOD:4,468-UNIMOD:35	0.02	17.0	1	1	1
PRT	sp|P05166|PCCB_HUMAN	Propionyl-CoA carboxylase beta chain, mitochondrial OS=Homo sapiens OX=9606 GN=PCCB PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	381-UNIMOD:4	0.06	17.0	1	1	0
PRT	sp|P51948|MAT1_HUMAN	CDK-activating kinase assembly factor MAT1 OS=Homo sapiens OX=9606 GN=MNAT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17.0	null	181-UNIMOD:28	0.07	17.0	1	1	1
PRT	sp|P37268|FDFT_HUMAN	Squalene synthase OS=Homo sapiens OX=9606 GN=FDFT1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	289-UNIMOD:4,303-UNIMOD:4	0.07	17.0	1	1	1
PRT	sp|Q9BTW9|TBCD_HUMAN	Tubulin-specific chaperone D OS=Homo sapiens OX=9606 GN=TBCD PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17.0	null	773-UNIMOD:385,773-UNIMOD:4	0.01	17.0	1	1	1
PRT	sp|Q9Y4E8|UBP15_HUMAN	Ubiquitin carboxyl-terminal hydrolase 15 OS=Homo sapiens OX=9606 GN=USP15 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	381-UNIMOD:4	0.03	17.0	1	1	1
PRT	sp|P51692|STA5B_HUMAN	Signal transducer and activator of transcription 5B OS=Homo sapiens OX=9606 GN=STAT5B PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17.0	null	2-UNIMOD:1	0.04	17.0	1	1	1
PRT	sp|Q9Y5K5|UCHL5_HUMAN	Ubiquitin carboxyl-terminal hydrolase isozyme L5 OS=Homo sapiens OX=9606 GN=UCHL5 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17.0	null	82-UNIMOD:28,88-UNIMOD:4,100-UNIMOD:4	0.11	17.0	1	1	1
PRT	sp|Q8N474|SFRP1_HUMAN	Secreted frizzled-related protein 1 OS=Homo sapiens OX=9606 GN=SFRP1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	140-UNIMOD:4	0.06	17.0	1	1	1
PRT	sp|P33991|MCM4_HUMAN	DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17.0	null	225-UNIMOD:28,239-UNIMOD:35	0.05	17.0	1	1	1
PRT	sp|Q7Z3B4|NUP54_HUMAN	Nucleoporin p54 OS=Homo sapiens OX=9606 GN=NUP54 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17.0	null	469-UNIMOD:28	0.04	17.0	1	1	1
PRT	sp|Q96L33|RHOV_HUMAN	Rho-related GTP-binding protein RhoV OS=Homo sapiens OX=9606 GN=RHOV PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17.0	null	196-UNIMOD:27	0.06	17.0	1	1	1
PRT	sp|P27448|MARK3_HUMAN	MAP/microtubule affinity-regulating kinase 3 OS=Homo sapiens OX=9606 GN=MARK3 PE=1 SV=5	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null		0.03	17.0	1	1	1
PRT	sp|O14578|CTRO_HUMAN	Citron Rho-interacting kinase OS=Homo sapiens OX=9606 GN=CIT PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17.0	null	343-UNIMOD:4	0.01	17.0	1	1	0
PRT	sp|P30154-2|2AAB_HUMAN	Isoform 2 of Serine/threonine-protein phosphatase 2A 65 kDa regulatory subunit A beta isoform OS=Homo sapiens OX=9606 GN=PPP2R1B	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q96EY7|PTCD3_HUMAN	Pentatricopeptide repeat domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=PTCD3 PE=1 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	16.0	null	578-UNIMOD:4	0.03	16.0	1	1	0
PRT	sp|P14635|CCNB1_HUMAN	G2/mitotic-specific cyclin-B1 OS=Homo sapiens OX=9606 GN=CCNB1 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|Q5T160|SYRM_HUMAN	Probable arginine--tRNA ligase, mitochondrial OS=Homo sapiens OX=9606 GN=RARS2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.03	16.0	1	1	1
PRT	sp|P48556|PSMD8_HUMAN	26S proteasome non-ATPase regulatory subunit 8 OS=Homo sapiens OX=9606 GN=PSMD8 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.07	16.0	1	1	1
PRT	sp|P42345|MTOR_HUMAN	Serine/threonine-protein kinase mTOR OS=Homo sapiens OX=9606 GN=MTOR PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|O14974-2|MYPT1_HUMAN	Isoform 2 of Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|P27105-2|STOM_HUMAN	Isoform 2 of Erythrocyte band 7 integral membrane protein OS=Homo sapiens OX=9606 GN=STOM	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.17	16.0	1	1	1
PRT	sp|Q9Y394-2|DHRS7_HUMAN	Isoform 2 of Dehydrogenase/reductase SDR family member 7 OS=Homo sapiens OX=9606 GN=DHRS7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null	154-UNIMOD:4	0.08	16.0	1	1	1
PRT	sp|Q53GS9-2|SNUT2_HUMAN	Isoform 2 of U4/U6.U5 tri-snRNP-associated protein 2 OS=Homo sapiens OX=9606 GN=USP39	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null	71-UNIMOD:4	0.06	16.0	1	1	1
PRT	sp|O95602|RPA1_HUMAN	DNA-directed RNA polymerase I subunit RPA1 OS=Homo sapiens OX=9606 GN=POLR1A PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q9NVH2-2|INT7_HUMAN	Isoform 2 of Integrator complex subunit 7 OS=Homo sapiens OX=9606 GN=INTS7	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null	636-UNIMOD:4,638-UNIMOD:4	0.02	16.0	1	1	1
PRT	sp|Q8NFQ8|TOIP2_HUMAN	Torsin-1A-interacting protein 2 OS=Homo sapiens OX=9606 GN=TOR1AIP2 PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q92797|SYMPK_HUMAN	Symplekin OS=Homo sapiens OX=9606 GN=SYMPK PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.02	16.0	1	1	1
PRT	sp|Q16851-2|UGPA_HUMAN	Isoform 2 of UTP--glucose-1-phosphate uridylyltransferase OS=Homo sapiens OX=9606 GN=UGP2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.06	16.0	1	1	1
PRT	sp|Q6Y7W6-3|GGYF2_HUMAN	Isoform 2 of GRB10-interacting GYF protein 2 OS=Homo sapiens OX=9606 GN=GIGYF2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null	1160-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|Q15652-3|JHD2C_HUMAN	Isoform 3 of Probable JmjC domain-containing histone demethylation protein 2C OS=Homo sapiens OX=9606 GN=JMJD1C	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|Q8IWT6|LRC8A_HUMAN	Volume-regulated anion channel subunit LRRC8A OS=Homo sapiens OX=9606 GN=LRRC8A PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.04	16.0	1	1	1
PRT	sp|P0DMV8-2|HS71A_HUMAN	Isoform 2 of Heat shock 70 kDa protein 1A OS=Homo sapiens OX=9606 GN=HSPA1A	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.05	16.0	1	1	1
PRT	sp|Q01780-2|EXOSX_HUMAN	Isoform 2 of Exosome component 10 OS=Homo sapiens OX=9606 GN=EXOSC10	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null	685-UNIMOD:35	0.02	16.0	1	1	1
PRT	sp|Q96MR6|CFA57_HUMAN	Cilia- and flagella-associated protein 57 OS=Homo sapiens OX=9606 GN=CFAP57 PE=2 SV=3	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null	701-UNIMOD:35	0.01	16.0	1	1	1
PRT	sp|Q99801-2|NKX31_HUMAN	Isoform 2 of Homeobox protein Nkx-3.1 OS=Homo sapiens OX=9606 GN=NKX3-1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null		0.11	16.0	1	1	1
PRT	sp|P51805|PLXA3_HUMAN	Plexin-A3 OS=Homo sapiens OX=9606 GN=PLXNA3 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16.0	null	1851-UNIMOD:4	0.01	16.0	1	1	1
PRT	sp|Q92973|TNPO1_HUMAN	Transportin-1 OS=Homo sapiens OX=9606 GN=TNPO1 PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null	386-UNIMOD:4	0.03	16.0	1	1	1
PRT	sp|O95336|6PGL_HUMAN	6-phosphogluconolactonase OS=Homo sapiens OX=9606 GN=PGLS PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16.0	null	132-UNIMOD:28,156-UNIMOD:4	0.15	16.0	1	1	1
PRT	sp|Q8WUM4|PDC6I_HUMAN	Programmed cell death 6-interacting protein OS=Homo sapiens OX=9606 GN=PDCD6IP PE=1 SV=1	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null		0.02	16.0	1	1	0
PRT	sp|P35579|MYH9_HUMAN	Myosin-9 OS=Homo sapiens OX=9606 GN=MYH9 PE=1 SV=4	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null		0.01	16.0	1	1	1
PRT	sp|P16104|H2AX_HUMAN	Histone H2AX OS=Homo sapiens OX=9606 GN=H2AFX PE=1 SV=2	null	null	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16.0	null		0.25	16.0	1	1	1

PSH	sequence	PSM_ID	accession	unique	database	database_version	search_engine	search_engine_score[1]	modifications	spectra_ref	retention_time	charge	exp_mass_to_charge	calc_mass_to_charge	pre	post	start	end
PSM	PEEVHHGEEEVETFAFQAEIAQLMSLIINTFYSNK	1	sp|P08238|HS90B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	66		ms_run[1]:scan=1.1.1564.9	41.89563	4	4049.9189	4049.9357	M	E	2	37
PSM	HAFEIIHLLTGENPLQVLVNAIINSGPR	2	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	55		ms_run[1]:scan=1.1.1563.5	41.86155	4	3064.6653	3064.6822	K	E	95	123
PSM	DQAVENILVSPVVVASSLGLVSLGGK	3	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	53		ms_run[1]:scan=1.1.250.5	6.679033	3	2550.4108	2550.4269	K	A	61	87
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	4	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	53	27-UNIMOD:4	ms_run[1]:scan=1.1.1339.3	35.87423	4	3512.6741	3512.6956	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	5	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	52	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.174.4	4.649683	5	3585.6736	3585.6942	R	R	85	117
PSM	SGDAPLTVNELGTAYVSATTGAVATALGLNALTK	6	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	52		ms_run[1]:scan=1.1.1113.8	29.8586	3	3246.6766	3246.6983	R	H	137	171
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	7	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.247.4	6.601133	4	3585.6717	3585.6942	R	R	85	117
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	8	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51		ms_run[1]:scan=1.1.705.5	18.91608	4	3113.6637	3113.6801	K	F	193	222
PSM	HAFEIIHLLTGENPLQVLVNAIINSGPR	9	sp|P46782|RS5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	51		ms_run[1]:scan=1.1.1582.3	42.37548	4	3064.6653	3064.6822	K	E	95	123
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	10	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	51	27-UNIMOD:4	ms_run[1]:scan=1.1.876.6	23.45748	4	3435.664094	3436.697307	R	R	85	117
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	11	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	11-UNIMOD:4	ms_run[1]:scan=1.1.416.10	11.16342	3	2908.4119	2908.4310	K	N	101	130
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	12	sp|P56545-2|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.474.7	12.69122	4	3527.7177	3527.7388	K	R	655	688
PSM	TSANPLSTLSSHLSQQLAAAAGLAQSLASQSASISGVK	13	sp|Q9NSC2-2|SALL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50		ms_run[1]:scan=1.1.1294.2	34.67302	4	3651.8825	3651.9067	R	Q	180	218
PSM	VGAGAPVYMAAVLEYLTAEILELAGNAAR	14	sp|Q6FI13|H2A2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50		ms_run[1]:scan=1.1.1582.5	42.38215	3	2932.5214	2932.5368	R	D	44	73
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	15	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.1359.6	36.3934	4	3512.6749	3512.6956	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	16	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	50	27-UNIMOD:4	ms_run[1]:scan=1.1.857.8	22.95403	4	3437.674094	3436.697307	R	R	85	117
PSM	AHITLGCAADVEAVQTGLDLLEILR	17	sp|P09543-2|CN37_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49	7-UNIMOD:4	ms_run[1]:scan=1.1.376.4	10.07682	4	2677.3901	2677.4109	R	Q	309	334
PSM	DQAVENILVSPVVVASSLGLVSLGGK	18	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.307.5	8.208734	3	2550.4102	2550.4269	K	A	61	87
PSM	DQAVENILVSPVVVASSLGLVSLGGK	19	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.288.9	7.7041	3	2550.4105	2550.4269	K	A	61	87
PSM	DQAVENILVSPVVVASSLGLVSLGGK	20	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.269.7	7.192616	3	2550.4108	2550.4269	K	A	61	87
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	21	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.179.4	4.784184	5	3585.6736	3585.6942	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	22	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49	27-UNIMOD:4	ms_run[1]:scan=1.1.820.3	21.99915	5	3436.6781	3436.6973	R	R	85	117
PSM	VGAGAPVYLAAVLEYLTAEILELAGNAAR	23	sp|P0C0S8|H2A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.1578.6	42.27088	3	2914.5652	2914.5804	R	D	44	73
PSM	GGISNILEELVVQPLLVSVSALTLATETVR	24	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.1588.4	42.51665	4	3120.7469	3120.7646	K	S	468	498
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	25	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	49		ms_run[1]:scan=1.1.1562.6	41.83557	4	2987.5077	2987.5240	K	I	653	680
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	26	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	49	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.228.6	6.082716	4	3586.672094	3585.694213	R	R	85	117
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	27	sp|P56545|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	49	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.512.3	13.71635	4	3528.722494	3527.738855	K	R	115	148
PSM	DQAVENILVSPVVVASSLGLVSLGGK	28	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.300.2	8.01695	4	2550.4113	2550.4269	K	A	61	87
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	29	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48	11-UNIMOD:4	ms_run[1]:scan=1.1.397.5	10.64913	3	2908.4119	2908.4310	K	N	101	130
PSM	VGATAAVYSAAILEYLTAEVLELAGNASK	30	sp|P0C0S5|H2AZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.1567.7	41.97438	3	2894.5141	2894.5276	R	D	47	76
PSM	GGISNILEELVVQPLLVSVSALTLATETVR	31	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.1590.3	42.5731	3	3120.7462	3120.7646	K	S	468	498
PSM	GGISNILEELVVQPLLVSVSALTLATETVR	32	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.1594.2	42.65536	3	3120.7462	3120.7646	K	S	468	498
PSM	GGISNILEELVVQPLLVSVSALTLATETVR	33	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	48		ms_run[1]:scan=1.1.1589.3	42.54743	3	3120.7462	3120.7646	K	S	468	498
PSM	NGFLNLALPFFGFSEPLAAPR	34	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47		ms_run[1]:scan=1.1.616.4	16.50837	3	2277.1801	2277.1946	K	H	884	905
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	35	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47		ms_run[1]:scan=1.1.805.9	21.60708	3	2934.4675	2934.4862	R	D	133	163
PSM	VGAGAPVYMAAVLEYLTAEILELAGNAAR	36	sp|Q6FI13|H2A2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47		ms_run[1]:scan=1.1.1573.2	42.12903	4	2932.5225	2932.5368	R	D	44	73
PSM	GGISNILEELVVQPLLVSVSALTLATETVR	37	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47		ms_run[1]:scan=1.1.1591.3	42.59862	3	3120.7462	3120.7646	K	S	468	498
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	38	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	47		ms_run[1]:scan=1.1.1566.11	41.95373	3	3252.5902	3252.6021	K	T	119	148
PSM	TLLEGSGLESIISIIHSSLAEPR	39	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46		ms_run[1]:scan=1.1.212.6	5.65255	3	2421.2983	2421.3115	R	V	2483	2506
PSM	DQAVENILVSPVVVASSLGLVSLGGK	40	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46		ms_run[1]:scan=1.1.231.6	6.163084	3	2550.4102	2550.4269	K	A	61	87
PSM	KASFEEASNQLINHIEQFLDTNETPYFMK	41	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46		ms_run[1]:scan=1.1.139.9	3.709967	4	3443.6137	3443.6343	K	S	606	635
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	42	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.177.3	4.728817	5	3585.6736	3585.6942	R	R	85	117
PSM	INALTAASEAACLIVSVDETIK	43	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46	12-UNIMOD:4	ms_run[1]:scan=1.1.542.2	14.50652	3	2288.1808	2288.1933	R	N	296	318
PSM	LPITVLNGAPGFINLCDALNAWQLVK	44	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46	16-UNIMOD:4	ms_run[1]:scan=1.1.614.10	16.46475	3	2836.5106	2836.5309	K	E	225	251
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	45	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46	11-UNIMOD:4	ms_run[1]:scan=1.1.553.3	14.81802	3	2908.4143	2908.4310	K	N	101	130
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	46	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46	27-UNIMOD:4	ms_run[1]:scan=1.1.833.5	22.35618	4	3436.6733	3436.6973	R	R	85	117
PSM	NLDIERPTYTNLNRLIGQIVSSITASLR	47	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46		ms_run[1]:scan=1.1.1561.4	41.80432	4	3156.7013	3156.7255	R	F	181	209
PSM	YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR	48	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46		ms_run[1]:scan=1.1.1357.5	36.33972	4	4098.9889	4099.0149	K	K	337	373
PSM	YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR	49	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	46		ms_run[1]:scan=1.1.1377.4	36.85947	5	4098.9911	4099.0149	K	K	337	373
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	50	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	46	27-UNIMOD:4	ms_run[1]:scan=1.1.895.6	23.97067	4	3438.674094	3436.697307	R	R	85	117
PSM	GIHSAIDASQTPDVVFASILAAFSK	51	sp|P54819-2|KAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.281.4	7.512533	3	2544.3049	2544.3224	R	A	205	230
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	52	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45	5-UNIMOD:4	ms_run[1]:scan=1.1.92.4	2.431283	5	4320.1566	4320.1835	K	A	198	238
PSM	SANYCHTSQGDPIGLILLGEVALGNMYELK	53	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45	5-UNIMOD:4	ms_run[1]:scan=1.1.759.7	20.37483	4	3262.5833	3262.6002	K	H	904	934
PSM	LTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	54	sp|P13797-2|PLST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45	22-UNIMOD:4	ms_run[1]:scan=1.1.683.8	18.32783	4	3561.8397	3561.8613	K	A	166	199
PSM	WTAISALEYGVPVTLIGEAVFAR	55	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.739.4	19.84405	3	2462.3059	2462.3209	K	C	253	276
PSM	AEVQNLGGELVVSGVDSAMSLIQAAK	56	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.474.4	12.68622	3	2585.3227	2585.3371	K	N	428	454
PSM	HGITQANELVNLTEFFVNHILPDLK	57	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.1559.9	41.75712	3	2861.4865	2861.5076	K	S	446	471
PSM	YGAVDPLLALLAVPDMSSLACGYLR	58	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45	21-UNIMOD:4	ms_run[1]:scan=1.1.1530.9	40.95063	3	2664.3475	2664.3655	K	N	203	228
PSM	NLDIERPTYTNLNRLISQIVSSITASLR	59	sp|P68363|TBA1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	45		ms_run[1]:scan=1.1.1563.2	41.85655	5	3186.7171	3186.7360	R	F	216	244
PSM	AHITLGCAADVEAVQTGLDLLEILR	60	sp|P09543-2|CN37_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	7-UNIMOD:4	ms_run[1]:scan=1.1.375.3	10.04135	4	2677.3901	2677.4109	R	Q	309	334
PSM	GIHSAIDASQTPDVVFASILAAFSK	61	sp|P54819-2|KAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.285.2	7.6113	4	2544.3077	2544.3224	R	A	205	230
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	62	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	11-UNIMOD:4	ms_run[1]:scan=1.1.435.9	11.676	3	2908.4140	2908.4310	K	N	101	130
PSM	ASLDRPFTNLESAFYSIVGLSSLGAQVPDAK	63	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.307.3	8.2054	4	3252.6473	3252.6666	K	K	39	70
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	64	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.236.6	6.2965	5	3585.6726	3585.6942	R	R	85	117
PSM	LGDPAEYAHLVQAIIENPFLNGEVIR	65	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.620.4	16.61533	4	2877.4817	2877.5025	R	L	218	244
PSM	ALQSNIIPFCDEVMQLLLENLGNENVHR	66	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	10-UNIMOD:4	ms_run[1]:scan=1.1.959.6	25.69513	4	3265.6025	3265.6223	R	S	535	563
PSM	AELATEEFLPVTPILEGFVILR	67	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.954.2	25.55563	3	2456.3395	2456.3566	R	K	721	743
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	68	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	27-UNIMOD:4	ms_run[1]:scan=1.1.856.4	22.92102	5	3436.6786	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	69	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44	27-UNIMOD:4	ms_run[1]:scan=1.1.879.3	23.5329	5	3436.6786	3436.6973	R	R	85	117
PSM	VHAELADVLTEAVVDSILAIK	70	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.1562.2	41.8289	4	2205.2129	2205.2256	K	K	115	136
PSM	VGAGAPVYLAAVLEYLTAEILELAGNAAR	71	sp|P0C0S8|H2A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.1602.2	42.77988	4	2914.5601	2914.5804	R	D	44	73
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	72	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	44		ms_run[1]:scan=1.1.1568.10	42.00673	3	2987.5099	2987.5240	K	I	653	680
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	73	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	44		ms_run[1]:scan=1.1.755.8	20.2746	3	2845.406171	2843.416381	R	N	766	791
PSM	SHCIAEVENDEMPADLPSLAADFVESK	74	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	44	3-UNIMOD:4	ms_run[1]:scan=1.1.1441.3	38.52387	3	2974.320071	2973.337204	K	D	311	338
PSM	FGAQLAHIQALISGIEAQLGDVR	75	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.242.2	6.454683	4	2406.2853	2406.3019	R	A	331	354
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	76	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43	11-UNIMOD:4	ms_run[1]:scan=1.1.399.6	10.69507	4	2908.4141	2908.4310	K	N	101	130
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	77	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.207.9	5.524783	4	3585.6741	3585.6942	R	R	85	117
PSM	DQAVENILVSPVVVASSLGLVSLGGK	78	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.326.10	8.729116	3	2550.4102	2550.4269	K	A	61	87
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	79	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.238.7	6.352983	5	3585.6726	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	80	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.208.4	5.5428	5	3585.6736	3585.6942	R	R	85	117
PSM	SLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVEK	81	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.801.4	21.49388	4	3903.0017	3903.0265	K	A	866	902
PSM	ALMLQGVDLLADAVAVTMGPK	82	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.928.2	24.85173	3	2112.1198	2112.1323	R	G	38	59
PSM	DVQNTFYDIVAELGAMEHAQAVDYIK	83	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.1007.5	26.99078	4	2939.3821	2939.4011	R	K	638	664
PSM	GVQPLLDAVLEYLPNPSEVQNYAILNK	84	sp|Q96RP9-2|EFGM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.1135.4	30.45068	4	2996.5641	2996.5858	K	E	324	351
PSM	KGGISNILEELVVQPLLVSVSALTLATETVR	85	sp|P50991-2|TCPD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.1578.4	42.26755	4	3248.8417	3248.8595	R	S	467	498
PSM	IIVENLFYPVTLDVLHQIFSK	86	sp|P26599-2|PTBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.1561.7	41.80932	3	2487.3625	2487.3777	R	F	186	207
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	87	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.1314.4	35.20658	4	3503.9153	3503.9392	K	S	754	787
PSM	TDMIQALGGVEGILEHTLFK	88	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.1290.2	34.55742	3	2171.1172	2171.1296	R	G	1472	1492
PSM	AGTLTVEELGATLTSLLAQAQAQAR	89	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.1197.7	32.13163	3	2512.3312	2512.3497	R	A	2477	2502
PSM	GGISNILEELVVQPLLVSVSALTLATETVR	90	sp|P50991-2|TCPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.1596.2	42.6865	3	3120.7462	3120.7646	K	S	468	498
PSM	SENVQDLLLLDVTPLSLGIETAGGVMTVLIK	91	sp|P11142|HSP7C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	43		ms_run[1]:scan=1.1.1565.10	41.92485	3	3237.7600	3237.7782	K	R	385	416
PSM	CLQILAAGLFLPGSVGITDPCESGNFR	92	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	43	1-UNIMOD:385,1-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.1574.7	42.16452	3	2874.3902	2874.4042	R	V	271	298
PSM	CIALAQLLVEQNFPAIAIHR	93	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	43	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.980.4	26.25708	3	2260.2062	2259.2192	R	G	300	320
PSM	YALQMEQLNGILLHLESELAQTR	94	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.225.4	5.9974	4	2669.3693	2669.3846	R	A	331	354
PSM	SAGDLGIAVCNVPAASVEETADSTLCHILNLYR	95	sp|Q13363-2|CTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.57.9	1.493417	4	3515.6781	3515.7025	K	R	98	131
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	96	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.328.3	8.7849	4	3585.6717	3585.6942	R	R	85	117
PSM	GDLENAFLNLVQCIQNKPLYFADR	97	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	13-UNIMOD:4	ms_run[1]:scan=1.1.83.6	2.1903	4	2837.4009	2837.4170	K	L	268	292
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	98	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	11-UNIMOD:4	ms_run[1]:scan=1.1.454.10	12.1941	3	2908.4116	2908.4310	K	N	101	130
PSM	SLEGDLEDLKDQIAQLEASLAAAK	99	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.881.3	23.58705	4	2527.2837	2527.3017	K	K	158	182
PSM	GQVLSVCVEEENIIPYITNVLQNPDLALR	100	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	7-UNIMOD:4	ms_run[1]:scan=1.1.546.7	14.62487	4	3295.6937	3295.7122	K	M	322	351
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	101	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	27-UNIMOD:4	ms_run[1]:scan=1.1.933.5	25.00183	4	3436.6745	3436.6973	R	R	85	117
PSM	TALLDAAGVASLLTTAEVVVTEIPK	102	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42		ms_run[1]:scan=1.1.1569.3	42.02228	4	2481.3765	2481.3942	R	E	527	552
PSM	ELEAVCQDVLSLLDNYLIK	103	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	42	6-UNIMOD:4	ms_run[1]:scan=1.1.1468.3	39.2486	3	2234.1376	2234.1504	K	N	92	111
PSM	ALMLQGVDLLADAVAVTMGPK	104	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.966.4	25.87847	3	2113.120271	2112.132284	R	G	38	59
PSM	DQAVENILVSPVVVASSLGLVSLGGK	105	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	42		ms_run[1]:scan=1.1.364.5	9.74695	3	2551.410971	2550.426869	K	A	61	87
PSM	AAGAAEAAVAAVEEVGSAGQFEELLR	106	sp|O76003|GLRX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:1	ms_run[1]:scan=1.1.1569.7	42.02895	3	2558.2622	2557.2652	M	L	2	28
PSM	EVAAFAQFGSDLDAATQQLLSR	107	sp|P25705|ATPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	42	1-UNIMOD:27	ms_run[1]:scan=1.1.1255.2	33.67993	3	2320.1372	2319.1492	R	G	442	464
PSM	AIPDLTAPVAAVQAAVSNLVR	108	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.1.6	0.0237	3	2075.1562	2075.1739	K	V	36	57
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	109	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41	11-UNIMOD:4	ms_run[1]:scan=1.1.419.2	11.23302	4	2908.4141	2908.4310	K	N	101	130
PSM	LHIQNPSFSQINQLVSTIMSASTTTLR	110	sp|Q9NRH3|TBG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.194.2	5.173767	4	2986.5349	2986.5546	R	Y	218	245
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	111	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.302.5	8.0776	4	3536.8589	3536.8813	K	A	311	345
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	112	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.183.7	4.894567	4	3585.6741	3585.6942	R	R	85	117
PSM	YFILPDSLPLDTLLVDVEPK	113	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.303.4	8.099383	3	2286.2266	2286.2399	R	V	67	87
PSM	PNSEPASLLELFNSIATQGELVR	114	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.107.7	2.842867	3	2484.2668	2484.2860	M	S	2	25
PSM	ASLDRPFTNLESAFYSIVGLSSLGAQVPDAK	115	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.301.3	8.043917	5	3252.6486	3252.6666	K	K	39	70
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	116	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.172.4	4.59555	5	3585.6736	3585.6942	R	R	85	117
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	117	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.724.6	19.43	4	3113.6637	3113.6801	K	F	193	222
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	118	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41	27-UNIMOD:4	ms_run[1]:scan=1.1.843.2	22.58142	6	3436.6765	3436.6973	R	R	85	117
PSM	VLVTGAAGQIAYSLLYSIGNGSVFGK	119	sp|P40925-3|MDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.706.2	18.94135	3	2584.3726	2584.3901	R	D	25	51
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	120	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41	27-UNIMOD:4	ms_run[1]:scan=1.1.939.3	25.15398	5	3436.6751	3436.6973	R	R	85	117
PSM	LQADDFLQDYTLLINILHSEDLGK	121	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.812.11	21.79642	3	2773.3984	2773.4174	R	D	421	445
PSM	NLPQYVSNELLEEAFSVFGQVER	122	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.1559.2	41.74545	4	2667.3013	2667.3180	R	A	65	88
PSM	HGITQANELVNLTEFFVNHILPDLK	123	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.1555.3	41.63417	4	2861.4905	2861.5076	K	S	446	471
PSM	TDMIQALGGVEGILEHTLFK	124	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.1270.2	34.05404	3	2171.1172	2171.1296	R	G	1472	1492
PSM	TALLDAAGVASLLTTAEVVVTEIPKEEK	125	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.1555.9	41.64417	3	2867.5588	2867.5743	R	D	527	555
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	126	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.1566.9	41.9504	3	2987.5099	2987.5240	K	I	653	680
PSM	KSEMESVLAQLDNYGQQELADLFVNYNVK	127	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.1208.2	32.41605	5	3344.6006	3344.6234	K	S	236	265
PSM	SYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDR	128	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.1454.6	38.8788	5	4832.2596	4832.2875	R	H	230	275
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	129	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.743.6	19.94543	4	3113.6637	3113.6801	K	F	193	222
PSM	IRFPGFEPLTPWILDLLGHYAVMNNPTR	130	sp|Q12905|ILF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	41		ms_run[1]:scan=1.1.1556.5	41.66603	4	3266.6897	3266.7063	R	Q	232	260
PSM	ALMLQGVDLLADAVAVTMGPK	131	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	41		ms_run[1]:scan=1.1.947.2	25.36433	3	2114.119871	2112.132284	R	G	38	59
PSM	AAIGCGIVESILNWVK	132	sp|P11388-2|TOP2A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	5-UNIMOD:4	ms_run[1]:scan=1.1.1.2	0.01036667	3	1728.9088	1728.9233	K	F	427	443
PSM	DQAVENILVSPVVVASSLGLVSLGGK	133	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.383.8	10.26798	3	2550.4102	2550.4269	K	A	61	87
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	134	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.321.6	8.595966	4	3536.8593	3536.8813	K	A	311	345
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	135	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.421.4	11.2941	5	4436.2086	4436.2322	K	E	270	310
PSM	TLLEGSGLESIISIIHSSLAEPR	136	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.231.5	6.15975	3	2421.2983	2421.3115	R	V	2483	2506
PSM	GIHSAIDASQTPDVVFASILAAFSK	137	sp|P54819-2|KAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.266.8	7.10995	3	2544.3049	2544.3224	R	A	205	230
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	138	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.189.6	5.05745	3	3585.6712	3585.6942	R	R	85	117
PSM	ALMLQGVDLLADAVAVTMGPK	139	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.936.4	25.07123	3	2112.1198	2112.1323	R	G	38	59
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	140	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.786.5	21.09255	3	2934.4675	2934.4862	R	D	133	163
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	141	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	27-UNIMOD:4	ms_run[1]:scan=1.1.837.7	22.44003	3	3436.6723	3436.6973	R	R	85	117
PSM	QSGAFLSTSEGLILQLVGDAVHPQFK	142	sp|Q96AB3-2|ISOC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.1211.4	32.50373	4	2741.4241	2741.4388	R	E	169	195
PSM	VGATAAVYSAAILEYLTAEVLELAGNASK	143	sp|P0C0S5|H2AZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.1576.4	42.2137	4	2894.5109	2894.5276	R	D	47	76
PSM	YDCGEEILITVLSAMTEEAAVAIK	144	sp|Q6IS14|IF5AL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	3-UNIMOD:4	ms_run[1]:scan=1.1.1565.7	41.91985	3	2625.2785	2625.2917	K	A	127	151
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	145	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	27-UNIMOD:4	ms_run[1]:scan=1.1.1320.3	35.37325	4	3512.6741	3512.6956	R	R	85	117
PSM	NLDIERPTYTNLNRLISQIVSSITASLR	146	sp|P68363|TBA1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.1559.11	41.76045	3	3186.7168	3186.7360	R	F	216	244
PSM	ELEAVCQDVLSLLDNYLIK	147	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	6-UNIMOD:4	ms_run[1]:scan=1.1.1472.8	39.36583	3	2234.1376	2234.1504	K	N	92	111
PSM	EITAIESSVPCQLLESVLQELK	148	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	11-UNIMOD:4	ms_run[1]:scan=1.1.1442.5	38.54455	3	2485.2820	2485.2985	R	G	635	657
PSM	QDIFQEQLAAIPEFLNIGPLFK	149	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40		ms_run[1]:scan=1.1.1279.5	34.28838	3	2530.3300	2530.3471	R	S	608	630
PSM	FVDVLGLEEESLGSVPAPACALLLLFPLTAQHENFR	150	sp|P09936|UCHL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	20-UNIMOD:4	ms_run[1]:scan=1.1.1563.6	41.86322	5	3952.0256	3952.0444	R	K	28	64
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	151	sp|P56545-2|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	40	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.486.4	13.01783	4	3527.7177	3527.7388	K	R	655	688
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	152	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	40	11-UNIMOD:4	ms_run[1]:scan=1.1.513.2	13.74548	4	2909.410494	2908.431045	K	N	101	130
PSM	CIALAQLLVEQNFPAIAIHR	153	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.961.5	25.74592	3	2260.2062	2259.2192	R	G	300	320
PSM	CIALAQLLVEQNFPAIAIHR	154	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	40	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.942.4	25.2329	3	2259.2062	2259.2192	R	G	300	320
PSM	SDSVTDSGPTFNYLLDMPLWYLTK	155	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	40		ms_run[1]:scan=1.1.472.9	12.6405	3	2763.301271	2762.314935	K	E	1115	1139
PSM	LHIQNPSFSQINQLVSTIMSASTTTLR	156	sp|Q9NRH3|TBG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.196.3	5.225883	4	2986.5349	2986.5546	R	Y	218	245
PSM	LHIQNPSFSQINQLVSTIMSASTTTLR	157	sp|Q9NRH3|TBG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.195.4	5.201483	4	2986.5349	2986.5546	R	Y	218	245
PSM	ILCQDNPSHNVFCSPVSISSALAMVLLGAK	158	sp|P50453|SPB9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	3-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.154.8	4.114483	4	3227.5953	3227.6141	K	G	18	48
PSM	VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKK	159	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	21-UNIMOD:4	ms_run[1]:scan=1.1.237.2	6.3321	4	4208.1629	4208.1927	R	Q	59	100
PSM	TVQDLTSVVQTLLQQMQDK	160	sp|O75506|HSBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.334.6	8.93855	3	2174.1082	2174.1253	K	F	8	27
PSM	QYDADLEQILIQWITTQCR	161	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	18-UNIMOD:4	ms_run[1]:scan=1.1.397.4	10.64413	3	2393.1529	2393.1685	K	K	42	61
PSM	FLESVEGNQNYPLLLLTLLEK	162	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.310.2	8.286384	3	2432.3038	2432.3202	K	S	32	53
PSM	PNSEPASLLELFNSIATQGELVR	163	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.49.8	1.275017	3	2484.2656	2484.2860	M	S	2	25
PSM	PNSEPASLLELFNSIATQGELVR	164	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.68.11	1.7936	3	2484.2656	2484.2860	M	S	2	25
PSM	AELATEEFLPVTPILEGFVILR	165	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.975.4	26.12752	4	2456.3433	2456.3566	R	K	721	743
PSM	NGFLNLALPFFGFSEPLAAPR	166	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.635.5	17.02067	3	2277.1801	2277.1946	K	H	884	905
PSM	AELATEEFLPVTPILEGFVILR	167	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.992.4	26.58638	3	2456.3413	2456.3566	R	K	721	743
PSM	VLVTGAAGQIAYSLLYSIGNGSVFGK	168	sp|P40925-3|MDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.726.5	19.48882	3	2584.3726	2584.3901	R	D	25	51
PSM	LTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	169	sp|P13797-2|PLST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	22-UNIMOD:4	ms_run[1]:scan=1.1.681.6	18.27363	4	3561.8397	3561.8613	K	A	166	199
PSM	NGFLNLALPFFGFSEPLAAPR	170	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.597.6	16.00013	3	2277.1801	2277.1946	K	H	884	905
PSM	MAQLLDLSVDESEAFLSNLVVNK	171	sp|O00232-2|PSD12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.666.5	17.87057	3	2534.2750	2534.2938	R	T	358	381
PSM	LPITVLNGAPGFINLCDALNAWQLVK	172	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	16-UNIMOD:4	ms_run[1]:scan=1.1.595.3	15.9541	3	2836.5106	2836.5309	K	E	225	251
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	173	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	27-UNIMOD:4	ms_run[1]:scan=1.1.823.4	22.08178	5	3436.6781	3436.6973	R	R	85	117
PSM	GLLPLVTILGLPNLPIDFPTSAACQAVAGVCK	174	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	24-UNIMOD:4,31-UNIMOD:4	ms_run[1]:scan=1.1.1381.6	36.96098	4	3304.7717	3304.7927	K	S	798	830
PSM	LYQVEYAMEAIGHAGTCLGILANDGVLLAAER	175	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	17-UNIMOD:4	ms_run[1]:scan=1.1.1062.6	28.47867	4	3417.6829	3417.7061	R	R	18	50
PSM	FVDVLGLEEESLGSVPAPACALLLLFPLTAQHENFR	176	sp|P09936|UCHL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	20-UNIMOD:4	ms_run[1]:scan=1.1.1558.9	41.72912	4	3952.0229	3952.0444	R	K	28	64
PSM	IQDALSTVLQYAEDVLSGK	177	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.1562.5	41.8339	3	2049.0529	2049.0630	R	V	279	298
PSM	ELEAVCQDVLSLLDNYLIK	178	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39	6-UNIMOD:4	ms_run[1]:scan=1.1.1491.5	39.87762	3	2234.1376	2234.1504	K	N	92	111
PSM	TALLDAAGVASLLTTAEVVVTEIPK	179	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.1565.11	41.92652	2	2481.3814	2481.3942	R	E	527	552
PSM	QDIFQEQLAAIPEFLNIGPLFK	180	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.1258.4	33.76512	3	2530.3300	2530.3471	R	S	608	630
PSM	GVDLDQLLDMSYEQLMQLYSAR	181	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.1557.8	41.6994	3	2587.2145	2587.2298	R	Q	19	41
PSM	GPNNATLFTAAEIAPFVEILLTNLFK	182	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.1574.5	42.16118	3	2803.5004	2803.5160	R	A	534	560
PSM	FFEGPVTGIFSGYVNSMLQEYAK	183	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.139.9	3.709967	3	2583.2194	2583.2356	K	N	396	419
PSM	IAAQDLLLAVATDFQNESAAALAAAATR	184	sp|Q96P70|IPO9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.1563.4	41.85988	4	2785.4437	2785.4610	R	H	400	428
PSM	PLTPLQEEMASLLQQIEIER	185	sp|Q9H2W6|RM46_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	39		ms_run[1]:scan=1.1.132.8	3.518767	3	2337.2074	2337.2249	K	S	62	82
PSM	QDQIQQVVNHGLVPFLVSVLSK	186	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:28	ms_run[1]:scan=1.1.1561.10	41.81432	2	2430.3082	2430.3262	R	A	367	389
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	187	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	39	11-UNIMOD:4	ms_run[1]:scan=1.1.632.9	16.94937	3	2909.412071	2908.431045	K	N	101	130
PSM	CIALAQLLVEQNFPAIAIHR	188	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.999.4	26.76935	3	2259.2062	2259.2192	R	G	300	320
PSM	AAAAAEQQQFYLLLGNLLSPDNVVR	189	sp|O00410|IPO5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=1.1.1566.7	41.94707	3	2742.4162	2742.4332	M	K	2	27
PSM	SDPAVNAQLDGIISDFEALK	190	sp|Q9UHD8-5|SEPT9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	39	1-UNIMOD:1	ms_run[1]:scan=1.1.328.2	8.776567	3	2144.0472	2144.0632	M	R	2	22
PSM	NMAEQIIQEIYSQIQSK	191	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.22.3	0.5383833	3	2022.0010	2022.0091	K	K	273	290
PSM	VSGYLNLAADLAHNFTDGLAIGASFR	192	sp|Q92504|S39A7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.5.8	0.1006333	3	2692.3420	2692.3609	R	G	317	343
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	193	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.361.5	9.666	5	3585.6721	3585.6942	R	R	85	117
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	194	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	5-UNIMOD:4	ms_run[1]:scan=1.1.96.8	2.549167	4	4320.1537	4320.1835	K	A	198	238
PSM	YFILPDSLPLDTLLVDVEPK	195	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.322.3	8.613017	3	2286.2266	2286.2399	R	V	67	87
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	196	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	11-UNIMOD:4	ms_run[1]:scan=1.1.378.11	10.136	3	2908.4134	2908.4310	K	N	101	130
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	197	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.213.5	5.677583	5	3585.6736	3585.6942	R	R	85	117
PSM	ALMLQGVDLLADAVAVTMGPK	198	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.930.2	24.90907	4	2112.1177	2112.1323	R	G	38	59
PSM	LGDPAEYAHLVQAIIENPFLNGEVIR	199	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.601.3	16.10355	4	2877.4817	2877.5025	R	L	218	244
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	200	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	11-UNIMOD:4	ms_run[1]:scan=1.1.612.8	16.40783	3	2908.4227	2908.4310	K	N	101	130
PSM	LANQFAIYKPVTDFFLQLVDAGK	201	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.686.6	18.40403	3	2597.3728	2597.3894	R	V	1244	1267
PSM	LTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	202	sp|P13797-2|PLST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	22-UNIMOD:4	ms_run[1]:scan=1.1.686.8	18.40903	4	3561.8397	3561.8613	K	A	166	199
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	203	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.725.3	19.45193	5	4113.1201	4113.1436	K	D	157	198
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	204	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.717.5	19.23937	5	4113.1201	4113.1436	K	D	157	198
PSM	GADNLVAINLIVQHIQDILNGGPSK	205	sp|Q9BZX2-2|UCK2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.1524.3	40.77627	4	2598.3965	2598.4129	R	R	61	86
PSM	QSGAFLSTSEGLILQLVGDAVHPQFK	206	sp|Q96AB3-2|ISOC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.1230.2	33.00828	4	2741.4241	2741.4388	R	E	169	195
PSM	NQAFLELATEEAAITMVNYYSAVTPHLR	207	sp|Q9UKA9-2|PTBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.1312.2	35.14942	4	3151.5401	3151.5648	K	N	95	123
PSM	TALLDAAGVASLLTTAEVVVTEIPK	208	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.1575.7	42.19142	3	2481.3811	2481.3942	R	E	527	552
PSM	GVDNTFADELVELSTALEHQEYITFLEDLK	209	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.1560.7	41.7816	4	3438.6637	3438.6718	R	S	247	277
PSM	DYVLNCSILNPLLTLLTK	210	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	6-UNIMOD:4	ms_run[1]:scan=1.1.1147.2	30.76562	3	2089.1344	2089.1493	R	S	203	221
PSM	DQQEAALVDMVNDGVEDLR	211	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.1549.2	41.46253	3	2115.9613	2115.9743	K	C	83	102
PSM	NDVLDSLGISPDLLPEDFVR	212	sp|Q9UBE0|SAE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.1548.3	41.43642	3	2213.1043	2213.1216	R	Y	274	294
PSM	LCYVALDFEQEMATAASSSSLEK	213	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	2-UNIMOD:4	ms_run[1]:scan=1.1.1506.8	40.29248	3	2549.1487	2549.1665	K	S	216	239
PSM	YSPDCIIIVVSNPVDILTYVTWK	214	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38	5-UNIMOD:4	ms_run[1]:scan=1.1.1028.5	27.56272	3	2694.3784	2694.3979	K	L	128	151
PSM	IQQLVQDIASLTLLEISDLNELLK	215	sp|P52815|RM12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.1570.4	42.05115	3	2708.5063	2708.5211	K	K	64	88
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	216	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	38		ms_run[1]:scan=1.1.402.5	10.78467	5	4436.2066	4436.2322	K	E	270	310
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	217	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.1585.3	42.45695	4	2988.518494	2987.524017	K	I	653	680
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	218	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.736.8	19.76292	3	2844.396971	2843.416381	R	N	766	791
PSM	IDLGVHVDGFIANVAHTFVVDVAQGTQVTGR	219	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.579.7	15.51477	4	3235.658494	3234.678561	K	K	108	139
PSM	YFILPDSLPLDTLLVDVEPK	220	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	38		ms_run[1]:scan=1.1.284.5	7.592834	3	2287.226471	2286.239903	R	V	67	87
PSM	NMAEQIIQEIYSQIQSK	221	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1.4	0.01703333	3	2021.9935	2022.0091	K	K	273	290
PSM	SGNYTVLQVVEALGSSLENPEPR	222	sp|Q96T76-5|MMS19_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.5.5	0.09396667	3	2458.2304	2458.2340	K	T	41	64
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	223	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.193.2	5.146133	6	3585.6745	3585.6942	R	R	85	117
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	224	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	11-UNIMOD:4	ms_run[1]:scan=1.1.440.3	11.80118	4	2908.4105	2908.4310	K	N	101	130
PSM	DQAVENILVSPVVVASSLGLVSLGGK	225	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.345.11	9.243816	3	2550.4102	2550.4269	K	A	61	87
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	226	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.304.10	8.137983	4	3585.6701	3585.6942	R	R	85	117
PSM	NLATAYDNFVELVANLK	227	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.219.4	5.836417	3	1893.9703	1893.9836	K	E	660	677
PSM	AAELFHQLSQALEVLTDAAAR	228	sp|Q9NVM6|DJC17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.246.3	6.5677	3	2253.1576	2253.1753	R	A	49	70
PSM	FGAQLAHIQALISGIEAQLGDVR	229	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.223.8	5.950467	3	2406.2860	2406.3019	R	A	331	354
PSM	PNSEPASLLELFNSIATQGELVR	230	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.87.6	2.298117	3	2484.2668	2484.2860	M	S	2	25
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	231	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.185.4	4.943417	5	3585.6736	3585.6942	R	R	85	117
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	232	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.844.5	22.61717	3	2934.4903	2934.4862	R	D	133	163
PSM	TLMEDVENSFFLNVNSQVTTVCQALAK	233	sp|P50897|PPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	22-UNIMOD:4	ms_run[1]:scan=1.1.666.3	17.86057	4	3057.4569	3057.4787	K	D	75	102
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	234	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	27-UNIMOD:4	ms_run[1]:scan=1.1.863.2	23.10258	6	3436.6777	3436.6973	R	R	85	117
PSM	LTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	235	sp|P13797-2|PLST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	22-UNIMOD:4	ms_run[1]:scan=1.1.679.6	18.21952	4	3561.8373	3561.8613	K	A	166	199
PSM	INALTAASEAACLIVSVDETIK	236	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	12-UNIMOD:4	ms_run[1]:scan=1.1.522.2	13.9897	3	2288.1808	2288.1933	R	N	296	318
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	237	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	27-UNIMOD:4	ms_run[1]:scan=1.1.946.4	25.34085	5	3436.6751	3436.6973	R	R	85	117
PSM	SLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVEK	238	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.800.4	21.47175	5	3903.0011	3903.0265	K	A	866	902
PSM	VHAELADVLTEAVVDSILAIK	239	sp|P40227-2|TCPZ_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1558.2	41.71745	3	2205.2119	2205.2256	K	K	115	136
PSM	YVVFFFYPLDFTFVCPTEIIAFSDR	240	sp|Q06830|PRDX1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	15-UNIMOD:4	ms_run[1]:scan=1.1.1569.4	42.02395	4	3092.4853	3092.5034	K	A	38	63
PSM	GLLPLVTILGLPNLPIDFPTSAACQAVAGVCK	241	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	24-UNIMOD:4,31-UNIMOD:4	ms_run[1]:scan=1.1.1361.4	36.44227	4	3304.7717	3304.7927	K	S	798	830
PSM	LPINHQIIYQLQDVFNLLPDVSLQEFVK	242	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1395.3	37.33895	4	3322.7757	3322.7965	K	A	220	248
PSM	KSEMESVLAQLDNYGQQELADLFVNYNVK	243	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1216.4	32.63215	4	3344.6065	3344.6234	K	S	236	265
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	244	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	27-UNIMOD:4	ms_run[1]:scan=1.1.1106.4	29.6733	4	3436.6737	3436.6973	R	R	85	117
PSM	TSANPLSTLSSHLSQQLAAAAGLAQSLASQSASISGVK	245	sp|Q9NSC2-2|SALL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1273.2	34.13125	4	3651.8841	3651.9067	R	Q	180	218
PSM	YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR	246	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1337.3	35.8217	4	4098.9909	4099.0149	K	K	337	373
PSM	YLASGAIDGIINIFDIATGK	247	sp|Q9GZS3|WDR61_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1088.3	29.17465	3	2051.0800	2051.0939	K	L	162	182
PSM	VNLSQDLEHQLQNIIQELNLEILPPPEDPSVPVALNIGK	248	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1558.10	41.73078	4	4326.2889	4326.3111	K	L	276	315
PSM	QDIFQEQLAAIPEFLNIGPLFK	249	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1299.3	34.79725	3	2530.3300	2530.3471	R	S	608	630
PSM	NLGNSCYLNSVVQVLFSIPDFQR	250	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	6-UNIMOD:4	ms_run[1]:scan=1.1.1185.4	31.80737	3	2669.3122	2669.3272	R	K	330	353
PSM	TISALAIAALAEAATPYGIESFDSVLK	251	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.1133.7	30.40178	3	2721.4267	2721.4476	R	P	703	730
PSM	NLSDLIDLVPSLCEDLLSSVDQPLK	252	sp|P47756-2|CAPZB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37	13-UNIMOD:4	ms_run[1]:scan=1.1.1561.8	41.81098	3	2782.4119	2782.4310	K	I	24	49
PSM	FFEGPVTGIFSGYVNSMLQEYAK	253	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	37		ms_run[1]:scan=1.1.125.6	3.32725	3	2583.2194	2583.2356	K	N	396	419
PSM	QDQIQQVVNHGLVPFLVSVLSK	254	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:28	ms_run[1]:scan=1.1.1561.6	41.80765	3	2430.3142	2430.3262	R	A	367	389
PSM	VNPTVFFDIAVDGEPLGR	255	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1	ms_run[1]:scan=1.1.1.3	0.0137	3	1986.9902	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	256	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	37	1-UNIMOD:1	ms_run[1]:scan=1.1.79.8	2.090517	2	1986.9912	1987.0042	M	V	2	20
PSM	TPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVR	257	sp|O43347|MSI1H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	37		ms_run[1]:scan=1.1.715.6	19.1871	4	3271.782094	3270.805007	R	G	251	285
PSM	DPEAPIFQVADYGIVADLFK	258	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.232.4	6.19165	3	2207.0977	2207.1150	K	V	253	273
PSM	ALDLFSDNAPPPELLEIINEDIAK	259	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.406.8	10.88938	3	2636.3521	2636.3585	R	R	317	341
PSM	AAELFHQLSQALEVLTDAAAR	260	sp|Q9NVM6|DJC17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.249.2	6.642033	4	2253.1589	2253.1753	R	A	49	70
PSM	TLLEGSGLESIISIIHSSLAEPR	261	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.230.2	6.129583	4	2421.2933	2421.3115	R	V	2483	2506
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	262	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.340.6	9.10875	4	3536.8597	3536.8813	K	A	311	345
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	263	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.200.7	5.33695	4	3585.6741	3585.6942	R	R	85	117
PSM	NTSELVSSEVYLLSALAALQK	264	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.67.3	1.759883	3	2235.1843	2235.1998	K	V	1746	1767
PSM	FFEGPVTGIFSGYVNSMLQEYAK	265	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.158.8	4.222883	3	2583.2203	2583.2356	K	N	396	419
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	266	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.279.10	7.46535	3	2784.5614	2784.5790	R	T	902	928
PSM	FDPTQFQDCIIQGLTETGTDLEAVAK	267	sp|Q7L1Q6-2|BZW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	9-UNIMOD:4	ms_run[1]:scan=1.1.447.5	12.00403	3	2896.3669	2896.3801	R	F	27	53
PSM	ASLDRPFTNLESAFYSIVGLSSLGAQVPDAK	268	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.306.11	8.191816	3	3252.6451	3252.6666	K	K	39	70
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	269	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.187.4	4.9939	5	3585.6736	3585.6942	R	R	85	117
PSM	SLPPVMAQNLSIPLAFACLLHLANEK	270	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	18-UNIMOD:4	ms_run[1]:scan=1.1.939.4	25.15898	4	2846.5025	2846.5186	R	N	697	723
PSM	GFGYAEFEDLDSLLSALSLNEESLGNRR	271	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.501.2	13.41683	4	3101.4745	3101.4941	K	I	138	166
PSM	TGAFSIPVIQIVYETLK	272	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.548.3	14.66905	3	1878.0391	1878.0502	K	D	53	70
PSM	TGAFSIPVIQIVYETLK	273	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.586.2	15.69567	3	1878.0394	1878.0502	K	D	53	70
PSM	TGAFSIPVIQIVYETLK	274	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.567.2	15.18328	3	1878.0394	1878.0502	K	D	53	70
PSM	ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK	275	sp|Q9H299|SH3L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	13-UNIMOD:4	ms_run[1]:scan=1.1.802.9	21.52263	4	3814.7801	3814.8036	K	L	59	92
PSM	SLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVEK	276	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.847.6	22.6948	4	3902.9909	3903.0265	K	A	866	902
PSM	INALTAASEAACLIVSVDETIK	277	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	12-UNIMOD:4	ms_run[1]:scan=1.1.561.2	15.01945	3	2288.1808	2288.1933	R	N	296	318
PSM	LANQFAIYKPVTDFFLQLVDAGK	278	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.667.8	17.89268	3	2597.3728	2597.3894	R	V	1244	1267
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	279	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.698.7	18.73382	3	2843.3980	2843.4164	R	N	766	791
PSM	LGDPAEYAHLVQAIIENPFLNGEVIR	280	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.602.6	16.14373	3	2877.4789	2877.5025	R	L	218	244
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	281	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	11-UNIMOD:4	ms_run[1]:scan=1.1.495.10	13.26457	3	2908.4125	2908.4310	K	N	101	130
PSM	VFQSSANYAENFIQSIISTVEPAQR	282	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.1244.2	33.38713	4	2798.3721	2798.3875	K	Q	28	53
PSM	GVQPLLDAVLEYLPNPSEVQNYAILNK	283	sp|Q96RP9-2|EFGM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.1154.2	30.96147	4	2996.5641	2996.5858	K	E	324	351
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	284	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	27-UNIMOD:4	ms_run[1]:scan=1.1.1379.5	36.90667	4	3512.6737	3512.6956	R	R	85	117
PSM	DAQVVQVVLDGLSNILK	285	sp|O00629|IMA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.1562.3	41.83057	3	1810.0081	1810.0200	K	M	424	441
PSM	DQEGQDVLLFIDNIFR	286	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.1394.2	37.30727	3	1920.9451	1920.9581	R	F	295	311
PSM	ETYEVLLSFIQAALGDQPR	287	sp|O75643-2|U520_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.1540.5	41.21881	3	2149.0900	2149.1055	R	D	111	130
PSM	TFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGR	288	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	29-UNIMOD:4	ms_run[1]:scan=1.1.1567.11	41.98105	4	4648.4069	4648.4291	K	L	142	184
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	289	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	27-UNIMOD:4	ms_run[1]:scan=1.1.1349.6	36.11715	5	3512.6746	3512.6956	R	R	85	117
PSM	AVNPDEAVAIGAAIQGGVLAGDVTDVLLLDVTPLSLGIETLGGVFTK	290	sp|P38646|GRP75_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.1579.4	42.2944	5	4588.4711	4588.4892	K	L	410	457
PSM	YDCGEEILITVLSAMTEEAAVAIK	291	sp|Q6IS14|IF5AL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36	3-UNIMOD:4	ms_run[1]:scan=1.1.1570.2	42.04782	4	2625.2825	2625.2917	K	A	127	151
PSM	SNEGKLEGLTDEFEELEFLSTINVGLTSIANLPK	292	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	36		ms_run[1]:scan=1.1.1558.8	41.72745	4	3706.8689	3706.8829	R	L	29	63
PSM	CAILTTLIHLVQGLGADSK	293	sp|Q9UI26|IPO11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1572.3	42.10367	3	1992.0572	1992.0712	R	N	621	640
PSM	MEYEWKPDEQGLQQILQLLK	294	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=1.1.423.6	11.35005	3	2530.2602	2530.2772	-	E	1	21
PSM	VNPTVFFDIAVDGEPLGR	295	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=1.1.41.4	1.052333	3	1986.9902	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	296	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	36	1-UNIMOD:1	ms_run[1]:scan=1.1.22.2	0.5367166	3	1986.9902	1987.0042	M	V	2	20
PSM	YFILPDSLPLDTLLVDVEPK	297	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	36		ms_run[1]:scan=1.1.246.4	6.574367	3	2287.226471	2286.239903	R	V	67	87
PSM	DPEAPIFQVADYGIVADLFK	298	sp|P13804-2|ETFA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.254.4	6.783783	3	2207.1085	2207.1150	K	V	253	273
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	299	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.403.4	10.8066	6	4436.2069	4436.2322	K	E	270	310
PSM	KPPTFGDASVIALELLNSGYEFDEGSIIFNK	300	sp|P36542-2|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.138.8	3.681217	4	3370.6757	3370.6973	R	F	159	190
PSM	GMTLVTPLQLLLFASK	301	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.374.3	10.01433	3	1730.9911	1731.0005	K	K	1058	1074
PSM	GEPGLEQPFWISSVAALLNTDLVATGSHSSCVR	302	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	31-UNIMOD:4	ms_run[1]:scan=1.1.419.3	11.23802	4	3497.7037	3497.7249	R	L	369	402
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	303	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.327.10	8.756184	4	3585.6717	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	304	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.266.10	7.113283	4	3585.6717	3585.6942	R	R	85	117
PSM	NPEILAIAPVLLDALTDPSR	305	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.409.3	10.9606	3	2117.1586	2117.1732	R	K	1571	1591
PSM	TVQDLTSVVQTLLQQMQDK	306	sp|O75506|HSBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.338.3	9.04145	3	2174.1082	2174.1253	K	F	8	27
PSM	FLESVEGNQNYPLLLLTLLEK	307	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.329.3	8.7985	3	2432.3038	2432.3202	K	S	32	53
PSM	FFEGPVTGIFSGYVNSMLQEYAK	308	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.120.11	3.1985	3	2583.2194	2583.2356	K	N	396	419
PSM	VHAELADVLTEAVVDSILAIKK	309	sp|P40227-2|TCPZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.658.2	17.63873	4	2333.3097	2333.3206	K	Q	115	137
PSM	IDLGVHVDGFIANVAHTFVVDVAQGTQVTGR	310	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.560.8	15.00245	4	3234.6597	3234.6786	K	K	54	85
PSM	IDLGVHVDGFIANVAHTFVVDVAQGTQVTGR	311	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.541.6	14.48945	4	3234.6593	3234.6786	K	K	54	85
PSM	NVLITSALPYVNNVPHLGNIIGCVLSADVFAR	312	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	23-UNIMOD:4	ms_run[1]:scan=1.1.716.7	19.21573	4	3435.8121	3435.8337	R	Y	265	297
PSM	SLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVEK	313	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.836.5	22.4142	4	3903.0017	3903.0265	K	A	866	902
PSM	INALTAASEAACLIVSVDETIK	314	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	12-UNIMOD:4	ms_run[1]:scan=1.1.580.6	15.54008	3	2288.1787	2288.1933	R	N	296	318
PSM	INALTAASEAACLIVSVDETIK	315	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	12-UNIMOD:4	ms_run[1]:scan=1.1.599.3	16.05243	3	2288.1772	2288.1933	R	N	296	318
PSM	IQFNDLQSLLCATLQNVLRK	316	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	11-UNIMOD:4	ms_run[1]:scan=1.1.909.5	24.3447	3	2373.2692	2373.2838	R	V	430	450
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	317	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.775.9	20.7947	3	2843.3986	2843.4164	R	N	766	791
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	318	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	11-UNIMOD:4	ms_run[1]:scan=1.1.691.4	18.5479	3	2908.4134	2908.4310	K	N	101	130
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	319	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.824.11	22.12042	3	2934.4675	2934.4862	R	D	133	163
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	320	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	27-UNIMOD:4	ms_run[1]:scan=1.1.950.2	25.44648	5	3436.6796	3436.6973	R	R	85	117
PSM	LLCSGHDVSDGGLVTCLLEMAFAGNCGLQVDVPVPR	321	sp|O15067|PUR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	35	3-UNIMOD:4,16-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.1049.7	28.13448	4	3855.8312941913205	3855.841622426389	R	V	903	939
PSM	TISALAIAALAEAATPYGIESFDSVLK	322	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.1137.3	30.49668	4	2721.4305	2721.4476	R	P	703	730
PSM	LGLALNFSVFYYEILNNPELACTLAK	323	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	22-UNIMOD:4	ms_run[1]:scan=1.1.1187.3	31.85143	4	2972.5165	2972.5357	R	T	168	194
PSM	AFAGDIANQLATDAVQILGGNGFNTEYPVEK	324	sp|P11310-2|ACADM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.1023.4	27.42558	4	3222.5601	3222.5833	K	L	363	394
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	325	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1071.3	28.72177	4	3528.6669	3528.6905	R	R	85	117
PSM	CGAIAEQTPILLLFLLR	326	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	1-UNIMOD:4	ms_run[1]:scan=1.1.1091.2	29.25393	3	1927.0843	1927.0965	R	N	1277	1294
PSM	ESQLALIVCPLEQLLQGINPR	327	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	9-UNIMOD:4	ms_run[1]:scan=1.1.1502.4	40.17652	3	2390.2867	2390.2991	R	T	869	890
PSM	LGSAADFLLDISETDLSSLTASIK	328	sp|O75369-2|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35		ms_run[1]:scan=1.1.1351.2	36.16535	3	2466.2623	2466.2741	K	A	1896	1920
PSM	LCYVALDFEQEMATAASSSSLEK	329	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	2-UNIMOD:4	ms_run[1]:scan=1.1.1545.9	41.36352	3	2549.1547	2549.1665	K	S	216	239
PSM	ICELLPEAAINDVYLAPLLQCLIEGLSAEPR	330	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	2-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.1564.8	41.89397	4	3479.7861	3479.8044	R	V	290	321
PSM	MTQIMFEAFNTPAMYVAIQAVLSLYASGR	331	sp|Q562R1|ACTBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	35	5-UNIMOD:35,14-UNIMOD:35	ms_run[1]:scan=1.1.1566.11	41.95373	3	3254.5894	3254.5814	K	T	120	149
PSM	DQQEAALVDMVNDGVEDLR	332	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35		ms_run[1]:scan=1.1.1454.3	38.8688	3	2116.969271	2115.974263	K	C	83	102
PSM	MEYEWKPDEQGLQQILQLLK	333	sp|Q92973-2|TNPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	35	1-UNIMOD:1	ms_run[1]:scan=1.1.442.4	11.85845	3	2530.2602	2530.2772	-	E	1	21
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	334	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.323.2	8.636517	5	3586.666118	3585.694213	R	R	85	117
PSM	DVTEALILQLFSQIGPCK	335	sp|P31483|TIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	17-UNIMOD:4	ms_run[1]:scan=1.1.856.3	22.91935	3	2032.057871	2031.071064	R	N	17	35
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	336	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	35	27-UNIMOD:4	ms_run[1]:scan=1.1.874.7	23.40865	4	3439.678494	3436.697307	R	R	85	117
PSM	RSVFQTINQFLDLTLFTHR	337	sp|P53985-2|MOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.83.2	2.183633	4	2335.2317	2335.2437	K	G	243	262
PSM	FGAQLAHIQALISGIEAQLGDVR	338	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.261.2	6.9666	4	2406.2853	2406.3019	R	A	331	354
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	339	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.278.2	7.423316	4	2784.5577	2784.5790	R	T	902	928
PSM	ILCQDNPSHNVFCSPVSISSALAMVLLGAK	340	sp|P50453|SPB9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	3-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.173.7	4.627584	4	3227.5945	3227.6141	K	G	18	48
PSM	AMTTGAIAAMLSTILYSR	341	sp|P20618|PSB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.170.3	4.53975	3	1869.9568	1869.9692	K	R	110	128
PSM	ERPPNPIEFLASYLLK	342	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.84.3	2.21215	3	1886.0197	1886.0301	K	N	75	91
PSM	TVQDLTSVVQTLLQQMQDK	343	sp|O75506|HSBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.353.3	9.446617	3	2174.1082	2174.1253	K	F	8	27
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	344	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.260.7	6.946233	3	2784.5614	2784.5790	R	T	902	928
PSM	SAGDLGIAVCNVPAASVEETADSTLCHILNLYR	345	sp|Q13363-2|CTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.58.11	1.5237	3	3515.6782	3515.7025	K	R	98	131
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	346	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.209.11	5.580917	3	3585.6712	3585.6942	R	R	85	117
PSM	RGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAK	347	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	5-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=1.1.164.9	4.3871	5	4373.1126	4373.1460	K	V	911	948
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	348	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	11-UNIMOD:4	ms_run[1]:scan=1.1.883.4	23.65408	3	2908.4254	2908.4310	K	N	101	130
PSM	TATFAISILQQIELDLK	349	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.562.2	15.04823	3	1903.0540	1903.0666	K	A	83	100
PSM	CAILTTLIHLVQGLGADSK	350	sp|Q9UI26-2|IPO11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	1-UNIMOD:4	ms_run[1]:scan=1.1.677.3	18.15568	3	2009.0845	2009.0979	R	N	661	680
PSM	QLASGLLELAFAFGGLCER	351	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	17-UNIMOD:4	ms_run[1]:scan=1.1.760.2	20.40862	3	2051.0392	2051.0510	K	L	1509	1528
PSM	VDQGTLFELILAANYLDIK	352	sp|P63208-2|SKP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.524.6	14.04402	3	2135.1379	2135.1514	K	G	95	114
PSM	QLNHFWEIVVQDGITLITK	353	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.769.4	20.64648	3	2253.2032	2253.2158	K	E	670	689
PSM	ADIWSFGITAIELATGAAPYHK	354	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.839.5	22.48502	3	2331.1750	2331.1899	K	Y	208	230
PSM	IQFNDLQSLLCATLQNVLRK	355	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	11-UNIMOD:4	ms_run[1]:scan=1.1.928.7	24.8634	3	2373.2692	2373.2838	R	V	430	450
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	356	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	27-UNIMOD:4	ms_run[1]:scan=1.1.938.6	25.1288	5	3436.6751	3436.6973	R	R	85	117
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	357	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.679.7	18.22285	3	2843.3953	2843.4164	R	N	766	791
PSM	FTVAMSPELIQQFLQATVSGLHETQPPSVR	358	sp|Q96P70|IPO9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.489.2	13.09053	4	3310.6813	3310.7020	R	I	505	535
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	359	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	27-UNIMOD:4	ms_run[1]:scan=1.1.951.2	25.47332	5	3436.6796	3436.6973	R	R	85	117
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	360	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.730.4	19.60047	5	4113.1201	4113.1436	K	D	157	198
PSM	DQQEAALVDMVNDGVEDLR	361	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1293.3	34.64608	3	2115.9643	2115.9743	K	C	83	102
PSM	AYLDQTVVPILLQGLAVLAK	362	sp|Q9C005|DPY30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1561.3	41.80265	3	2124.2410	2124.2558	R	E	55	75
PSM	VLTLSEDSPYETLHSFISNAVAPFFK	363	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1554.3	41.60548	4	2911.4465	2911.4644	R	S	137	163
PSM	IVPVDIYIPGCPPTAEALLYGILQLQR	364	sp|O75251|NDUS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	11-UNIMOD:4	ms_run[1]:scan=1.1.1164.2	31.23233	4	3008.6241	3008.6409	R	K	173	200
PSM	DSNTILLPSNPGDVTSMVAQAMGVYGALTK	365	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1215.3	32.61027	4	3049.4905	3049.5100	K	A	247	277
PSM	NLDIERPTYTNLNRLISQIVSSITASLR	366	sp|P68363|TBA1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1571.3	42.07655	4	3186.7169	3186.7360	R	F	216	244
PSM	SGDAPLTVNELGTAYVSATTGAVATALGLNALTK	367	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1114.6	29.88057	4	3246.6761	3246.6983	R	H	137	171
PSM	SAASYALGSISVGNLPEYLPFVLQEITSQPK	368	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1313.4	35.18462	4	3278.6829	3278.7074	K	R	874	905
PSM	AISCMGQIICNLGDNLGSDLPNTLQIFLER	369	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.1423.6	38.04998	4	3361.6301	3361.6469	R	L	589	619
PSM	AVGNIVTGDDIQTQVILNCSALQSLLHLLSSPK	370	sp|P52294|IMA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	19-UNIMOD:4	ms_run[1]:scan=1.1.1243.7	33.37187	4	3503.8397	3503.8658	R	E	319	352
PSM	DQEGQDVLLFIDNIFR	371	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1414.2	37.81168	3	1920.9451	1920.9581	R	F	295	311
PSM	DQEGQDVLLFIDNIFR	372	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1375.3	36.7954	3	1920.9451	1920.9581	R	F	295	311
PSM	TDMIQALGGVEGILEHTLFK	373	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1309.3	35.07023	3	2171.1172	2171.1296	R	G	1472	1492
PSM	LQSVQALTEIQEFISFISK	374	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1564.3	41.88563	3	2180.1532	2180.1729	K	Q	3129	3148
PSM	ELEAVCQDVLSLLDNYLIK	375	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	6-UNIMOD:4	ms_run[1]:scan=1.1.1467.2	39.21975	3	2234.1376	2234.1504	K	N	92	111
PSM	TLEEAVNNIITFLGMQPCER	376	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	18-UNIMOD:4	ms_run[1]:scan=1.1.1379.2	36.89833	3	2334.1213	2334.1348	K	S	793	813
PSM	LCYVALDFEQEMATAASSSSLEK	377	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	2-UNIMOD:4	ms_run[1]:scan=1.1.1107.4	29.69033	3	2549.1484	2549.1665	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	378	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34	2-UNIMOD:4	ms_run[1]:scan=1.1.1525.9	40.81353	3	2549.1487	2549.1665	K	S	216	239
PSM	NLPQYVSNELLEEAFSVFGQVER	379	sp|Q15233-2|NONO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1580.6	42.33275	3	2667.3025	2667.3180	R	A	65	88
PSM	GETSLQSSETHPPEVALPPVGEPPALENSTALLEGVNTVVVTTSAPEALLASWAR	380	sp|Q7L190|DPPA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.1241.4	33.31808	5	5618.8336	5618.8632	K	I	154	209
PSM	SREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEK	381	sp|Q8NFU3-3|TSTD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	34		ms_run[1]:scan=1.1.305.9	8.164833	4	4159.0465	4159.0782	R	P	28	68
PSM	QLNHFWEIVVQDGITLITK	382	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:28	ms_run[1]:scan=1.1.1567.3	41.96772	3	2236.1801	2236.1887	K	E	670	689
PSM	YSPDCIIIVVSNPVDILTYVTWK	383	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34	5-UNIMOD:4	ms_run[1]:scan=1.1.1162.7	31.18328	3	2695.379771	2694.397877	K	L	128	151
PSM	VNPTVFFDIAVDGEPLGR	384	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=1.1.117.2	3.102067	3	1986.9902	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	385	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=1.1.60.2	1.562583	3	1987.9922	1987.0042	M	V	2	20
PSM	DQEGQDVLLFIDNIFR	386	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.1434.4	38.33148	3	1921.944071	1920.958142	R	F	295	311
PSM	MEVVEAAAAQLETLK	387	sp|Q96HR8|NAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=1.1.1201.2	32.23938	2	1643.8292	1643.8432	-	F	1	16
PSM	GDKPIWEQIGSSFIQHYYQLFDNDR	388	sp|P61970|NTF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:1	ms_run[1]:scan=1.1.1558.4	41.72078	4	3099.4512	3097.4562	M	T	2	27
PSM	YFILPDSLPLDTLLVDVEPK	389	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.398.3	10.67607	3	2287.227371	2286.239903	R	V	67	87
PSM	YFILPDSLPLDTLLVDVEPK	390	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	34		ms_run[1]:scan=1.1.265.4	7.076267	3	2287.226471	2286.239903	R	V	67	87
PSM	QILLGIQELLNEPNIQDPAQAEAYTIYCQNR	391	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	34	1-UNIMOD:28,28-UNIMOD:4	ms_run[1]:scan=1.1.932.5	24.97488	4	3597.7532	3597.7772	K	V	111	142
PSM	DPPLAAVTTAVQELLR	392	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.109.2	2.886833	3	1692.9352	1692.9410	K	L	955	971
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	393	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.174.2	4.64635	6	3585.6745	3585.6942	R	R	85	117
PSM	LSVLDLVVALAPCADEAAISK	394	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	13-UNIMOD:4	ms_run[1]:scan=1.1.101.4	2.67435	3	2154.1444	2154.1606	R	L	651	672
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	395	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	11-UNIMOD:4	ms_run[1]:scan=1.1.380.4	10.17865	4	2908.4109	2908.4310	K	N	101	130
PSM	DLATALEQLLQAYPR	396	sp|P55957-2|BID_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.345.4	9.23215	3	1700.8954	1700.9097	R	D	172	187
PSM	PNSEPASLLELFNSIATQGELVR	397	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.40.10	1.03705	3	2484.2656	2484.2860	M	S	2	25
PSM	GEGTGVLGSLSLPLSELLVADQLCLDR	398	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	24-UNIMOD:4	ms_run[1]:scan=1.1.134.10	3.576417	3	2811.4495	2811.4688	R	W	877	904
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	399	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	4-UNIMOD:4	ms_run[1]:scan=1.1.138.11	3.686217	3	2830.4035	2830.4211	K	E	173	198
PSM	EVAETSMHNLLETDIEQVSQLSALVDAQLDYHR	400	sp|Q99961-2|SH3G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.432.4	11.58782	5	3753.7961	3753.8156	K	Q	147	180
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	401	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.694.3	18.6154	4	2875.5021	2875.5179	K	K	591	617
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	402	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	27-UNIMOD:4	ms_run[1]:scan=1.1.972.7	26.04823	4	3436.6729	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	403	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	27-UNIMOD:4	ms_run[1]:scan=1.1.914.9	24.48622	4	3436.6725	3436.6973	R	R	85	117
PSM	NVLITSALPYVNNVPHLGNIIGCVLSADVFAR	404	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	23-UNIMOD:4	ms_run[1]:scan=1.1.697.5	18.70327	4	3435.8121	3435.8337	R	Y	265	297
PSM	TATFAISILQQIELDLK	405	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.600.2	16.07473	3	1903.0531	1903.0666	K	A	83	100
PSM	VAACELLHSMVMFMLGK	406	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	4-UNIMOD:4	ms_run[1]:scan=1.1.829.2	22.2376	3	1935.9346	1935.9443	K	A	928	945
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	407	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	11-UNIMOD:4	ms_run[1]:scan=1.1.514.5	13.77757	3	2908.4119	2908.4310	K	N	101	130
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	408	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.729.4	19.56662	5	4113.1201	4113.1436	K	D	157	198
PSM	LPITVLNGAPGFINLCDALNAWQLVK	409	sp|P31939-2|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	16-UNIMOD:4	ms_run[1]:scan=1.1.633.7	16.9732	3	2836.5106	2836.5309	K	E	225	251
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	410	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	11-UNIMOD:4	ms_run[1]:scan=1.1.573.7	15.3552	3	2908.4125	2908.4310	K	N	101	130
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	411	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.686.2	18.39737	5	3113.6656	3113.6801	K	F	193	222
PSM	NVLITSALPYVNNVPHLGNIIGCVLSADVFAR	412	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	23-UNIMOD:4	ms_run[1]:scan=1.1.678.6	18.18923	4	3435.8121	3435.8337	R	Y	265	297
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	413	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	27-UNIMOD:4	ms_run[1]:scan=1.1.937.3	25.09665	5	3436.6751	3436.6973	R	R	85	117
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	414	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.721.4	19.3471	5	4113.1201	4113.1436	K	D	157	198
PSM	IQFNDLQSLLCATLQNVLR	415	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	11-UNIMOD:4	ms_run[1]:scan=1.1.1559.4	41.74878	3	2245.1740	2245.1889	R	K	430	449
PSM	IVPVDIYIPGCPPTAEALLYGILQLQR	416	sp|O75251|NDUS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	11-UNIMOD:4	ms_run[1]:scan=1.1.1183.3	31.7468	4	3008.6241	3008.6409	R	K	173	200
PSM	DGADIHSDLFISIAQALLGGTAR	417	sp|Q96EY1-2|DNJA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1131.5	30.34438	3	2340.1921	2340.2074	R	A	342	365
PSM	FCDAFNIPLITFVDVPGFLPGTAQEYGGIIR	418	sp|P05166-2|PCCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	2-UNIMOD:4	ms_run[1]:scan=1.1.1306.4	34.99588	4	3426.7085	3426.7323	R	H	400	431
PSM	GVDNTFADELVELSTALEHQEYITFLEDLK	419	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1562.11	41.8439	4	3438.6637	3438.6718	R	S	247	277
PSM	AVGNIVTGDDIQTQVILNCSALQSLLHLLSSPK	420	sp|P52294|IMA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	19-UNIMOD:4	ms_run[1]:scan=1.1.1224.2	32.84815	4	3503.8397	3503.8658	R	E	319	352
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	421	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	27-UNIMOD:4	ms_run[1]:scan=1.1.1329.5	35.60622	4	3512.6741	3512.6956	R	R	85	117
PSM	DQEGQDVLLFIDNIFR	422	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1453.4	38.8415	3	1920.9454	1920.9581	R	F	295	311
PSM	FVFEITQPPLLSISSDSLLSHVEQLLR	423	sp|Q9UI95|MD2L2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1557.10	41.70273	3	3067.6288	3067.6594	K	A	98	125
PSM	ESQLALIVCPLEQLLQGINPR	424	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	9-UNIMOD:4	ms_run[1]:scan=1.1.1483.5	39.65997	3	2390.2867	2390.2991	R	T	869	890
PSM	AVSDASAGDYGSAIETLVTAISLIK	425	sp|Q16630-2|CPSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1561.11	41.81598	2	2451.2654	2451.2744	R	Q	469	494
PSM	YSVWIGGSILASLSTFQQMWISK	426	sp|P60709|ACTB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1565.5	41.91652	3	2601.3127	2601.3301	K	Q	337	360
PSM	YSPDCIIIVVSNPVDILTYVTWK	427	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	5-UNIMOD:4	ms_run[1]:scan=1.1.1078.7	28.91447	3	2694.3784	2694.3979	K	L	128	151
PSM	YSPDCIIIVVSNPVDILTYVTWK	428	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	5-UNIMOD:4	ms_run[1]:scan=1.1.1047.11	28.08052	3	2694.3784	2694.3979	K	L	128	151
PSM	YSPDCIIIVVSNPVDILTYVTWK	429	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	5-UNIMOD:4	ms_run[1]:scan=1.1.1066.9	28.58988	3	2694.3784	2694.3979	K	L	128	151
PSM	VFQSSANYAENFIQSIISTVEPAQR	430	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1224.3	32.85315	3	2798.3734	2798.3875	K	Q	28	53
PSM	TLMVDPSQEVQENYNFLLQLQEELLK	431	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1380.4	36.94035	4	3120.5501	3120.5689	R	E	289	315
PSM	HGFFVNPSDSVAVIAANIFSIPYFQQTGVR	432	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1134.5	30.42207	4	3280.6449	3280.6670	K	G	300	330
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	433	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1319.3	35.33624	5	3503.9166	3503.9392	K	S	754	787
PSM	SYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDR	434	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1473.11	39.39803	5	4832.2541	4832.2875	R	H	230	275
PSM	EITAIESSVPCQLLESVLQELK	435	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33	11-UNIMOD:4	ms_run[1]:scan=1.1.1423.5	38.04665	3	2485.2820	2485.2985	R	G	635	657
PSM	KSEMESVLAQLDNYGQQELADLFVNYNVK	436	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	33		ms_run[1]:scan=1.1.1197.6	32.1283	4	3344.6065	3344.6234	K	S	236	265
PSM	IPQVTTHWLEILQALLLSSNQELQHR	437	sp|Q9H3U1|UN45A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33		ms_run[1]:scan=1.1.1035.4	27.74887	4	3067.632894	3066.661454	R	G	856	882
PSM	QQLSSLITDLQSSISNLSQAK	438	sp|Q14980|NUMA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:28	ms_run[1]:scan=1.1.1097.4	29.43083	2	2243.1472	2243.1642	K	E	462	483
PSM	SDPAVNAQLDGIISDFEALK	439	sp|Q9UHD8-5|SEPT9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=1.1.348.2	9.312917	3	2145.0522	2144.0632	M	R	2	22
PSM	ASTVVAVGLTIAAAGFAGR	440	sp|Q96DA6|TIM14_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	33	1-UNIMOD:1	ms_run[1]:scan=1.1.1572.6	42.10867	2	1772.9706	1772.9780	M	Y	2	21
PSM	GPFSLQATLCWLDLLLAALECYNTFIGER	441	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	33	10-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.1581.6	42.35092	4	3369.624894	3370.673007	R	T	1246	1275
PSM	AIPDLTAPVAAVQAAVSNLVR	442	sp|P18206-2|VINC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.22.6	0.5433834	3	2075.1631	2075.1739	K	V	36	57
PSM	ALDLFSDNAPPPELLEIINEDIAK	443	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.357.5	9.567984	3	2636.3593	2636.3585	R	R	317	341
PSM	VFTPGQGNNVYIFPGVALAVILCNTR	444	sp|P23368|MAOM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	23-UNIMOD:4	ms_run[1]:scan=1.1.449.2	12.0449	4	2819.4613	2819.4793	R	H	459	485
PSM	LSVLDLVVALAPCADEAAISK	445	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	13-UNIMOD:4	ms_run[1]:scan=1.1.139.4	3.701633	3	2154.1444	2154.1606	R	L	651	672
PSM	ECANGYLELLDHVLLTLQK	446	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	2-UNIMOD:4	ms_run[1]:scan=1.1.130.3	3.456417	3	2228.1364	2228.1511	R	P	2242	2261
PSM	TGDAISVMSEVAQTLLTQDVR	447	sp|Q99943|PLCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.178.3	4.75555	3	2233.1119	2233.1260	R	V	152	173
PSM	GMTLVTPLQLLLFASK	448	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.393.2	10.52622	3	1730.9908	1731.0005	K	K	1058	1074
PSM	AFAVVASALGIPSLLPFLK	449	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.69.2	1.805583	3	1913.1244	1913.1390	R	A	631	650
PSM	FYPEDVAEELIQDITQK	450	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.434.2	11.63728	3	2036.9821	2036.9942	K	L	84	101
PSM	VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKK	451	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	21-UNIMOD:4	ms_run[1]:scan=1.1.218.8	5.821267	4	4208.1709	4208.1927	R	Q	59	100
PSM	NPEILAIAPVLLDALTDPSR	452	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.433.2	11.6099	3	2117.1586	2117.1732	R	K	1571	1591
PSM	NPEILAIAPVLLDALTDPSR	453	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.428.4	11.47765	3	2117.1586	2117.1732	R	K	1571	1591
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	454	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	5-UNIMOD:4	ms_run[1]:scan=1.1.100.10	2.657333	4	4320.1537	4320.1835	K	A	198	238
PSM	RGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAK	455	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	5-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=1.1.154.11	4.119483	4	4373.1189	4373.1460	K	V	911	948
PSM	YSEPDLAVDFDNFVCCLVR	456	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.163.4	4.351666	3	2318.0185	2318.0348	R	L	663	682
PSM	TLLEGSGLESIISIIHSSLAEPR	457	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.192.8	5.130067	3	2421.2983	2421.3115	R	V	2483	2506
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	458	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	11-UNIMOD:4	ms_run[1]:scan=1.1.672.9	18.03367	3	2908.4608	2908.4310	K	N	101	130
PSM	FSNLVLQALLVLLKK	459	sp|P46459-2|NSF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.891.2	23.85467	3	1698.0697	1698.0807	R	A	524	539
PSM	DLVEAVAHILGIR	460	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.758.2	20.33937	2	1404.8000	1404.8089	R	D	2126	2139
PSM	SLPPVMAQNLSIPLAFACLLHLANEK	461	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	18-UNIMOD:4	ms_run[1]:scan=1.1.958.5	25.665	4	2846.5025	2846.5186	R	N	697	723
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	462	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.591.3	15.83238	5	3585.6681	3585.6942	R	R	85	117
PSM	FTVAMSPELIQQFLQATVSGLHETQPPSVR	463	sp|Q96P70|IPO9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.501.3	13.42183	4	3310.6813	3310.7020	R	I	505	535
PSM	TGAFSIPVIQIVYETLK	464	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.605.2	16.20983	3	1878.0385	1878.0502	K	D	53	70
PSM	FYPEDVAEELIQDITQK	465	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.492.3	13.17167	3	2036.9812	2036.9942	K	L	84	101
PSM	GLNTIPLFVQLLYSPIENIQR	466	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.967.7	25.9104	3	2427.3388	2427.3526	R	V	592	613
PSM	GLNTIPLFVQLLYSPIENIQR	467	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.948.6	25.39938	3	2427.3388	2427.3526	R	V	592	613
PSM	LLTAPELILDQWFQLSSSGPNSR	468	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.659.7	17.68095	3	2571.3166	2571.3333	R	L	574	597
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	469	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	11-UNIMOD:4	ms_run[1]:scan=1.1.474.11	12.69788	3	2908.4149	2908.4310	K	N	101	130
PSM	IDLGVHVDGFIANVAHTFVVDVAQGTQVTGR	470	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.563.3	15.0753	5	3234.6576	3234.6786	K	K	54	85
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	471	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	27-UNIMOD:4	ms_run[1]:scan=1.1.889.3	23.80225	5	3436.6786	3436.6973	R	R	85	117
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	472	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.733.4	19.67175	5	4113.1201	4113.1436	K	D	157	198
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	473	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.722.6	19.38092	5	4113.1201	4113.1436	K	D	157	198
PSM	GPAPDPCLVPLALEALVGAVHVLHASR	474	sp|Q6ZNJ1|NBEL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	32	7-UNIMOD:4	ms_run[1]:scan=1.1.1190.4	31.93573	4	2758.4792941913206	2758.49524002268	R	A	239	266
PSM	EITAIESSVPCQLLESVLQELK	475	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	11-UNIMOD:4	ms_run[1]:scan=1.1.1426.2	38.13223	4	2485.2793	2485.2985	R	G	635	657
PSM	TALLDAAGVASLLTTAEVVVTEIPKEEK	476	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.1565.2	41.91152	4	2867.5577	2867.5743	R	D	527	555
PSM	AGHWVVLDELNLASQSVLEGLNACFDHR	477	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	24-UNIMOD:4	ms_run[1]:scan=1.1.1092.4	29.286	4	3149.5149	3149.5353	K	G	1816	1844
PSM	AISCMGQIICNLGDNLGSDLPNTLQIFLER	478	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.1442.7	38.55122	4	3361.6301	3361.6469	R	L	589	619
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	479	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	27-UNIMOD:4	ms_run[1]:scan=1.1.1327.2	35.5473	6	3512.6743	3512.6956	R	R	85	117
PSM	DYVISLGVVKPLLSFISPSIPITFLR	480	sp|O00629|IMA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.1555.10	41.64583	3	2873.6533	2873.6670	R	N	193	219
PSM	DQQEAALVDMVNDGVEDLR	481	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.1435.4	38.34878	3	2115.9595	2115.9743	K	C	83	102
PSM	YSPDCIIIVVSNPVDILTYVTWK	482	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	5-UNIMOD:4	ms_run[1]:scan=1.1.1052.8	28.21238	3	2694.3784	2694.3979	K	L	128	151
PSM	VFQSSANYAENFIQSIISTVEPAQR	483	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.1257.4	33.74077	3	2798.3701	2798.3875	K	Q	28	53
PSM	SGDAPLTVNELGTAYVSATTGAVATALGLNALTK	484	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.1132.9	30.37485	3	3246.6772	3246.6983	R	H	137	171
PSM	KSEMESVLAQLDNYGQQELADLFVNYNVK	485	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.1211.3	32.49873	5	3344.6006	3344.6234	K	S	236	265
PSM	FFEGPVTGIFSGYVNSMLQEYAK	486	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.144.8	3.8437	3	2583.2203	2583.2356	K	N	396	419
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	487	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.188.8	5.028217	4	3585.6741	3585.6942	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	488	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	27-UNIMOD:4	ms_run[1]:scan=1.1.1125.7	30.18248	4	3436.6709	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	489	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32	27-UNIMOD:4	ms_run[1]:scan=1.1.1553.11	41.59013	3	3436.6855	3436.6973	R	R	85	117
PSM	LQADDFLQDYTLLINILHSEDLGK	490	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.831.7	22.30458	3	2773.3984	2773.4174	R	D	421	445
PSM	KSEMESVLAQLDNYGQQELADLFVNYNVK	491	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.1214.2	32.57668	5	3344.6006	3344.6234	K	S	236	265
PSM	PYTLMSMVANLLYEK	492	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	32		ms_run[1]:scan=1.1.506.3	13.55072	3	1771.8778	1771.8888	K	R	84	99
PSM	SLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVEK	493	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.821.5	22.02945	5	3904.003118	3903.026563	K	A	866	902
PSM	ASVSELACIYSALILHDDEVTVTEDK	494	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1554.10	41.61715	3	2919.3912	2919.4052	M	I	2	28
PSM	VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKK	495	sp|P52565|GDIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32	21-UNIMOD:4	ms_run[1]:scan=1.1.199.11	5.31755	4	4209.166894	4208.192643	R	Q	59	100
PSM	QLTEMLPSILNQLGADSLTSLRR	496	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=1.1.1069.4	28.6642	3	2538.3282	2538.3472	K	L	142	165
PSM	VNPTVFFDIAVDGEPLGR	497	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=1.1.79.3	2.077183	3	1986.9912	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	498	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=1.1.98.2	2.588267	3	1986.9912	1987.0042	M	V	2	20
PSM	QIFNVNNLNLPQVALSFGFK	499	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:28	ms_run[1]:scan=1.1.905.2	24.23192	3	2245.1732	2245.1892	K	V	597	617
PSM	GDKPIWEQIGSSFIQHYYQLFDNDR	500	sp|P61970|NTF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	32	1-UNIMOD:1	ms_run[1]:scan=1.1.1557.11	41.7044	3	3098.5262	3097.4562	M	T	2	27
PSM	SGLTGLVIGGLYPVFLAIPVNGGLAAR	501	sp|Q9H061|T126A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	32		ms_run[1]:scan=1.1.271.3	7.243134	3	2625.481571	2624.505394	R	Y	106	133
PSM	ALDLFSDNAPPPELLEIINEDIAK	502	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.98.5	2.5966	3	2636.3434	2636.3585	R	R	317	341
PSM	HAQPALLYLVPACIGFPVLVALAK	503	sp|Q8TCT9-2|HM13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	13-UNIMOD:4	ms_run[1]:scan=1.1.290.3	7.750933	4	2560.4433	2560.4603	K	G	314	338
PSM	VNDVVPWVLDVILNK	504	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.96.2	2.534167	3	1721.9617	1721.9716	K	H	935	950
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	505	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.418.8	11.21767	4	3585.6693	3585.6942	R	R	85	117
PSM	YGLIPEEFFQFLYPK	506	sp|P24539|AT5F1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.219.3	5.83475	3	1889.9470	1889.9604	R	T	56	71
PSM	FIYITPEELAAVANFIR	507	sp|Q96HY6|DDRGK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.85.4	2.240867	3	1966.0432	1966.0564	K	Q	268	285
PSM	YFILPDSLPLDTLLVDVEPK	508	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.341.5	9.125783	3	2286.2266	2286.2399	R	V	67	87
PSM	IDIVTLLEGPIFDYGNISGTR	509	sp|Q12955-4|ANK3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.269.6	7.189283	3	2292.1855	2292.2002	R	S	1552	1573
PSM	VFTPGQGNNVYIFPGVALAVILCNTR	510	sp|P23368|MAOM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	23-UNIMOD:4	ms_run[1]:scan=1.1.437.5	11.73	3	2819.4586	2819.4793	R	H	459	485
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	511	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	4-UNIMOD:4	ms_run[1]:scan=1.1.157.10	4.199167	3	2830.4023	2830.4211	K	E	173	198
PSM	LANQFAIYKPVTDFFLQLVDAGK	512	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.705.2	18.91108	4	2597.3749	2597.3894	R	V	1244	1267
PSM	DVTEALILQLFSQIGPCK	513	sp|P31483-2|TIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	17-UNIMOD:4	ms_run[1]:scan=1.1.836.2	22.40087	3	2031.0586	2031.0711	R	N	17	35
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	514	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.762.3	20.44908	4	2843.3993	2843.4164	R	N	766	791
PSM	LGDPAEYAHLVQAIIENPFLNGEVIR	515	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.600.5	16.07973	4	2877.4817	2877.5025	R	L	218	244
PSM	EQQLQSTLQQAQGFHSEIEDFLLELTR	516	sp|Q9UPN3-2|MACF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.553.2	14.80968	4	3187.5589	3187.5786	R	M	4366	4393
PSM	VGAGSLPDFLPFLLEQIEAEPR	517	sp|O75155-2|CAND2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.912.2	24.43575	3	2397.2416	2397.2580	R	R	795	817
PSM	GPGTSFEFALAIVEALNGK	518	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.821.2	22.02445	3	1919.9869	1919.9993	R	E	157	176
PSM	ITLDAQDVLAHLVQMAFK	519	sp|P55196-1|AFAD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.854.2	22.86835	3	2012.0620	2012.0765	R	Y	695	713
PSM	NGFLNLALPFFGFSEPLAAPR	520	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.610.3	16.34582	3	2277.1801	2277.1946	K	H	884	905
PSM	AELATEEFLPVTPILEGFVILR	521	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.973.5	26.06853	3	2456.3413	2456.3566	R	K	721	743
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	522	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.717.9	19.24603	3	2843.4013	2843.4164	R	N	766	791
PSM	IDLGVHVDGFIANVAHTFVVDVAQGTQVTGR	523	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.568.3	15.21037	5	3234.6586	3234.6786	K	K	54	85
PSM	ALQSNIIPFCDEVMQLLLENLGNENVHR	524	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	10-UNIMOD:4	ms_run[1]:scan=1.1.940.4	25.17928	5	3265.6001	3265.6223	R	S	535	563
PSM	NVLITSALPYVNNVPHLGNIIGCVLSADVFAR	525	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	23-UNIMOD:4	ms_run[1]:scan=1.1.695.3	18.64253	5	3435.8126	3435.8337	R	Y	265	297
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	526	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	27-UNIMOD:4	ms_run[1]:scan=1.1.964.2	25.82338	5	3436.6736	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	527	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	27-UNIMOD:4	ms_run[1]:scan=1.1.990.2	26.5241	5	3436.6751	3436.6973	R	R	85	117
PSM	LTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	528	sp|P13797-2|PLST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	22-UNIMOD:4	ms_run[1]:scan=1.1.685.9	18.38198	4	3561.8397	3561.8613	K	A	166	199
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	529	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	27-UNIMOD:4	ms_run[1]:scan=1.1.1349.4	36.11382	6	3512.6767	3512.6956	R	R	85	117
PSM	YLASGAIDGIINIFDIATGK	530	sp|Q9GZS3|WDR61_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.1068.4	28.63545	3	2051.0800	2051.0939	K	L	162	182
PSM	DVTEVLILQLFSQIGPCK	531	sp|Q01085-2|TIAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	17-UNIMOD:4	ms_run[1]:scan=1.1.1237.3	33.2001	3	2059.0888	2059.1024	R	S	19	37
PSM	DLVILLYETALLSSGFSLEDPQTHANR	532	sp|P07900-2|HS90A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.1557.4	41.69273	4	3001.5365	3001.5396	K	I	783	810
PSM	YVVLFFYPLDFTFVCPTEIIAFSNR	533	sp|P32119-2|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	15-UNIMOD:4	ms_run[1]:scan=1.1.1564.6	41.89063	4	3057.5237	3057.5351	K	A	37	62
PSM	GFLEFVEDFIQVPR	534	sp|P51114-2|FXR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.1032.2	27.6593	3	1694.8540	1694.8668	R	N	277	291
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	535	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1052.7	28.20905	4	3528.6669	3528.6905	R	R	85	117
PSM	DVTEVLILQLFSQIGPCK	536	sp|Q01085-2|TIAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	17-UNIMOD:4	ms_run[1]:scan=1.1.1256.2	33.70621	3	2059.0885	2059.1024	R	S	19	37
PSM	DYVLNCSILNPLLTLLTK	537	sp|O60684|IMA7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	6-UNIMOD:4	ms_run[1]:scan=1.1.1166.3	31.28463	3	2089.1344	2089.1493	R	S	203	221
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	538	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1047.3	28.06718	5	3528.6661	3528.6905	R	R	85	117
PSM	ELEAVCQDVLSLLDNYLIK	539	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	6-UNIMOD:4	ms_run[1]:scan=1.1.1510.4	40.39488	3	2234.1376	2234.1504	K	N	92	111
PSM	EITAIESSVPCQLLESVLQELK	540	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31	11-UNIMOD:4	ms_run[1]:scan=1.1.1402.2	37.52392	3	2485.2805	2485.2985	R	G	635	657
PSM	VLTLSEDSPYETLHSFISNAVAPFFK	541	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.1553.7	41.58347	3	2911.4446	2911.4644	R	S	137	163
PSM	IQPGSQQADFLDALIVSMDVIQHETIGK	542	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.1551.10	41.53188	3	3052.5352	3052.5539	K	K	98	126
PSM	TLMVDPSQEVQENYNFLLQLQEELLK	543	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.1399.6	37.4503	3	3120.5512	3120.5689	R	E	289	315
PSM	GETSLQSSETHPPEVALPPVGEPPALENSTALLEGVNTVVVTTSAPEALLASWAR	544	sp|Q7L190|DPPA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.1261.5	33.8303	5	5618.8336	5618.8632	K	I	154	209
PSM	TAQAIEPYITNFFNQVLMLGK	545	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.1303.2	34.90325	3	2397.2236	2397.2402	R	T	225	246
PSM	DAAHLVNQDDPNVLEIWNLVFIQYNR	546	sp|P49588-2|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	31		ms_run[1]:scan=1.1.366.4	9.8046	4	3095.5213	3095.5465	R	E	207	233
PSM	LANQFAIYKPVTDFFLQLVDAGK	547	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.704.4	18.89885	3	2598.377771	2597.389361	R	V	1244	1267
PSM	ERPPNPIEFLASYLLK	548	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.46.2	1.183983	3	1888.020371	1886.030185	K	N	75	91
PSM	GKYVVLFFYPLDFTFVCPTEIIAFSNR	549	sp|P32119|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	17-UNIMOD:4	ms_run[1]:scan=1.1.1280.5	34.31438	4	3243.638094	3242.651466	K	A	35	62
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	550	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.225.8	6.004066	4	3586.672094	3585.694213	R	R	85	117
PSM	QNLQQLNSDISAITTWLK	551	sp|Q8WXH0|SYNE2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28	ms_run[1]:scan=1.1.1024.2	27.44597	3	2055.0472	2055.0632	K	K	6551	6569
PSM	IDLGVHVDGFIANVAHTFVVDVAQGTQVTGR	552	sp|Q9UQ80|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.569.3	15.23728	5	3235.662118	3234.678561	K	K	108	139
PSM	TGAFSIPVIQIVYETLK	553	sp|Q92499|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	31		ms_run[1]:scan=1.1.509.2	13.63032	3	1879.038071	1878.050252	K	D	53	70
PSM	TQFLPPNLLALFAPR	554	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:1	ms_run[1]:scan=1.1.1565.6	41.91818	2	1738.9675	1738.9765	M	D	2	17
PSM	QLSQSLLPAIVELAEDAK	555	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	31	1-UNIMOD:28	ms_run[1]:scan=1.1.772.3	20.7035	3	1908.0132	1907.0242	R	W	399	417
PSM	LCYVALDFEQEMATAASSSSLEK	556	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.54.6	1.40855	3	2549.1541	2549.1665	K	S	216	239
PSM	FDPTQFQDCIIQGLTETGTDLEAVAK	557	sp|Q7L1Q6-2|BZW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	9-UNIMOD:4	ms_run[1]:scan=1.1.467.4	12.50808	3	2896.3609	2896.3801	R	F	27	53
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	558	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.437.2	11.72	5	3585.6651	3585.6942	R	R	85	117
PSM	DAAHLVNQDDPNVLEIWNLVFIQYNR	559	sp|P49588-2|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.346.4	9.25895	4	3095.5241	3095.5465	R	E	207	233
PSM	GEPGLEQPFWISSVAALLNTDLVATGSHSSCVR	560	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	31-UNIMOD:4	ms_run[1]:scan=1.1.438.5	11.75033	4	3497.7037	3497.7249	R	L	369	402
PSM	SAGDLGIAVCNVPAASVEETADSTLCHILNLYR	561	sp|Q13363-2|CTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.57.10	1.495083	4	3515.6781	3515.7025	K	R	98	131
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	562	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.214.2	5.699333	6	3585.6769	3585.6942	R	R	85	117
PSM	VGLPLLSPEFLLTGVLK	563	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.127.2	3.373233	3	1795.0759	1795.0859	R	Q	1791	1808
PSM	VFTPGQGNNVYIFPGVALAVILCNTR	564	sp|P23368|MAOM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	23-UNIMOD:4	ms_run[1]:scan=1.1.449.6	12.05823	3	2819.4589	2819.4793	R	H	459	485
PSM	ERPPNPIEFLASYLLK	565	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.65.2	1.697583	3	1886.0194	1886.0301	K	N	75	91
PSM	AFAVVASALGIPSLLPFLK	566	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.54.2	1.400217	3	1913.1244	1913.1390	R	A	631	650
PSM	GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEK	567	sp|O95983-2|MBD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	9-UNIMOD:4	ms_run[1]:scan=1.1.200.9	5.343616	4	3880.9317	3880.9551	K	N	132	171
PSM	STTTAEDIEQFLLNYLK	568	sp|O43156|TTI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.397.2	10.6358	3	1984.9840	1984.9993	K	E	802	819
PSM	FYPEDVAEELIQDITQK	569	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.377.5	10.09903	3	2036.9797	2036.9942	K	L	84	101
PSM	FYPEDVAEELIQDITQK	570	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.453.2	12.15338	3	2036.9821	2036.9942	K	L	84	101
PSM	GDLENAFLNLVQCIQNKPLYFADR	571	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	13-UNIMOD:4	ms_run[1]:scan=1.1.64.5	1.67905	4	2837.4009	2837.4170	K	L	268	292
PSM	ASLDRPFTNLESAFYSIVGLSSLGAQVPDAK	572	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.326.9	8.727467	4	3252.6473	3252.6666	K	K	39	70
PSM	QLNHFWEIVVQDGITLITK	573	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.789.2	21.15858	4	2253.2013	2253.2158	K	E	670	689
PSM	SLEGDLEDLKDQIAQLEASLAAAK	574	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.900.2	24.09712	4	2527.2837	2527.3017	K	K	158	182
PSM	SLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVEK	575	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.821.9	22.03612	4	3903.0017	3903.0265	K	A	866	902
PSM	VTTLSDVVVGLESFIGSER	576	sp|Q96EB1-2|ELP4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.590.2	15.8053	3	2007.0373	2007.0525	R	E	317	336
PSM	AGLTVDPVIVEAFLASLSNR	577	sp|P42356|PI4KA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.655.4	17.56097	3	2071.1185	2071.1313	K	L	579	599
PSM	EGISINCGLLALGNVISALGDK	578	sp|Q7Z4S6-2|KI21A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	7-UNIMOD:4	ms_run[1]:scan=1.1.714.2	19.15518	3	2213.1592	2213.1725	K	S	293	315
PSM	AVFSDSLVPALEAFGLEGVFR	579	sp|Q6L8Q7-2|PDE12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.650.4	17.43062	3	2223.1474	2223.1576	R	I	355	376
PSM	SDIANILDWMLNQDFTTAYR	580	sp|P40937-2|RFC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1000.6	26.7998	3	2386.1131	2386.1263	K	N	224	244
PSM	LCYVALDFEQEMATAASSSSLEK	581	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.933.4	24.99683	3	2549.1508	2549.1665	K	S	216	239
PSM	VLQAVVDSLQGGLDSSVSFVSQVLGK	582	sp|Q9Y4R8|TELO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.942.10	25.24457	3	2631.3943	2631.4120	R	A	195	221
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	583	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.727.4	19.50917	5	4113.1201	4113.1436	K	D	157	198
PSM	KYSVWIGGSILASLSTFQQMWISK	584	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1449.5	38.74203	3	2729.4250	2729.4251	R	Q	336	360
PSM	YGAVDPLLALLAVPDMSSLACGYLR	585	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	21-UNIMOD:4	ms_run[1]:scan=1.1.1537.3	41.13283	4	2664.3465	2664.3655	K	N	203	228
PSM	VFQSSANYAENFIQSIISTVEPAQR	586	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1222.2	32.79102	4	2798.3661	2798.3875	K	Q	28	53
PSM	YAGLQPYLDQINVIEEQVAALEQAAYK	587	sp|Q6QNY1-2|BL1S2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1266.2	33.95112	4	3036.5237	3036.5444	K	L	55	82
PSM	IPQVTTHWLEILQALLLSSNQELQHR	588	sp|Q9H3U1-2|UN45A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1059.3	28.39442	4	3066.6421	3066.6614	R	G	841	867
PSM	IIVENLFYPVTLDVLHQIFSKFGTVLK	589	sp|P26599-2|PTBP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1562.7	41.83723	4	3132.7401	3132.7627	R	I	186	213
PSM	IFNNQEFAQLLAQSVNHGFETVYELTK	590	sp|Q15797|SMAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1371.4	36.68772	4	3139.5393	3139.5614	K	M	382	409
PSM	YLVTFSPLMDTQDDPQAIIIWDILTGHK	591	sp|P55884-2|EIF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1044.4	27.99268	4	3229.6153	3229.6369	R	K	387	415
PSM	GFLEFVEDFIQVPR	592	sp|P51114-2|FXR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1013.2	27.14827	3	1694.8540	1694.8668	R	N	277	291
PSM	VIVVWVGTNNHENTAEEVAGGIEAIVQLINTR	593	sp|P68402-2|PA1B2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1559.7	41.75378	4	3444.7849	3444.8001	K	Q	97	129
PSM	DAIITCNPEEFIVEALQLPNFQQSVQEYR	594	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	6-UNIMOD:4	ms_run[1]:scan=1.1.1091.8	29.2656	4	3450.6517	3450.6765	R	R	342	371
PSM	DAIITCNPEEFIVEALQLPNFQQSVQEYR	595	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	6-UNIMOD:4	ms_run[1]:scan=1.1.1102.4	29.56042	4	3450.6517	3450.6765	R	R	342	371
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	596	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	27-UNIMOD:4	ms_run[1]:scan=1.1.1398.3	37.41965	4	3512.6753	3512.6956	R	R	85	117
PSM	TVLDLAVVLFETATLR	597	sp|P14625|ENPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1566.4	41.94207	2	1759.9988	1760.0084	K	S	709	725
PSM	GHYTEGAELVDSVLDVVR	598	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1459.4	39.00422	3	1957.9630	1957.9745	K	K	104	122
PSM	IILVILDAISNIFQAAEK	599	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1570.2	42.04782	3	1970.1292	1970.1452	K	L	436	454
PSM	IILVILDAISNIFQAAEK	600	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1571.8	42.08488	2	1970.1362	1970.1452	K	L	436	454
PSM	ALMLQGVDLLADAVAVTMGPK	601	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1040.3	27.88135	3	2112.1060	2112.1323	R	G	38	59
PSM	GHAADVFEAYTQLLTEMVLR	602	sp|Q5T4S7-2|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1286.3	34.44903	3	2263.1110	2263.1307	K	L	3147	3167
PSM	AELATEEFLPVTPILEGFVILR	603	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1011.4	27.10562	3	2456.3332	2456.3566	R	K	721	743
PSM	LGSAADFLLDISETDLSSLTASIK	604	sp|O75369-2|FLNB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1371.5	36.69105	3	2466.2551	2466.2741	K	A	1896	1920
PSM	AGTLTVEELGATLTSLLAQAQAQAR	605	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1185.2	31.7957	3	2512.3312	2512.3497	R	A	2477	2502
PSM	LCYVALDFEQEMATAASSSSLEK	606	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.1548.9	41.44641	3	2549.1547	2549.1665	K	S	216	239
PSM	LCYVALDFEQEMATAASSSSLEK	607	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	2-UNIMOD:4	ms_run[1]:scan=1.1.1126.5	30.20938	3	2549.1490	2549.1665	K	S	216	239
PSM	YSPDCIIIVVSNPVDILTYVTWK	608	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	5-UNIMOD:4	ms_run[1]:scan=1.1.1085.8	29.10195	3	2694.3784	2694.3979	K	L	128	151
PSM	VGYTPDVLTDTTAELAVSLLLTTCR	609	sp|Q9UBQ7|GRHPR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	24-UNIMOD:4	ms_run[1]:scan=1.1.1368.4	36.61027	3	2708.3761	2708.3943	R	R	100	125
PSM	GKYVVLFFYPLDFTFVCPTEIIAFSNR	610	sp|P32119-2|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	17-UNIMOD:4	ms_run[1]:scan=1.1.1297.3	34.7536	3	3242.6302	3242.6515	K	A	35	62
PSM	VDIVAINDPFIDLNYMVYMFQYDSTHGK	611	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1556.11	41.67603	3	3307.5433	3307.5570	K	F	28	56
PSM	KSEMESVLAQLDNYGQQELADLFVNYNVK	612	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1210.2	32.46663	5	3344.6006	3344.6234	K	S	236	265
PSM	ETPFELIEALLKYIETLNVPGAVLVFLPGWNLIYTMQK	613	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1592.2	42.62415	4	4362.3349	4362.3629	K	H	631	669
PSM	WSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKR	614	sp|P49459-2|UBE2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1229.6	32.99138	5	4461.1491	4461.1724	R	E	66	106
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	615	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1354.3	36.25245	5	3528.6661	3528.6905	R	R	85	117
PSM	GIHSAIDASQTPDVVFASILAAFSK	616	sp|P54819-2|KAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.263.3	7.020633	4	2544.3077	2544.3224	R	A	205	230
PSM	VDIVAINDPFIDLNYMVYMFQYDSTHGK	617	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.1555.6	41.63917	4	3307.5429	3307.5570	K	F	28	56
PSM	SGPPGEEAQVASQFIADVIENSQIIQK	618	sp|Q96B26|EXOS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	30		ms_run[1]:scan=1.1.161.6	4.301033	4	2854.4129	2854.4348	R	E	95	122
PSM	DQQEAALVDMVNDGVEDLR	619	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.1511.5	40.4238	3	2116.968371	2115.974263	K	C	83	102
PSM	FTVAMSPELIQQFLQATVSGLHETQPPSVR	620	sp|Q96P70|IPO9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30		ms_run[1]:scan=1.1.470.10	12.58797	4	3311.678494	3310.701998	R	I	505	535
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	621	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.629.4	16.8687	4	3586.666094	3585.694213	R	R	85	117
PSM	CIALAQLLVEQNFPAIAIHR	622	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.976.2	26.14437	4	2259.2096	2259.2193	R	G	300	320
PSM	ASVSELACIYSALILHDDEVTVTEDK	623	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1311.3	35.1309	3	2919.3812	2919.4052	M	I	2	28
PSM	ASVSELACIYSALILHDDEVTVTEDK	624	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1138.4	30.53715	3	2919.3842	2919.4052	M	I	2	28
PSM	VNPTVFFDIAVDGEPLGR	625	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=1.1.270.2	7.211133	3	1986.9956	1987.0046	M	V	2	20
PSM	QIFNVNNLNLPQVALSFGFK	626	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28	ms_run[1]:scan=1.1.886.4	23.72287	3	2245.1732	2245.1892	K	V	597	617
PSM	MEVVEAAAAQLETLK	627	sp|Q96HR8|NAF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:1	ms_run[1]:scan=1.1.1220.3	32.7454	2	1643.8302	1643.8432	-	F	1	16
PSM	QAAPCVLFFDELDSIAK	628	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	30	1-UNIMOD:28,5-UNIMOD:4	ms_run[1]:scan=1.1.528.3	14.14725	3	1906.9092	1905.9182	R	A	568	585
PSM	AVGNIVTGDDIQTQVILNCSALQSLLHLLSSPK	629	sp|P52294|IMA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	30	19-UNIMOD:4	ms_run[1]:scan=1.1.1234.3	33.1294	3	3504.836171	3503.865769	R	E	319	352
PSM	ALDLFSDNAPPPELLEIINEDIAK	630	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.252.2	6.728066	3	2636.3437	2636.3585	R	R	317	341
PSM	AGNYEEALQLYQHAVQYFLHVVK	631	sp|O75351|VPS4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.217.3	5.781367	4	2719.3553	2719.3758	K	Y	24	47
PSM	FDPTQFQDCIIQGLTETGTDLEAVAK	632	sp|Q7L1Q6-2|BZW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	9-UNIMOD:4	ms_run[1]:scan=1.1.445.2	11.93662	4	2896.3589	2896.3801	R	F	27	53
PSM	KGQEQVLGDLSMILCDPFAINTLALSTVR	633	sp|Q8WX92|NELFB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	15-UNIMOD:4	ms_run[1]:scan=1.1.273.4	7.298717	4	3188.6441	3188.6573	K	H	292	321
PSM	LGLIEWLENTVTLK	634	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.206.2	5.486784	3	1627.9093	1627.9185	R	D	3800	3814
PSM	VNDVVPWVLDVILNK	635	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.77.3	2.023317	3	1721.9617	1721.9716	K	H	935	950
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	636	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.285.6	7.617967	4	3585.6693	3585.6942	R	R	85	117
PSM	AQELLLILDEYWQNHPELHDIPIYYASSLAK	637	sp|Q9UKF6|CPSF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.262.4	7.006917	4	3681.8453	3681.8718	R	K	246	277
PSM	AFAVVASALGIPSLLPFLK	638	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.57.11	1.49675	2	1913.1262	1913.1390	R	A	631	650
PSM	FYPEDVAEELIQDITQK	639	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.396.5	10.61198	3	2036.9797	2036.9942	K	L	84	101
PSM	SFDPFTEVIVDGIVANALR	640	sp|Q01970-2|PLCB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.247.2	6.589467	3	2062.0588	2062.0735	K	V	644	663
PSM	GSGTQLFDHIAECLANFMDK	641	sp|P52789|HXK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	13-UNIMOD:4	ms_run[1]:scan=1.1.42.3	1.077667	3	2253.0037	2253.0194	R	L	121	141
PSM	TLLEGSGLESIISIIHSSLAEPR	642	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.270.3	7.216133	3	2421.2869	2421.3115	R	V	2483	2506
PSM	AHITLGCAADVEAVQTGLDLLEILR	643	sp|P09543-2|CN37_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	7-UNIMOD:4	ms_run[1]:scan=1.1.391.7	10.48048	3	2677.3909	2677.4109	R	Q	309	334
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	644	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.317.3	8.474883	5	3536.8571	3536.8813	K	A	311	345
PSM	GDLENAFLNLVQCIQNKPLYFADR	645	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	13-UNIMOD:4	ms_run[1]:scan=1.1.85.7	2.245867	4	2837.4009	2837.4170	K	L	268	292
PSM	NWYIQATCATSGDGLYEGLDWLANQLK	646	sp|P61204-2|ARF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	8-UNIMOD:4	ms_run[1]:scan=1.1.204.11	5.449266	3	3086.4232	3086.4444	R	N	115	142
PSM	ILCQDNPSHNVFCSPVSISSALAMVLLGAK	647	sp|P50453|SPB9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	3-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.150.11	4.011467	3	3227.6002	3227.6141	K	G	18	48
PSM	VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKK	648	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	21-UNIMOD:4	ms_run[1]:scan=1.1.226.4	6.031017	5	4208.1636	4208.1927	R	Q	59	100
PSM	ALMLQGVDLLADAVAVTMGPK	649	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.953.2	25.52553	4	2112.1177	2112.1323	R	G	38	59
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	650	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.713.4	19.1299	4	2875.5021	2875.5179	K	K	591	617
PSM	GSVPLGLATVLQDLLR	651	sp|Q8WUX9-2|CHMP7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.666.2	17.85723	3	1650.9580	1650.9669	K	R	85	101
PSM	LTPGCEAEAETEAICFFVQQFTDMEHNR	652	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	5-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.715.7	19.18877	4	3329.4229	3329.4427	K	V	2355	2383
PSM	LTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	653	sp|P13797-2|PLST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	22-UNIMOD:4	ms_run[1]:scan=1.1.684.8	18.35328	4	3561.8397	3561.8613	K	A	166	199
PSM	TATFAISILQQIELDLK	654	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.619.3	16.58685	3	1903.0531	1903.0666	K	A	83	100
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	655	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	11-UNIMOD:4	ms_run[1]:scan=1.1.533.5	14.29232	3	2908.4155	2908.4310	K	N	101	130
PSM	SMNINLWSEITELLYK	656	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.743.3	19.93877	3	1952.9794	1952.9917	R	D	551	567
PSM	FYPEDVAEELIQDITQK	657	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.664.3	17.8065	3	2036.9815	2036.9942	K	L	84	101
PSM	FYPEDVAEELIQDITQK	658	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.511.2	13.69112	3	2036.9830	2036.9942	K	L	84	101
PSM	DLSEELEALKTELEDTLDTTAAQQELR	659	sp|P35580-2|MYH10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.976.5	26.1527	4	3060.4793	3060.4986	R	T	1159	1186
PSM	FSGNFLVNLLGQWADVSGGGPAR	660	sp|Q9H9S3-2|S61A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.785.4	21.06043	3	2361.1717	2361.1866	R	S	312	335
PSM	GLNTIPLFVQLLYSPIENIQR	661	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.986.4	26.42222	3	2427.3388	2427.3526	R	V	592	613
PSM	WTAISALEYGVPVTLIGEAVFAR	662	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.720.4	19.31857	3	2462.3059	2462.3209	K	C	253	276
PSM	WTAISALEYGVPVTLIGEAVFAR	663	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.744.3	19.96948	3	2462.3059	2462.3209	K	C	253	276
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	664	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	27-UNIMOD:4	ms_run[1]:scan=1.1.962.3	25.76965	5	3436.6736	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	665	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	27-UNIMOD:4	ms_run[1]:scan=1.1.971.3	26.01133	5	3436.6736	3436.6973	R	R	85	117
PSM	TSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLK	666	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.987.5	26.4492	5	4845.5601	4845.5857	R	R	729	773
PSM	QGLLGAPPAMPLLNGPALSTALLQLALQTQGQK	667	sp|Q8IY67|RAVR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	29		ms_run[1]:scan=1.1.1278.3	34.2624	4	3309.8016941913206	3309.8482679147196	K	K	359	392
PSM	LCYVALDFEQEMATAASSSSLEK	668	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	2-UNIMOD:4	ms_run[1]:scan=1.1.1059.4	28.39942	3	2549.1376	2549.1665	K	S	216	239
PSM	AGTLTVEELGATLTSLLAQAQAQAR	669	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1183.2	31.7418	4	2512.3317	2512.3497	R	A	2477	2502
PSM	YSPDCIIIVVSNPVDILTYVTWK	670	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	5-UNIMOD:4	ms_run[1]:scan=1.1.1043.4	27.96072	4	2694.3781	2694.3979	K	L	128	151
PSM	YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR	671	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1350.2	36.13877	6	4098.9841	4099.0149	K	K	337	373
PSM	SHCIAEVENDEMPADLPSLAADFVESK	672	sp|P02768-2|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	3-UNIMOD:4	ms_run[1]:scan=1.1.1460.5	39.03342	4	2973.3185	2973.3372	K	D	119	146
PSM	YAGLQPYLDQINVIEEQVAALEQAAYK	673	sp|Q6QNY1-2|BL1S2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1287.5	34.47557	4	3036.5237	3036.5444	K	L	55	82
PSM	SAASYALGSISVGNLPEYLPFVLQEITSQPK	674	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1332.3	35.68645	4	3278.6865	3278.7074	K	R	874	905
PSM	TIDPQEPPWVEVLVEILLALLAQPSHLMR	675	sp|Q9BQG0-2|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1584.5	42.431	4	3306.7837	3306.8050	K	Q	639	668
PSM	VDIVAINDPFIDLNYMVYMFQYDSTHGK	676	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	19-UNIMOD:35	ms_run[1]:scan=1.1.1162.6	31.17995	4	3323.5333	3323.5519	K	F	28	56
PSM	DYPVVSIEDPFDQDDWGAWQK	677	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1544.8	41.3344	3	2509.0912	2509.1074	K	F	193	214
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	678	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	27-UNIMOD:4	ms_run[1]:scan=1.1.1019.7	27.32248	4	3436.6725	3436.6973	R	R	85	117
PSM	YSPDCIIIVVSNPVDILTYVTWK	679	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	5-UNIMOD:4	ms_run[1]:scan=1.1.1123.9	30.13162	3	2694.3799	2694.3979	K	L	128	151
PSM	TELDSFLIEITANILK	680	sp|P52209-2|6PGD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1562.4	41.83223	3	1818.9856	1818.9978	K	F	213	229
PSM	EQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK	681	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1554.2	41.60383	6	4084.0231	4084.0403	R	R	260	301
PSM	IQDALSTVLQYAEDVLSGK	682	sp|O00303|EIF3F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1564.10	41.8973	2	2049.0514	2049.0630	R	V	279	298
PSM	GYTSWAIGLSVADLAESIMK	683	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1008.3	27.01133	3	2111.0488	2111.0609	K	N	275	295
PSM	DQQEAALVDMVNDGVEDLR	684	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1492.6	39.90675	3	2115.9601	2115.9743	K	C	83	102
PSM	DQQEAALVDMVNDGVEDLR	685	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1530.4	40.9423	3	2115.9613	2115.9743	K	C	83	102
PSM	LAELNSYVPVTAYTGPLVEDFLSGFQVVVLTNTPLEDQLR	686	sp|P22314-2|UBA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1572.11	42.117	4	4407.2697	4407.2890	R	V	95	135
PSM	ILVQQTLNILQQLAVAMGPNIK	687	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1054.5	28.2595	3	2404.3666	2404.3876	K	Q	915	937
PSM	SAASYALGSISVGNLPEYLPFVLQEITSQPK	688	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1305.8	34.96885	3	3278.6872	3278.7074	K	R	874	905
PSM	KSEMESVLAQLDNYGQQELADLFVNYNVK	689	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1205.2	32.33204	5	3344.6006	3344.6234	K	S	236	265
PSM	RSVFQTINQFLDLTLFTHR	690	sp|P53985-2|MOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.88.2	2.31835	4	2335.2265	2335.2437	K	G	243	262
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	691	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	27-UNIMOD:4	ms_run[1]:scan=1.1.1270.3	34.06237	4	3436.6713	3436.6973	R	R	85	117
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	692	sp|P56545-2|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.469.2	12.56238	3	3527.7232	3527.7388	K	R	655	688
PSM	SDQTNILSALLVLLQDSLLATASSPK	693	sp|Q14008-2|CKAP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1575.9	42.19475	3	2697.4618	2697.4800	K	F	1619	1645
PSM	RGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAK	694	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29	5-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=1.1.162.6	4.327983	5	4373.1126	4373.1460	K	V	911	948
PSM	SNEGKLEGLTDEFEELEFLSTINVGLTSIANLPK	695	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	29		ms_run[1]:scan=1.1.1559.8	41.75545	4	3706.8689	3706.8829	R	L	29	63
PSM	GMTLVTPLQLLLFASK	696	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.381.10	10.21568	2	1731.989447	1731.000465	K	K	1058	1074
PSM	SHCIAEVENDEMPADLPSLAADFVESK	697	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	3-UNIMOD:4	ms_run[1]:scan=1.1.1479.8	39.55582	4	2974.317694	2973.337204	K	D	311	338
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	698	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.399.5	10.6934	5	3586.669618	3585.694213	R	R	85	117
PSM	TQFLPPNLLALFAPR	699	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=1.1.1564.8	41.89397	2	1738.9675	1738.9765	M	D	2	17
PSM	TATFAISILQQIELDLK	700	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.715.2	19.18043	3	1904.058371	1903.066630	K	A	83	100
PSM	ADAASQVLLGSGLTILSQPLMYVK	701	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:1	ms_run[1]:scan=1.1.1490.8	39.8555	3	2516.3392	2516.3552	M	V	2	26
PSM	CANLFEALVGTLK	702	sp|Q9P1F3|ABRAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1106.3	29.66663	2	1417.7171	1417.7270	K	A	39	52
PSM	CIECVQPQSLQFIIDAFK	703	sp|Q14671|PUM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	29	1-UNIMOD:385,1-UNIMOD:4,4-UNIMOD:4	ms_run[1]:scan=1.1.872.3	23.34527	3	2179.0352	2178.0482	K	G	977	995
PSM	QSGAFLSTSEGLILQLVGDAVHPQFK	704	sp|Q96AB3|ISOC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29		ms_run[1]:scan=1.1.1226.4	32.90888	3	2740.410071	2741.438831	R	E	153	179
PSM	YLVLFFYPLDFTFVCPTEIVAFSDK	705	sp|P30048|PRDX3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	29	15-UNIMOD:4	ms_run[1]:scan=1.1.1565.9	41.92318	3	3031.493171	3030.512907	K	A	94	119
PSM	NMAEQIIQEIYSQIQSK	706	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	28		ms_run[1]:scan=1.1.9.2	0.1914833	4	2021.9948941913199	2022.0091912832102	K	K	265	282
PSM	NQSLFCWEIPVQIVSHL	707	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	6-UNIMOD:4	ms_run[1]:scan=1.1.1.5	0.02036667	3	2069.0446	2069.0404	K	-	135	152
PSM	AGAAPYVQAFDSLLAGPVAEYLK	708	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.4.3	0.07216667	3	2350.1851	2350.2209	K	I	38	61
PSM	LCYVALDFEQEMATAASSSSLEK	709	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	2-UNIMOD:4	ms_run[1]:scan=1.1.76.8	2.00455	3	2549.1571	2549.1665	K	S	216	239
PSM	ALDLFSDNAPPPELLEIINEDIAK	710	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.7.8	0.1499167	3	2636.3392	2636.3585	R	R	317	341
PSM	DQAVENILVSPVVVASSLGLVSLGGK	711	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.342.2	9.147933	4	2550.4057	2550.4269	K	A	61	87
PSM	SNILEAWSEGVALLQDVR	712	sp|Q9BUA3|SPNDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.126.4	3.349433	3	1999.0279	1999.0374	K	A	126	144
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	713	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.298.3	7.962983	4	2784.5577	2784.5790	R	T	902	928
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	714	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	4-UNIMOD:4	ms_run[1]:scan=1.1.132.4	3.5121	4	2830.4009	2830.4211	K	E	173	198
PSM	TVQDLTSVVQTLLQQMQDK	715	sp|O75506|HSBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.372.6	9.965266	3	2174.1091	2174.1253	K	F	8	27
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	716	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.405.6	10.85925	6	4436.2021	4436.2322	K	E	270	310
PSM	VLELAQLLDQIWR	717	sp|Q9P2I0|CPSF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.325.2	8.688867	3	1595.8957	1595.9035	R	T	243	256
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	718	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.425.6	11.4077	5	4436.2086	4436.2322	K	E	270	310
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	719	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.332.6	8.889417	4	3585.6717	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	720	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.438.6	11.75367	4	3585.6693	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	721	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.458.7	12.29642	4	3585.6741	3585.6942	R	R	85	117
PSM	GLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGR	722	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	6-UNIMOD:4	ms_run[1]:scan=1.1.288.11	7.707433	4	3749.8845	3749.9127	R	S	117	151
PSM	YGLIPEEFFQFLYPK	723	sp|P24539|AT5F1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.200.2	5.328617	3	1889.9461	1889.9604	R	T	56	71
PSM	YGLIPEEFFQFLYPK	724	sp|P24539|AT5F1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.179.2	4.78085	3	1889.9485	1889.9604	R	T	56	71
PSM	YGLIPEEFFQFLYPK	725	sp|P24539|AT5F1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.261.3	6.969934	3	1889.9494	1889.9604	R	T	56	71
PSM	FYPEDVAEELIQDITQK	726	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.339.3	9.068383	3	2036.9821	2036.9942	K	L	84	101
PSM	FYPEDVAEELIQDITQK	727	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.358.2	9.579967	3	2036.9827	2036.9942	K	L	84	101
PSM	AAELFHQLSQALEVLTDAAAR	728	sp|Q9NVM6|DJC17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.265.3	7.0746	3	2253.1576	2253.1753	R	A	49	70
PSM	YFILPDSLPLDTLLVDVEPK	729	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.360.3	9.6356	3	2286.2266	2286.2399	R	V	67	87
PSM	IDIVTLLEGPIFDYGNISGTR	730	sp|Q12955-4|ANK3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.249.4	6.650367	3	2292.1855	2292.2002	R	S	1552	1573
PSM	PNSEPASLLELFNSIATQGELVR	731	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.84.8	2.220483	3	2484.2656	2484.2860	M	S	2	25
PSM	SGLTGLVIGGLYPVFLAIPVNGGLAAR	732	sp|Q9H061-2|T126A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.290.6	7.760933	3	2624.4871	2624.5054	R	Y	36	63
PSM	ALDLFSDNAPPPELLEIINEDIAK	733	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.140.11	3.740417	3	2636.3392	2636.3585	R	R	317	341
PSM	YALQMEQLNGILLHLESELAQTR	734	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.244.6	6.52035	3	2669.3674	2669.3846	R	A	331	354
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	735	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.238.11	6.35965	4	3601.6669	3601.6891	R	R	85	117
PSM	LCYVALDFEQEMATAASSSSLEK	736	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	2-UNIMOD:4	ms_run[1]:scan=1.1.661.4	17.7351	3	2549.1514	2549.1665	K	S	216	239
PSM	IPIPLMDYILNVMK	737	sp|Q7Z6Z7-2|HUWE1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.930.3	24.91407	3	1658.9017	1658.9139	R	F	762	776
PSM	INALTAASEAACLIVSVDETIK	738	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	12-UNIMOD:4	ms_run[1]:scan=1.1.552.2	14.77755	4	2288.1817	2288.1933	R	N	296	318
PSM	AEVQNLGGELVVSGVDSAMSLIQAAK	739	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.483.2	12.92643	4	2585.3193	2585.3371	K	N	428	454
PSM	SANYCHTSQGDPIGLILLGEVALGNMYELK	740	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.779.5	20.89948	4	3262.5833	3262.6002	K	H	904	934
PSM	ALQSNIIPFCDEVMQLLLENLGNENVHR	741	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	10-UNIMOD:4	ms_run[1]:scan=1.1.924.4	24.74902	4	3265.6025	3265.6223	R	S	535	563
PSM	WTAISALEYGVPVTLIGEAVFAR	742	sp|P52209-2|6PGD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.758.6	20.34603	3	2462.3059	2462.3209	K	C	253	276
PSM	NVLITSALPYVNNVPHLGNIIGCVLSADVFAR	743	sp|P56192-2|SYMC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	23-UNIMOD:4	ms_run[1]:scan=1.1.707.9	18.97997	4	3435.8121	3435.8337	R	Y	265	297
PSM	TGAFSIPVIQIVYETLK	744	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.528.2	14.14558	3	1878.0391	1878.0502	K	D	53	70
PSM	GPGTSFEFALAIVEALNGK	745	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.802.2	21.51097	3	1919.9869	1919.9993	R	E	157	176
PSM	GPGTSFEFALAIVEALNGK	746	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.841.2	22.53162	3	1919.9869	1919.9993	R	E	157	176
PSM	FGVICLEDLIHEIAFPGK	747	sp|Q6DKI1|RL7L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.563.4	15.07697	3	2057.0521	2057.0656	K	H	180	198
PSM	VALFYLLNPYTILSCVAK	748	sp|Q9H490-2|PIGU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	15-UNIMOD:4	ms_run[1]:scan=1.1.1002.2	26.8506	3	2084.1151	2084.1380	K	S	120	138
PSM	ALMLQGVDLLADAVAVTMGPK	749	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.909.3	24.34137	3	2112.1198	2112.1323	R	G	38	59
PSM	TSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLK	750	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.965.2	25.85188	6	4845.5593	4845.5857	R	R	729	773
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	751	sp|P56545-2|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.494.8	13.239	3	3527.7172	3527.7388	K	R	655	688
PSM	TCNLILIVLDVLKPLGHK	752	sp|Q9Y295|DRG1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	2-UNIMOD:4	ms_run[1]:scan=1.1.1118.2	29.98168	4	2045.1973	2045.2071	R	K	141	159
PSM	NIPLLFLQNITGFMVGR	753	sp|Q9HCC0-2|MCCB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1119.2	30.01027	3	1932.0508	1932.0655	R	E	357	374
PSM	YSPDCIIIVVSNPVDILTYVTWK	754	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	5-UNIMOD:4	ms_run[1]:scan=1.1.1050.2	28.14653	4	2694.3781	2694.3979	K	L	128	151
PSM	DQQEAALVDMVNDGVEDLR	755	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1415.2	37.83728	3	2115.9631	2115.9743	K	C	83	102
PSM	MASCLEVLDLFLNQPHMVLSSFVLAEK	756	sp|P49327|FAS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	4-UNIMOD:4	ms_run[1]:scan=1.1.1542.4	41.27234	4	3090.5401	3090.5592	R	A	2088	2115
PSM	AFAGDIANQLATDAVQILGGNGFNTEYPVEK	757	sp|P11310-2|ACADM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1011.3	27.09895	4	3222.5601	3222.5833	K	L	363	394
PSM	AVSDASAGDYGSAIETLVTAISLIK	758	sp|Q16630-2|CPSF6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1562.10	41.84223	3	2451.2602	2451.2744	R	Q	469	494
PSM	EGISQEALHTQMLTAVQEISHLIEPLANAAR	759	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1188.2	31.88843	4	3369.7145	3369.7350	R	A	1691	1722
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	760	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	27-UNIMOD:4	ms_run[1]:scan=1.1.1202.5	32.26295	4	3436.6721	3436.6973	R	R	85	117
PSM	CGAIAEQTPILLLFLLR	761	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	1-UNIMOD:4	ms_run[1]:scan=1.1.1110.3	29.76777	3	1927.0843	1927.0965	R	N	1277	1294
PSM	TDMIQALGGVEGILEHTLFK	762	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1277.5	34.23314	3	2171.1172	2171.1296	R	G	1472	1492
PSM	ELEAVCQDVLSLLDNYLIK	763	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	6-UNIMOD:4	ms_run[1]:scan=1.1.1486.5	39.74163	3	2234.1376	2234.1504	K	N	92	111
PSM	IQFNDLQSLLCATLQNVLR	764	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	11-UNIMOD:4	ms_run[1]:scan=1.1.1560.10	41.7866	2	2245.1758	2245.1889	R	K	430	449
PSM	TYVLQNSTLPSIWDMGLELFR	765	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1115.8	29.91078	3	2482.2424	2482.2566	R	T	59	80
PSM	SFSLLQEAIIPYIPTLITQLTQK	766	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1558.7	41.72578	3	2616.4600	2616.4778	R	L	579	602
PSM	SHCIAEVENDEMPADLPSLAADFVESK	767	sp|P02768-2|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	3-UNIMOD:4	ms_run[1]:scan=1.1.1499.10	40.10453	3	2973.3229	2973.3372	K	D	119	146
PSM	LPINHQIIYQLQDVFNLLPDVSLQEFVK	768	sp|P51665|PSMD7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1376.5	36.8257	4	3322.7757	3322.7965	K	A	220	248
PSM	IVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHR	769	sp|O95372|LYPA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	20-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=1.1.1303.3	34.90825	5	4045.1141	4045.1434	R	A	116	154
PSM	ICELLPEAAINDVYLAPLLQCLIEGLSAEPR	770	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	2-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.1565.6	41.91818	4	3479.7861	3479.8044	R	V	290	321
PSM	DLVVLLFETALLSSGFSLEDPQTHSNR	771	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.1576.6	42.21703	4	2987.5077	2987.5240	K	I	653	680
PSM	TFIVGDQISFADYNLLDLLLIHEVLAPGCLDAFPLLSAYVGR	772	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	29-UNIMOD:4	ms_run[1]:scan=1.1.1564.11	41.89897	4	4648.4089	4648.4291	K	L	142	184
PSM	ETQPPETVQNWIELLSGETWNPLK	773	sp|Q9H4A6|GOLP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.624.9	16.73087	3	2808.3802	2808.3970	K	L	142	166
PSM	NLGNSCYLNSVVQVLFSIPDFQR	774	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28	6-UNIMOD:4	ms_run[1]:scan=1.1.1166.2	31.2813	4	2669.3113	2669.3272	R	K	330	353
PSM	EQPGNTISAGQEDFPSVLLETAASLPSLSPLSAASFK	775	sp|Q9NQC3-6|RTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	28		ms_run[1]:scan=1.1.541.7	14.49278	4	3758.8653	3758.8890	K	E	5	42
PSM	DQQEAALVDMVNDGVEDLR	776	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.1313.2	35.17295	3	2116.960871	2115.974263	K	C	83	102
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	777	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	27-UNIMOD:4	ms_run[1]:scan=1.1.952.9	25.51045	4	3437.674894	3436.697307	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	778	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.649.4	17.40512	4	3586.670094	3585.694213	R	R	85	117
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	779	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	11-UNIMOD:4	ms_run[1]:scan=1.1.592.11	15.87287	3	2909.418971	2908.431045	K	N	101	130
PSM	CILVITWIQHLIPK	780	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1571.4	42.07822	2	1715.9682	1715.9792	K	I	118	132
PSM	VNPTVFFDIAVDGEPLGR	781	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=1.1.158.2	4.212883	3	1987.9922	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	782	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=1.1.155.10	4.145083	2	1986.9922	1987.0042	M	V	2	20
PSM	DQEGQDVLLFIDNIFR	783	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.1355.2	36.27768	3	1921.962971	1920.958142	R	F	295	311
PSM	CALMEALVLISNQFK	784	sp|Q9HAV4|XPO5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1579.3	42.29273	2	1718.8622	1718.8732	K	N	646	661
PSM	QILLGIQELLNEPNIQDPAQAEAYTIYCQNR	785	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28,28-UNIMOD:4	ms_run[1]:scan=1.1.951.6	25.48665	4	3597.7532	3597.7772	K	V	111	142
PSM	QILLGIQELLNEPNIQDPAQAEAYTIYCQNR	786	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:28,28-UNIMOD:4	ms_run[1]:scan=1.1.913.7	24.456	4	3597.7532	3597.7772	K	V	111	142
PSM	NLSDLIDLVPSLCEDLLSSVDQPLK	787	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28	13-UNIMOD:4	ms_run[1]:scan=1.1.1563.3	41.85822	4	2781.404094	2782.431028	K	I	24	49
PSM	CSVALLNETESVLSYLDK	788	sp|Q9BTC8|MTA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1382.2	36.98125	3	2022.9692	2022.9812	K	E	109	127
PSM	CDPAPFYLFDEIDQALDAQHR	789	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.806.4	21.62732	3	2503.0952	2503.1112	K	K	1134	1155
PSM	SLLQSALDFLAGPGSLGGASGR	790	sp|O14976|GAK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	28	1-UNIMOD:1	ms_run[1]:scan=1.1.1569.9	42.03228	2	2115.0913	2115.0955	M	D	2	24
PSM	RIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVR	791	sp|P43686|PRS6B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.1036.6	27.7794	4	3709.920494	3708.947525	K	I	81	115
PSM	VPFALFESFPEDFYVEGLPEGVPFR	792	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.190.5	5.0833	3	2886.378371	2887.410885	K	R	757	782
PSM	FYPEDVAEELIQDITQK	793	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	28		ms_run[1]:scan=1.1.996.2	26.69123	3	2035.994471	2036.994253	K	L	84	101
PSM	ALDLFSDNAPPPELLEIINEDIAK	794	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.295.7	7.89545	3	2636.3422	2636.3585	R	R	317	341
PSM	ALDLFSDNAPPPELLEIINEDIAK	795	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.119.10	3.16955	3	2636.3449	2636.3585	R	R	317	341
PSM	QYDADLEQILIQWITTQCR	796	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	18-UNIMOD:4	ms_run[1]:scan=1.1.386.2	10.33712	4	2393.1533	2393.1685	K	K	42	61
PSM	FGAQLAHIQALISGIEAQLGDVR	797	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.219.2	5.833083	4	2406.2853	2406.3019	R	A	331	354
PSM	FGAQLAHIQALISGIEAQLGDVR	798	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.280.4	7.48555	4	2406.2853	2406.3019	R	A	331	354
PSM	TISPEHVIQALESLGFGSYISEVK	799	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.200.4	5.33195	4	2603.3301	2603.3483	K	E	65	89
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	800	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.253.2	6.749967	4	2784.5577	2784.5790	R	T	902	928
PSM	GDLENAFLNLVQCIQNKPLYFADR	801	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	13-UNIMOD:4	ms_run[1]:scan=1.1.102.3	2.701183	4	2837.4009	2837.4170	K	L	268	292
PSM	DAAHLVNQDDPNVLEIWNLVFIQYNR	802	sp|P49588-2|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.353.5	9.453283	4	3095.5241	3095.5465	R	E	207	233
PSM	DPPLAAVTTAVQELLR	803	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.154.2	4.104483	3	1692.9328	1692.9410	K	L	955	971
PSM	ERPPNPIEFLASYLLK	804	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.81.2	2.129667	3	1886.0197	1886.0301	K	N	75	91
PSM	AFAVVASALGIPSLLPFLK	805	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.76.11	2.00955	2	1913.1262	1913.1390	R	A	631	650
PSM	LSVLDLVVALAPCADEAAISK	806	sp|Q5JTH9-2|RRP12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	13-UNIMOD:4	ms_run[1]:scan=1.1.120.4	3.186833	3	2154.1444	2154.1606	R	L	651	672
PSM	QITDNIFLTTAEVIAQQVSDK	807	sp|P48163-2|MAOX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.147.4	3.918183	3	2333.1940	2333.2115	R	H	397	418
PSM	RSVFQTINQFLDLTLFTHR	808	sp|P53985-2|MOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.77.7	2.029983	3	2335.2256	2335.2437	K	G	243	262
PSM	FLESVEGNQNYPLLLLTLLEK	809	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.326.4	8.719133	4	2432.3037	2432.3202	K	S	32	53
PSM	GIHSAIDASQTPDVVFASILAAFSK	810	sp|P54819-2|KAD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.304.8	8.132983	3	2544.3049	2544.3224	R	A	205	230
PSM	GNLLLTGDKDQLVMLLDQINSTFVR	811	sp|Q5T4S7-2|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.86.8	2.276117	3	2802.4705	2802.4950	K	S	4583	4608
PSM	DIPIWGTLIQYIRPVFVSR	812	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.998.2	26.74047	4	2272.2597	2272.2732	R	S	159	178
PSM	SELAALPPSVQEEHGQLLALLAELLR	813	sp|Q7L2E3-2|DHX30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.906.4	24.26208	4	2796.5241	2796.5385	R	G	1183	1209
PSM	QNIQSHLGEALIQDLINYCLSYIAK	814	sp|O15305-2|PMM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	19-UNIMOD:4	ms_run[1]:scan=1.1.491.2	13.14457	4	2903.4665	2903.4851	R	I	85	110
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	815	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	11-UNIMOD:4	ms_run[1]:scan=1.1.470.5	12.57963	4	2908.4113	2908.4310	K	N	101	130
PSM	SLLDCHIIPALLQGLLSPDLK	816	sp|Q8IUR7-2|ARMC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	5-UNIMOD:4	ms_run[1]:scan=1.1.550.10	14.73498	3	2315.2750	2315.2923	K	F	86	107
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	817	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.498.8	13.3475	4	3585.6741	3585.6942	R	R	85	117
PSM	EAMDPIAELLSQLSGVR	818	sp|Q9P0J7|KCMF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.754.2	20.23337	3	1827.9304	1827.9400	R	R	194	211
PSM	DSSLFDIFTLSCNLLK	819	sp|Q9UIA9|XPO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	12-UNIMOD:4	ms_run[1]:scan=1.1.630.3	16.88238	3	1871.9224	1871.9339	R	Q	183	199
PSM	LQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLR	820	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	10-UNIMOD:4,36-UNIMOD:4	ms_run[1]:scan=1.1.995.9	26.67258	4	4156.0909	4156.1085	R	E	155	193
PSM	INALTAASEAACLIVSVDETIK	821	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	12-UNIMOD:4	ms_run[1]:scan=1.1.619.9	16.59685	3	2288.1754	2288.1933	R	N	296	318
PSM	VLQAVVDSLQGGLDSSVSFVSQVLGK	822	sp|Q9Y4R8|TELO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.961.9	25.75258	3	2631.3943	2631.4120	R	A	195	221
PSM	LQADDFLQDYTLLINILHSEDLGK	823	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.824.3	22.10708	4	2773.3989	2773.4174	R	D	421	445
PSM	SLAHLALNDVSLQALPGDVGNLANLVTLELR	824	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.578.11	15.49432	3	3225.7582	3225.7721	R	E	48	79
PSM	KYSVWIGGSILASLSTFQQMWISK	825	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1464.10	39.15125	3	2729.4001	2729.4251	R	Q	336	360
PSM	YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR	826	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1371.2	36.68272	6	4098.9877	4099.0149	K	K	337	373
PSM	AMDLDQDVLSALAEVEQLSK	827	sp|P07942|LAMB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1058.4	28.3675	3	2174.0608	2174.0776	K	M	1444	1464
PSM	SHCIAEVENDEMPADLPSLAADFVESK	828	sp|P02768-2|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	3-UNIMOD:4	ms_run[1]:scan=1.1.1427.4	38.15278	4	2973.3097	2973.3372	K	D	119	146
PSM	LGLALNFSVFYYEILNNPELACTLAK	829	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	22-UNIMOD:4	ms_run[1]:scan=1.1.1168.4	31.34347	4	2972.5165	2972.5357	R	T	168	194
PSM	TLSTIATSTDAASVVHSTDLVVEAIVENLK	830	sp|Q16836-2|HCDH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1554.6	41.61049	4	3083.6001	3083.6238	K	V	155	185
PSM	DGADIHSDLFISIAQALLGGTAR	831	sp|Q96EY1-2|DNJA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1112.4	29.8234	3	2340.1921	2340.2074	R	A	342	365
PSM	NLDIERPTYTNLNRLISQIVSSITASLR	832	sp|P68363|TBA1B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1584.4	42.42767	4	3186.7169	3186.7360	R	F	216	244
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	833	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1583.7	42.40493	4	3252.5953	3252.6021	K	T	119	148
PSM	HGFFVNPSDSVAVIAANIFSIPYFQQTGVR	834	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1153.5	30.93287	4	3280.6417	3280.6670	K	G	300	330
PSM	QGLLGAPPAMPLLNGPALSTALLQLALQTQGQK	835	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1256.4	33.71455	4	3309.8253	3309.8482	K	K	359	392
PSM	GFLEFVEDFIQVPR	836	sp|P51114-2|FXR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1073.2	28.7689	3	1694.8549	1694.8668	R	N	277	291
PSM	SVNSVLLFTILNPIYSITTDVLYTICNPCGPVQR	837	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	26-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=1.1.1570.7	42.05615	4	3866.9769	3866.9951	R	I	57	91
PSM	FDQLFDDESDPFEVLK	838	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1541.2	41.24142	3	1942.8721	1942.8837	R	A	17	33
PSM	AENPQCLLGDFVTEFFK	839	sp|Q15042-3|RB3GP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.1073.3	28.77223	3	2013.9409	2013.9506	K	I	317	334
PSM	DYVLDCNILPPLLQLFSK	840	sp|P52294|IMA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	6-UNIMOD:4	ms_run[1]:scan=1.1.1156.3	31.0238	3	2147.1229	2147.1337	R	Q	205	223
PSM	ESQLALIVCPLEQLLQGINPR	841	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	9-UNIMOD:4	ms_run[1]:scan=1.1.1493.8	39.93718	3	2390.2867	2390.2991	R	T	869	890
PSM	TAQAIEPYITNFFNQVLMLGK	842	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1282.5	34.3699	3	2397.2224	2397.2402	R	T	225	246
PSM	FSWSPVGVLMNVMQSATYLLDGK	843	sp|Q9UDR5|AASS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1576.8	42.22037	3	2542.2472	2542.2600	K	V	650	673
PSM	LCYVALDFEQEMATAASSSSLEK	844	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	2-UNIMOD:4	ms_run[1]:scan=1.1.1487.10	39.7773	3	2549.1502	2549.1665	K	S	216	239
PSM	YSPDCIIIVVSNPVDILTYVTWK	845	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	5-UNIMOD:4	ms_run[1]:scan=1.1.1055.5	28.28652	3	2694.3784	2694.3979	K	L	128	151
PSM	VFQSSANYAENFIQSIISTVEPAQR	846	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1205.7	32.34703	3	2798.3728	2798.3875	K	Q	28	53
PSM	TALLDAAGVASLLTTAEVVVTEIPKEEK	847	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1574.6	42.16285	3	2867.5588	2867.5743	R	D	527	555
PSM	YVVLFFYPLDFTFVCPTEIIAFSNR	848	sp|P32119-2|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	15-UNIMOD:4	ms_run[1]:scan=1.1.1570.8	42.05782	3	3057.5206	3057.5351	K	A	37	62
PSM	APLIPTLNTIVQYLDLTPNQEYLFER	849	sp|Q96SK2-2|TM209_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1257.2	33.73243	4	3060.5945	3060.6172	K	I	387	413
PSM	SAASYALGSISVGNLPEYLPFVLQEITSQPK	850	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1324.9	35.4813	3	3278.6872	3278.7074	K	R	874	905
PSM	KSEMESVLAQLDNYGQQELADLFVNYNVK	851	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1213.2	32.54793	5	3344.6006	3344.6234	K	S	236	265
PSM	GVDNTFADELVELSTALEHQEYITFLEDLK	852	sp|Q07021|C1QBP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1560.11	41.78827	3	3438.6652	3438.6718	R	S	247	277
PSM	TSANPLSTLSSHLSQQLAAAAGLAQSLASQSASISGVK	853	sp|Q9NSC2-2|SALL1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1274.2	34.15202	5	3651.8916	3651.9067	R	Q	180	218
PSM	ETPFELIEALLKYIETLNVPGAVLVFLPGWNLIYTMQK	854	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1590.2	42.56477	5	4362.3386	4362.3629	K	H	631	669
PSM	GETSLQSSETHPPEVALPPVGEPPALENSTALLEGVNTVVVTTSAPEALLASWAR	855	sp|Q7L190|DPPA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.1222.9	32.80602	5	5618.8276	5618.8632	K	I	154	209
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	856	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27	27-UNIMOD:4	ms_run[1]:scan=1.1.608.7	16.29897	4	3512.6713	3512.6956	R	R	85	117
PSM	SNILEAWSEGVALLQDVR	857	sp|Q9BUA3|SPNDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	27		ms_run[1]:scan=1.1.125.2	3.318917	3	1999.0279	1999.0374	K	A	126	144
PSM	CDISLQFFLPFSLGK	858	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1395.2	37.33395	3	1753.8632	1753.8742	K	E	157	172
PSM	QLDSYKNGFLNLALPFFGFSEPLAAPR	859	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.51.5	1.323917	4	3012.516494	3011.554529	R	H	918	945
PSM	NGFLNLALPFFGFSEPLAAPR	860	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1564.5	41.88897	3	2278.163171	2277.194625	K	H	924	945
PSM	ALMLQGVDLLADAVAVTMGPK	861	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	3-UNIMOD:35,18-UNIMOD:35	ms_run[1]:scan=1.1.949.3	25.41972	3	2145.107171	2144.122114	R	G	38	59
PSM	VFQSSANYAENFIQSIISTVEPAQR	862	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1203.2	32.27988	4	2799.373294	2798.387524	K	Q	28	53
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	863	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.396.10	10.62198	4	3586.669294	3585.694213	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	864	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	27-UNIMOD:4	ms_run[1]:scan=1.1.1087.8	29.15602	4	3437.680494	3436.697307	R	R	85	117
PSM	ASVSELACIYSALILHDDEVTVTEDK	865	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1176.5	31.56458	3	2920.3872	2919.4052	M	I	2	28
PSM	ASVSELACIYSALILHDDEVTVTEDK	866	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1233.3	33.10247	3	2919.3892	2919.4052	M	I	2	28
PSM	LPITVLNGAPGFINLCDALNAWQLVK	867	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	16-UNIMOD:4	ms_run[1]:scan=1.1.515.8	13.805	3	2837.499371	2836.530957	K	E	226	252
PSM	VNPTVFFDIAVDGEPLGR	868	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.79.2	2.075517	3	1986.9912	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	869	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.289.3	7.72075	3	1989.0602	1987.0042	M	V	2	20
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	870	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.436.10	11.70468	4	4437.202894	4436.232216	K	E	235	275
PSM	FYPEDVAEELIQDITQK	871	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.320.2	8.554033	3	2038.990571	2036.994253	K	L	84	101
PSM	FYPEDVAEELIQDITQK	872	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.588.2	15.74972	3	2037.982571	2036.994253	K	L	84	101
PSM	FYPEDVAEELIQDITQK	873	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.569.4	15.23895	3	2037.986171	2036.994253	K	L	84	101
PSM	QLSQSLLPAIVELAEDAK	874	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1.1.791.3	21.21463	3	1907.0082	1907.0242	R	W	399	417
PSM	SDPAVNAQLDGIISDFEALK	875	sp|Q9UHD8-5|SEPT9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.371.3	9.93325	3	2145.0442	2144.0632	M	R	2	22
PSM	QAAPCVLFFDELDSIAK	876	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28,5-UNIMOD:4	ms_run[1]:scan=1.1.490.7	13.13067	2	1905.9072	1905.9182	R	A	568	585
PSM	MFQNFPTELLLSLAVEPLTANFHK	877	sp|Q92820|GGH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.1383.5	37.02153	3	2760.423371	2759.435660	R	W	173	197
PSM	QQPPDLVEFAVEYFTR	878	sp|P13861|KAP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.122.3	3.239217	3	1938.940871	1937.952329	R	L	24	40
PSM	AMTTGAIAAMLSTILYSR	879	sp|P20618|PSB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27		ms_run[1]:scan=1.1.189.2	5.044116	3	1871.962871	1869.969241	K	R	110	128
PSM	QLLAEESLPTTPFYFILGK	880	sp|Q8IWA0|WDR75_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:28	ms_run[1]:scan=1.1.691.2	18.53623	3	2149.1202	2149.1342	K	H	683	702
PSM	CSVALLNETESVLSYLDK	881	sp|Q9BTC8|MTA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1402.4	37.53558	2	2022.9749	2022.9814	K	E	109	127
PSM	LQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLR	882	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	10-UNIMOD:4,36-UNIMOD:4	ms_run[1]:scan=1.1.1072.9	28.75532	4	4157.078894	4156.108536	R	E	155	193
PSM	IVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHR	883	sp|O95372|LYPA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	20-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=1.1.1322.3	35.4272	5	4046.113618	4045.143405	R	A	116	154
PSM	ADAASQVLLGSGLTILSQPLMYVK	884	sp|Q9Y6C9|MTCH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	27	1-UNIMOD:1	ms_run[1]:scan=1.1.1482.9	39.63942	3	2517.3422	2516.3552	M	V	2	26
PSM	ISVGAPVYMAAVIEYLAAEILELAGNAAR	885	sp|Q9P0M6|H2AW_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	27	9-UNIMOD:35	ms_run[1]:scan=1.1.1554.4	41.60715	4	2989.539294	2990.578696	R	D	41	70
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	886	sp|P27824|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	26		ms_run[1]:scan=1.1.373.7	10.00062	4	4436.19489419132	4436.232214843139	K	E	235	275
PSM	KPPTFGDASVIALELLNSGYEFDEGSIIFNK	887	sp|P36542-2|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.147.10	3.92985	3	3370.6762	3370.6973	R	F	159	190
PSM	SAVELVQEFLNDLNK	888	sp|Q9H900-2|ZWILC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.76.2	1.99455	3	1717.8802	1717.8886	K	L	180	195
PSM	LAATTFISQGIPVYLFSDITPTPFVPFTVSHLK	889	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.117.7	3.113733	4	3606.9129	3606.9378	R	L	123	156
PSM	SGTAYSLVAPDEIPYLLDLHLFLGR	890	sp|Q8TDD1-2|DDX54_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.172.9	4.603883	3	2759.4409	2759.4534	R	S	435	460
PSM	ERPPNPIEFLASYLLK	891	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.103.2	2.723117	3	1886.0194	1886.0301	K	N	75	91
PSM	FFEGPVTGIFSGYVNSMLQEYAK	892	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.141.3	3.7541	4	2583.2161	2583.2356	K	N	396	419
PSM	NMAEQIIQEIYSQIQSK	893	sp|P29401-2|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.61.7	1.597883	3	2021.9953	2022.0091	K	K	273	290
PSM	FYPEDVAEELIQDITQK	894	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.415.2	11.12145	3	2036.9761	2036.9942	K	L	84	101
PSM	SFDPFTEVIVDGIVANALR	895	sp|Q01970-2|PLCB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.266.4	7.103283	3	2062.0606	2062.0735	K	V	644	663
PSM	DAAHLVNQDDPNVLEIWNLVFIQYNR	896	sp|P49588-2|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.350.9	9.378834	3	3095.5282	3095.5465	R	E	207	233
PSM	NPEILAIAPVLLDALTDPSR	897	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.452.3	12.12635	3	2117.1571	2117.1732	R	K	1571	1591
PSM	NTSELVSSEVYLLSALAALQK	898	sp|Q9H583|HEAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.48.8	1.247967	3	2235.1843	2235.1998	K	V	1746	1767
PSM	LSKPELLTLFSILEGELEAR	899	sp|Q9P2B4|CT2NL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.387.2	10.36438	3	2257.2391	2257.2569	K	D	6	26
PSM	DTELAEELLQWFLQEEKR	900	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.306.4	8.18015	3	2276.1175	2276.1324	K	E	1546	1564
PSM	QYDADLEQILIQWITTQCR	901	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	18-UNIMOD:4	ms_run[1]:scan=1.1.378.5	10.126	3	2393.1529	2393.1685	K	K	42	61
PSM	STSQNLDSGTDLSFPWILNVLNLK	902	sp|P06400|RB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.448.4	12.02448	3	2661.3511	2661.3650	R	A	501	525
PSM	YALQMEQLNGILLHLESELAQTR	903	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.226.5	6.036016	3	2669.3674	2669.3846	R	A	331	354
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	904	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	4-UNIMOD:4	ms_run[1]:scan=1.1.176.9	4.711833	3	2830.4023	2830.4211	K	E	173	198
PSM	QFEAPTLAEGFSAILEIPFR	905	sp|Q96T60-2|PNKP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.735.5	19.7325	3	2235.1456	2235.1575	K	L	446	466
PSM	LCYVALDFEQEMATAASSSSLEK	906	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.995.6	26.66425	3	2549.1442	2549.1665	K	S	216	239
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	907	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	27-UNIMOD:4	ms_run[1]:scan=1.1.823.2	22.07845	6	3436.6765	3436.6973	R	R	85	117
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	908	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.762.7	20.45575	4	3113.6609	3113.6801	K	F	193	222
PSM	SANYCHTSQGDPIGLILLGEVALGNMYELK	909	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.737.8	19.78998	4	3262.5833	3262.6002	K	H	904	934
PSM	GSGLLGSQPQPVIPASVIPEELISQAQVVLQGK	910	sp|O95071-2|UBR5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.884.4	23.67088	4	3338.8201	3338.8450	R	S	168	201
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	911	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.479.5	12.82657	4	3585.6733	3585.6942	R	R	85	117
PSM	TATFAISILQQIELDLK	912	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.696.2	18.66782	3	1903.0546	1903.0666	K	A	83	100
PSM	TATFAISILQQIELDLK	913	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.581.2	15.56057	3	1903.0540	1903.0666	K	A	83	100
PSM	TATFAISILQQIELDLK	914	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.543.2	14.53202	3	1903.0546	1903.0666	K	A	83	100
PSM	NIVSLLLSMLGHDEDNTR	915	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.927.4	24.82977	3	2026.0009	2026.0153	K	I	2426	2444
PSM	FYPEDVAEELIQDITQK	916	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.607.2	16.26532	3	2036.9809	2036.9942	K	L	84	101
PSM	FYPEDVAEELIQDITQK	917	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.473.2	12.6558	3	2036.9839	2036.9942	K	L	84	101
PSM	FYPEDVAEELIQDITQK	918	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.530.4	14.20272	3	2036.9845	2036.9942	K	L	84	101
PSM	FGVICLEDLIHEIAFPGK	919	sp|Q6DKI1|RL7L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.582.2	15.58748	3	2057.0545	2057.0656	K	H	180	198
PSM	ASVETLTEMLQSYISEIGR	920	sp|Q7Z7C8-2|TAF8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.814.2	21.8354	3	2126.0449	2126.0565	K	S	56	75
PSM	AVFSDSLVPALEAFGLEGVFR	921	sp|Q6L8Q7-2|PDE12_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.670.4	17.96922	3	2223.1456	2223.1576	R	I	355	376
PSM	ALQSNIIPFCDEVMQLLLENLGNENVHR	922	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	10-UNIMOD:4	ms_run[1]:scan=1.1.921.9	24.67817	3	3265.6042	3265.6223	R	S	535	563
PSM	LTPGCEAEAETEAICFFVQQFTDMEHNR	923	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.695.8	18.65087	4	3329.4229	3329.4427	K	V	2355	2383
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	924	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.718.7	19.26953	5	4113.1201	4113.1436	K	D	157	198
PSM	DQQEAALVDMVNDGVEDLR	925	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1090.3	29.2353	3	2115.9694	2115.9743	K	C	83	102
PSM	DQQEAALVDMVNDGVEDLR	926	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1267.2	33.9719	3	2116.0042	2115.9743	K	C	83	102
PSM	LCYVALDFEQEMATAASSSSLEK	927	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	2-UNIMOD:4	ms_run[1]:scan=1.1.1235.4	33.1496	3	2549.1421	2549.1665	K	S	216	239
PSM	ALDLFSDNAPPPELLEIINEDIAK	928	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1266.3	33.95945	3	2636.3773	2636.3585	R	R	317	341
PSM	TLEEAVNNIITFLGMQPCER	929	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	18-UNIMOD:4	ms_run[1]:scan=1.1.1374.2	36.76668	4	2334.1229	2334.1348	K	S	793	813
PSM	SDLRPMLYEAICNLLQDQDLVVR	930	sp|Q9UI26-2|IPO11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	12-UNIMOD:4	ms_run[1]:scan=1.1.1069.3	28.66087	4	2760.3697	2760.3938	K	I	550	573
PSM	AAFDDAIAELDTLSEESYK	931	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1545.3	41.35352	3	2086.9480	2086.9582	K	D	175	194
PSM	TALLDAAGVASLLTTAEVVVTEIPKEEK	932	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1559.3	41.74712	4	2867.5577	2867.5743	R	D	527	555
PSM	GVQPLLDAVLEYLPNPSEVQNYAILNK	933	sp|Q96RP9-2|EFGM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1116.2	29.9292	4	2996.5653	2996.5858	K	E	324	351
PSM	SAASYALGSISVGNLPEYLPFVLQEITSQPK	934	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1286.5	34.4557	4	3278.6829	3278.7074	K	R	874	905
PSM	DQEGQDVLLFIDNIFR	935	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1472.4	39.35917	3	1920.9457	1920.9581	R	F	295	311
PSM	SVNSVLLFTILNPIYSITTDVLYTICNPCGPVQR	936	sp|P14866-2|HNRPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	26-UNIMOD:4,29-UNIMOD:4	ms_run[1]:scan=1.1.1581.8	42.35425	4	3866.9769	3866.9951	R	I	57	91
PSM	AENPQCLLGDFVTEFFK	937	sp|Q15042-3|RB3GP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	6-UNIMOD:4	ms_run[1]:scan=1.1.1070.3	28.6914	3	2013.9409	2013.9506	K	I	317	334
PSM	QLDLLCDIPLVGFINSLK	938	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	6-UNIMOD:4	ms_run[1]:scan=1.1.1476.4	39.46786	3	2057.1121	2057.1231	R	F	411	429
PSM	LQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLR	939	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	10-UNIMOD:4,36-UNIMOD:4	ms_run[1]:scan=1.1.1092.7	29.296	4	4156.0789	4156.1085	R	E	155	193
PSM	LQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLR	940	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	10-UNIMOD:4,36-UNIMOD:4	ms_run[1]:scan=1.1.1033.6	27.70142	4	4156.0789	4156.1085	R	E	155	193
PSM	DQQEAALVDMVNDGVEDLR	941	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1394.3	37.31227	3	2115.9631	2115.9743	K	C	83	102
PSM	MNLQEIPPLVYQLLVLSSK	942	sp|Q9NVI1-1|FANCI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1415.3	37.84062	3	2184.2050	2184.2228	K	G	205	224
PSM	TLEEAVNNIITFLGMQPCER	943	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	18-UNIMOD:4	ms_run[1]:scan=1.1.1359.3	36.3834	3	2334.1219	2334.1348	K	S	793	813
PSM	TYVLQNSTLPSIWDMGLELFR	944	sp|Q13619-2|CUL4A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1134.6	30.4254	3	2482.2388	2482.2566	R	T	59	80
PSM	LGLALNFSVFYYEILNNPELACTLAK	945	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	22-UNIMOD:4	ms_run[1]:scan=1.1.1206.4	32.37393	3	2972.5189	2972.5357	R	T	168	194
PSM	SHCIAEVENDEMPADLPSLAADFVESK	946	sp|P02768-2|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	3-UNIMOD:4	ms_run[1]:scan=1.1.1541.11	41.25642	3	2973.3097	2973.3372	K	D	119	146
PSM	DSNTILLPSNPGDVTSMVAQAMGVYGALTK	947	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1191.8	31.96948	3	3049.4902	3049.5100	K	A	247	277
PSM	GKYVVLFFYPLDFTFVCPTEIIAFSNR	948	sp|P32119-2|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	17-UNIMOD:4	ms_run[1]:scan=1.1.1273.3	34.13958	3	3242.6332	3242.6515	K	A	35	62
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	949	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	1-UNIMOD:35	ms_run[1]:scan=1.1.1568.11	42.0084	3	3268.5814	3268.5970	K	T	119	148
PSM	EGISQEALHTQMLTAVQEISHLIEPLANAAR	950	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.1169.6	31.36885	4	3369.7145	3369.7350	R	A	1691	1722
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	951	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1347.3	36.06177	4	3528.6729	3528.6905	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	952	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.540.8	14.46232	4	3585.6697	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	953	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.245.3	6.540683	4	3601.6669	3601.6891	R	R	85	117
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	954	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.412.11	11.05527	4	4436.2029	4436.2322	K	E	270	310
PSM	VLISNLLDLLTEVGVSGQGR	955	sp|Q9H3U1-2|UN45A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26		ms_run[1]:scan=1.1.859.2	22.99638	3	2082.1537	2082.1685	K	D	278	298
PSM	VPIPCYLIALVVGALESR	956	sp|P09960-2|LKHA4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	26	5-UNIMOD:4	ms_run[1]:scan=1.1.1570.2	42.04782	3	1969.1044	1969.1070	K	Q	196	214
PSM	DDDIAALVVDNGSGMCK	957	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.1428.4	38.18682	2	1821.7642	1820.7912	M	A	2	19
PSM	CLELFSELAEDK	958	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1385.3	37.06562	2	1435.6452	1435.6536	K	E	412	424
PSM	QDLVISLLPYVLHPLVAK	959	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28	ms_run[1]:scan=1.1.1431.2	38.25572	3	2000.1562	2000.1702	K	A	547	565
PSM	CLQQALHTFQNDIHVYPIWLCPFILPSQPGLVHPK	960	sp|Q15392|DHC24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:385,1-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.1388.7	37.15682	4	4149.0742	4149.1112	K	G	393	428
PSM	VNPTVFFDIAVDGEPLGR	961	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.136.2	3.6171	3	1987.9942	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	962	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:1	ms_run[1]:scan=1.1.232.2	6.183317	3	1986.9902	1987.0042	M	V	2	20
PSM	NVLITSALPYVNNVPHLGNIIGCVLSADVFAR	963	sp|P56192|SYMC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	23-UNIMOD:4	ms_run[1]:scan=1.1.711.2	19.07427	5	3436.817618	3435.833681	R	Y	265	297
PSM	ANYLASPPLVIAYAIAGTIR	964	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.294.3	7.8586	3	2075.148971	2073.162262	R	I	548	568
PSM	SGPPGEEAQVASQFIADVIENSQIIQK	965	sp|Q96B26|EXOS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.119.5	3.161217	4	2855.418894	2854.434868	R	E	95	122
PSM	QILLGIQELLNEPNIQDPAQAEAYTIYCQNR	966	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,28-UNIMOD:4	ms_run[1]:scan=1.1.970.8	25.99443	4	3597.7592	3597.7772	K	V	111	142
PSM	QILLGIQELLNEPNIQDPAQAEAYTIYCQNR	967	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	26	1-UNIMOD:28,28-UNIMOD:4	ms_run[1]:scan=1.1.919.8	24.62418	3	3597.7582	3597.7772	K	V	111	142
PSM	VPFALFESFPEDFYVEGLPEGVPFR	968	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26		ms_run[1]:scan=1.1.171.11	4.58035	3	2888.396171	2887.410885	K	R	757	782
PSM	NMAEQIIQEIYSQIQSK	969	sp|P29401|TKT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	2-UNIMOD:35	ms_run[1]:scan=1.1.3.2	0.05378333	3	2036.981171	2038.004107	K	K	265	282
PSM	MTQIMFETFNVPAMYVAIQAVLSLYASGR	970	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	26	1-UNIMOD:35	ms_run[1]:scan=1.1.1568.11	42.0084	3	3268.580171	3266.617800	K	T	121	150
PSM	TLLEGSGLESIISIIHSSLAEPR	971	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.236.3	6.2915	4	2421.2933	2421.3115	R	V	2483	2506
PSM	PNSEPASLLELFNSIATQGELVR	972	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.42.2	1.076	4	2484.2649	2484.2860	M	S	2	25
PSM	HAQPALLYLVPACIGFPVLVALAK	973	sp|Q8TCT9-2|HM13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	13-UNIMOD:4	ms_run[1]:scan=1.1.312.3	8.340217	4	2560.4461	2560.4603	K	G	314	338
PSM	LYHCAAYNCAISVICCVFNELK	974	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	4-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.36.2	0.9137	4	2704.2129	2704.2270	R	F	1939	1961
PSM	VFTPGQGNNVYIFPGVALAVILCNTR	975	sp|P23368|MAOM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	23-UNIMOD:4	ms_run[1]:scan=1.1.430.6	11.5353	4	2819.4605	2819.4793	R	H	459	485
PSM	EAIETIVAAMSNLVPPVELANPENQFR	976	sp|Q5JWF2-2|GNAS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.451.6	12.10422	4	2951.4825	2951.5062	K	V	730	757
PSM	LLVSNLDFGVSDADIQELFAEFGTLKK	977	sp|Q86V81|THOC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.373.2	9.985617	4	2968.5249	2968.5433	K	A	108	135
PSM	LGLIEWLENTVTLK	978	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.186.5	4.972833	2	1627.9088	1627.9185	R	D	3800	3814
PSM	VQALTTDISLIFAALK	979	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.57.7	1.490083	2	1702.9760	1702.9869	R	D	370	386
PSM	VGLPLLSPEFLLTGVLK	980	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.146.3	3.889433	3	1795.0747	1795.0859	R	Q	1791	1808
PSM	ERPPNPIEFLASYLLK	981	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.62.2	1.616433	3	1886.0194	1886.0301	K	N	75	91
PSM	ERPPNPIEFLASYLLK	982	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.122.2	3.23755	3	1886.0194	1886.0301	K	N	75	91
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	983	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	4-UNIMOD:4	ms_run[1]:scan=1.1.199.9	5.314217	3	2830.3984	2830.4211	K	E	173	198
PSM	GLQGVGPGCTDETLLSAIASALHTSTMPITGQLSAAVEK	984	sp|O95983-2|MBD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.180.9	4.819033	4	3880.9269	3880.9551	K	N	132	171
PSM	IVSLLAASEAEVEQLLSER	985	sp|Q99538|LGMN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.369.3	9.87915	3	2056.0912	2056.1051	K	A	352	371
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	986	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.95.11	2.522167	4	4320.1537	4320.1835	K	A	198	238
PSM	DTELAEELLQWFLQEEKR	987	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.287.2	7.66535	3	2276.1160	2276.1324	K	E	1546	1564
PSM	YFILPDSLPLDTLLVDVEPK	988	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.379.6	10.1549	3	2286.2257	2286.2399	R	V	67	87
PSM	QTAQDWPATSLNCIAILFLR	989	sp|Q96EY7-2|PTCD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	13-UNIMOD:4	ms_run[1]:scan=1.1.27.9	0.68225	3	2317.1761	2317.1889	R	A	157	177
PSM	ALLAGQAALLQALMELAPASAPAR	990	sp|Q9BTY7|HGH1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.94.8	2.490267	3	2346.2887	2346.3093	R	D	56	80
PSM	TLLEGSGLESIISIIHSSLAEPR	991	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.208.5	5.544466	3	2421.2983	2421.3115	R	V	2483	2506
PSM	TISPEHVIQALESLGFGSYISEVK	992	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.200.5	5.333617	3	2603.3290	2603.3483	K	E	65	89
PSM	AHITLGCAADVEAVQTGLDLLEILR	993	sp|P09543-2|CN37_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.372.11	9.973583	3	2677.3909	2677.4109	R	Q	309	334
PSM	IPTAKPELFAYPLDWSIVDSILMER	994	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.251.6	6.70935	3	2903.4997	2903.5143	K	R	745	770
PSM	KASFEEASNQLINHIEQFLDTNETPYFMK	995	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.147.2	3.91485	5	3443.6106	3443.6343	K	S	606	635
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	996	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	11-UNIMOD:4	ms_run[1]:scan=1.1.753.8	20.22183	3	2908.4293	2908.4310	K	N	101	130
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	997	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.919.6	24.61752	3	2934.4714	2934.4862	R	D	133	163
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	998	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.949.8	25.42972	3	2934.4891	2934.4862	R	D	133	163
PSM	AELATEEFLPVTPILEGFVILR	999	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.935.3	25.0426	4	2456.3393	2456.3566	R	K	721	743
PSM	DLVEAVAHILGIR	1000	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.752.2	20.17992	3	1404.8041	1404.8089	R	D	2126	2139
PSM	ITELLKPGDVLFDVFAGVGPFAIPVAK	1001	sp|Q32P41|TRM5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.700.5	18.78092	4	2812.5541	2812.5779	R	K	292	319
PSM	VVETLPHFISPYLEGILSQVIHLEK	1002	sp|Q9H583|HEAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.523.4	14.01355	4	2860.5557	2860.5739	K	I	1767	1792
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	1003	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.823.5	22.08345	4	2934.4669	2934.4862	R	D	133	163
PSM	MNEEQIAAVCLAVLQALSVLHAQGVIHR	1004	sp|O96013-2|PAK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.476.6	12.7437	4	3069.6001	3069.6216	R	D	247	275
PSM	LVAAPLFELYDNAPGYGPIISSLPQLLSR	1005	sp|O43809|CPSF5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.705.6	18.91775	4	3113.6637	3113.6801	K	F	193	222
PSM	AFAGDIANQLATDAVQILGGNGFNTEYPVEK	1006	sp|P11310-2|ACADM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1001.6	26.83542	4	3222.5601	3222.5833	K	L	363	394
PSM	IDLGVHVDGFIANVAHTFVVDVAQGTQVTGR	1007	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.601.6	16.10855	4	3234.6597	3234.6786	K	K	54	85
PSM	ALQSNIIPFCDEVMQLLLENLGNENVHR	1008	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	10-UNIMOD:4	ms_run[1]:scan=1.1.920.7	24.64453	4	3265.6025	3265.6223	R	S	535	563
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	1009	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	27-UNIMOD:4	ms_run[1]:scan=1.1.983.5	26.34143	4	3436.6781	3436.6973	R	R	85	117
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	1010	sp|P56545-2|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.532.6	14.26212	4	3527.7157	3527.7388	K	R	655	688
PSM	SVPVSAGGEGETSPYSLEASPLGQLMNMLSHPVIR	1011	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.877.6	23.49255	4	3609.7589	3609.7807	K	R	3394	3429
PSM	ELQLEYLLGAFESLGK	1012	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.688.2	18.45173	3	1808.9464	1808.9560	K	A	1686	1702
PSM	TATFAISILQQIELDLK	1013	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.657.2	17.61318	3	1903.0537	1903.0666	K	A	83	100
PSM	QLNHFWEIVVQDGITLITK	1014	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.750.4	20.13105	3	2253.2032	2253.2158	K	E	670	689
PSM	DIPIWGTLIQYIRPVFVSR	1015	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1004.6	26.90792	3	2272.2568	2272.2732	R	S	159	178
PSM	INALTAASEAACLIVSVDETIK	1016	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	12-UNIMOD:4	ms_run[1]:scan=1.1.690.6	18.51248	3	2288.1775	2288.1933	R	N	296	318
PSM	IQFNDLQSLLCATLQNVLRK	1017	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	11-UNIMOD:4	ms_run[1]:scan=1.1.931.2	24.93612	4	2373.2689	2373.2838	R	V	430	450
PSM	LCYVALDFEQEMATAASSSSLEK	1018	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.792.6	21.24828	3	2549.1475	2549.1665	K	S	216	239
PSM	AEVQNLGGELVVSGVDSAMSLIQAAK	1019	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.480.9	12.86033	3	2585.3227	2585.3371	K	N	428	454
PSM	AFAGDIANQLATDAVQILGGNGFNTEYPVEK	1020	sp|P11310-2|ACADM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1002.4	26.86227	3	3222.5602	3222.5833	K	L	363	394
PSM	LTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	1021	sp|P13797-2|PLST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	22-UNIMOD:4	ms_run[1]:scan=1.1.687.5	18.42953	4	3561.8397	3561.8613	K	A	166	199
PSM	GFLEFVEDFIQVPR	1022	sp|P51114-2|FXR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1051.2	28.17372	3	1694.8624	1694.8668	R	N	277	291
PSM	LCYVALDFEQEMATAASSSSLEK	1023	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.1523.2	40.74722	4	2549.18009419132	2549.1665567026694	K	S	216	239
PSM	AAFDDAIAELDTLSEESYK	1024	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1506.2	40.28248	3	2086.9480	2086.9582	K	D	175	194
PSM	LCYVALDFEQEMATAASSSSLEK	1025	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	2-UNIMOD:4	ms_run[1]:scan=1.1.1147.6	30.77728	3	2549.1508	2549.1665	K	S	216	239
PSM	APLIPTLNTIVQYLDLTPNQEYLFER	1026	sp|Q96SK2-2|TM209_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1257.5	33.74577	3	3060.5872	3060.6172	K	I	387	413
PSM	FYPEDVAEELIQDITQK	1027	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1035.2	27.7422	3	2036.9824	2036.9942	K	L	84	101
PSM	NQLEIQNLQEDWDHFEPLLSSLLR	1028	sp|Q8NCN5|PDPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1087.4	29.14935	4	2936.4561	2936.4668	K	R	318	342
PSM	SHCIAEVENDEMPADLPSLAADFVESK	1029	sp|P02768-2|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	3-UNIMOD:4	ms_run[1]:scan=1.1.1518.7	40.61868	4	2973.3241	2973.3372	K	D	119	146
PSM	SLADELALVDVLEDK	1030	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1549.6	41.4692	2	1628.8360	1628.8509	K	L	44	59
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	1031	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	27-UNIMOD:4	ms_run[1]:scan=1.1.1077.6	28.88393	4	3436.6729	3436.6973	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	1032	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	27-UNIMOD:4	ms_run[1]:scan=1.1.1027.7	27.53575	4	3436.6741	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1033	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	27-UNIMOD:4	ms_run[1]:scan=1.1.1375.2	36.79207	6	3512.6683	3512.6956	R	R	85	117
PSM	FYPEDVAEELIQDITQK	1034	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1297.2	34.74527	3	2036.9809	2036.9942	K	L	84	101
PSM	EAVSSAFFSLLQTLSTQFK	1035	sp|Q9BQG0-2|MBB1A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1561.2	41.80098	3	2103.0730	2103.0888	R	Q	511	530
PSM	DQQEAALVDMVNDGVEDLR	1036	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1473.3	39.3847	3	2115.9601	2115.9743	K	C	83	102
PSM	ELEAVCQDVLSLLDNYLIK	1037	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	6-UNIMOD:4	ms_run[1]:scan=1.1.1497.3	40.03817	3	2234.1376	2234.1504	K	N	92	111
PSM	CPSCFYNLLNLFCELTCSPR	1038	sp|O15118|NPC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.1386.2	37.09438	3	2550.1165	2550.1164	R	Q	97	117
PSM	YSPDCIIIVVSNPVDILTYVTWK	1039	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	5-UNIMOD:4	ms_run[1]:scan=1.1.1104.9	29.6193	3	2694.3784	2694.3979	K	L	128	151
PSM	DGPYITAEEAVAVYTTTVHWLESR	1040	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1427.6	38.15945	3	2707.3036	2707.3130	K	R	797	821
PSM	GVQPLLDAVLEYLPNPSEVQNYAILNK	1041	sp|Q96RP9-2|EFGM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1155.5	30.99697	3	2996.5627	2996.5858	K	E	324	351
PSM	DSNTILLPSNPGDVTSMVAQAMGVYGALTK	1042	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1210.8	32.48163	3	3049.4902	3049.5100	K	A	247	277
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	1043	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25		ms_run[1]:scan=1.1.1323.2	35.43922	5	3503.9166	3503.9392	K	S	754	787
PSM	FLNTTFSFFPPFVSCIQDISCQHAALLSLDPAAVSAGCLASLQQPVGIR	1044	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	15-UNIMOD:4,21-UNIMOD:4,38-UNIMOD:4	ms_run[1]:scan=1.1.1366.8	36.5817	5	5350.6286	5350.6618	R	L	2843	2892
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1045	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1350.4	36.1471	4	3528.6729	3528.6905	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1046	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.725.7	19.46193	4	3585.6697	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1047	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.193.6	5.154467	4	3601.6625	3601.6891	R	R	85	117
PSM	ESQLALIVCPLEQLLQGINPR	1048	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	25	9-UNIMOD:4	ms_run[1]:scan=1.1.1524.7	40.78293	3	2390.2846	2390.2991	R	T	869	890
PSM	QLFSSLFSGILK	1049	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.100.2	2.642333	2	1321.7180	1321.7277	K	E	2807	2819
PSM	CDISLQFFLPFSLGK	1050	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1415.4	37.84562	2	1753.8622	1753.8742	K	E	157	172
PSM	CLELFSELAEDK	1051	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1248.2	33.49287	2	1435.6438	1435.6536	K	E	412	424
PSM	GQVLSVCVEEENIIPYITNVLQNPDLALR	1052	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25	7-UNIMOD:4	ms_run[1]:scan=1.1.565.8	15.14257	3	3297.692171	3295.712229	K	M	322	351
PSM	CIALAQLLVEQNFPAIAIHR	1053	sp|Q13838|DX39B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1019.4	27.31248	3	2259.2022	2259.2192	R	G	300	320
PSM	QNLFQEAEEFLYR	1054	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.562.3	15.05157	2	1668.7672	1668.7782	R	F	22	35
PSM	ASVSELACIYSALILHDDEVTVTEDK	1055	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1157.4	31.04428	3	2920.3942	2919.4052	M	I	2	28
PSM	VNPTVFFDIAVDGEPLGR	1056	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:1	ms_run[1]:scan=1.1.193.3	5.1478	3	1987.9902	1987.0042	M	V	2	20
PSM	FYPEDVAEELIQDITQK	1057	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.702.2	18.82993	3	2037.986771	2036.994253	K	L	84	101
PSM	QLSQSLLPAIVELAEDAK	1058	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.812.4	21.78475	3	1907.0082	1907.0242	R	W	399	417
PSM	QAAPCVLFFDELDSIAK	1059	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28,5-UNIMOD:4	ms_run[1]:scan=1.1.509.8	13.64198	2	1905.9072	1905.9182	R	A	568	585
PSM	CDPAPFYLFDEIDQALDAQHR	1060	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.787.5	21.11298	3	2503.0952	2503.1112	K	K	1134	1155
PSM	QVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSK	1061	sp|P30049|ATPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.389.8	10.43338	4	4089.2002	4089.2262	R	Y	57	97
PSM	HDSEQDNSDNNTIFVQGLGENVTIESVADYFK	1062	sp|P35637|FUS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	25		ms_run[1]:scan=1.1.1484.9	39.6938	4	3585.642094	3584.617930	R	Q	275	307
PSM	CANLFEALVGTLK	1063	sp|Q9P1F3|ABRAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1087.3	29.14768	2	1417.7171	1417.7270	K	A	39	52
PSM	QSVHIVENEIQASIDQIFSR	1064	sp|O14653|GOSR2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	25	1-UNIMOD:28	ms_run[1]:scan=1.1.168.6	4.490167	3	2295.1332	2295.1492	K	L	28	48
PSM	ANYLASPPLVIAYAIAGTIR	1065	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.274.4	7.318933	3	2073.1510	2073.1622	R	I	548	568
PSM	TVQDLTSVVQTLLQQMQDK	1066	sp|O75506|HSBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.331.2	8.854333	4	2174.1145	2174.1253	K	F	8	27
PSM	DLATALEQLLQAYPR	1067	sp|P55957-2|BID_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.366.3	9.801267	3	1700.8954	1700.9097	R	D	172	187
PSM	QYDADLEQILIQWITTQCR	1068	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	18-UNIMOD:4	ms_run[1]:scan=1.1.406.3	10.87938	4	2393.1533	2393.1685	K	K	42	61
PSM	HAQPALLYLVPACIGFPVLVALAK	1069	sp|Q8TCT9-2|HM13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	13-UNIMOD:4	ms_run[1]:scan=1.1.292.4	7.8031	4	2560.4433	2560.4603	K	G	314	338
PSM	DITYFIQQLLR	1070	sp|Q9C0K3|ARP3C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.192.3	5.121733	2	1408.7634	1408.7714	R	E	70	81
PSM	VLSTAGPSEALQPLVYPLAQVIIGCIK	1071	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	25-UNIMOD:4	ms_run[1]:scan=1.1.167.4	4.4598	4	2836.5605	2836.5772	R	L	418	445
PSM	LHIQNPSFSQINQLVSTIMSASTTTLR	1072	sp|Q9NRH3|TBG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.173.5	4.62425	4	2986.5349	2986.5546	R	Y	218	245
PSM	KPPTFGDASVIALELLNSGYEFDEGSIIFNK	1073	sp|P36542-2|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.146.10	3.9011	4	3370.6757	3370.6973	R	F	159	190
PSM	GMTLVTPLQLLLFASK	1074	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.412.2	11.04027	3	1730.9908	1731.0005	K	K	1058	1074
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1075	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.313.5	8.377183	4	3585.6701	3585.6942	R	R	85	117
PSM	VGLPLLSPEFLLTGVLK	1076	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.108.2	2.858267	3	1795.0723	1795.0859	R	Q	1791	1808
PSM	NLATAYDNFVELVANLK	1077	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.200.3	5.330283	3	1893.9703	1893.9836	K	E	660	677
PSM	ANYLASPPLVIAYAIAGTIR	1078	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.230.4	6.13625	3	2073.1555	2073.1622	R	I	548	568
PSM	FSSVQLLGDLLFHISGVTGK	1079	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.333.3	8.906384	3	2117.1388	2117.1521	R	M	1833	1853
PSM	ILCQDNPSHNVFCSPVSISSALAMVLLGAK	1080	sp|P50453|SPB9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	3-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.174.11	4.66135	3	3227.5882	3227.6141	K	G	18	48
PSM	KPPTFGDASVIALELLNSGYEFDEGSIIFNK	1081	sp|P36542-2|ATPG_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.127.4	3.376567	5	3370.6751	3370.6973	R	F	159	190
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1082	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.238.8	6.35465	5	3585.6726	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1083	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.179.6	4.787517	5	3601.6586	3601.6891	R	R	85	117
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	1084	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.73.8	1.923567	5	4320.1566	4320.1835	K	A	198	238
PSM	FYPEDVAEELIQDITQK	1085	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.645.2	17.28657	3	2036.9893	2036.9942	K	L	84	101
PSM	SELAALPPSVQEEHGQLLALLAELLR	1086	sp|Q7L2E3-2|DHX30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.887.6	23.75825	3	2796.5161	2796.5385	R	G	1183	1209
PSM	IDLGVHVDGFIANVAHTFVVDVAQGTQVTGR	1087	sp|Q9UQ80-2|PA2G4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.589.3	15.77827	5	3234.6581	3234.6786	K	K	54	85
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1088	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.687.6	18.43287	4	3585.6701	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1089	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.561.8	15.03112	4	3585.6709	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1090	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.816.5	21.90443	4	3585.6649	3585.6942	R	R	85	117
PSM	ELQLEYLLGAFESLGK	1091	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.707.2	18.96497	3	1808.9464	1808.9560	K	A	1686	1702
PSM	EAMDPIAELLSQLSGVR	1092	sp|Q9P0J7|KCMF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.735.2	19.7225	3	1827.9304	1827.9400	R	R	194	211
PSM	TATFAISILQQIELDLK	1093	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.638.3	17.09858	3	1903.0540	1903.0666	K	A	83	100
PSM	GIVSLSDILQALVLTGGEK	1094	sp|P54619-2|AAKG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.743.2	19.9371	3	1912.0747	1912.0881	K	K	279	298
PSM	EATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK	1095	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.544.8	14.57088	4	3865.9945	3866.0149	K	A	354	389
PSM	EATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK	1096	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.563.7	15.0853	4	3865.9929	3866.0149	K	A	354	389
PSM	FYPEDVAEELIQDITQK	1097	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.721.2	19.3421	3	2036.9803	2036.9942	K	L	84	101
PSM	FYPEDVAEELIQDITQK	1098	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.779.3	20.89282	3	2036.9830	2036.9942	K	L	84	101
PSM	KYPIDLAGLLQYVANQLK	1099	sp|Q8NI27|THOC2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.936.3	25.06957	3	2046.1393	2046.1513	R	A	652	670
PSM	FGVICLEDLIHEIAFPGK	1100	sp|Q6DKI1|RL7L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.544.3	14.56088	3	2057.0557	2057.0656	K	H	180	198
PSM	SIFWELQDIIPFGNNPIFR	1101	sp|Q15392-2|DHC24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.886.5	23.72453	3	2305.1722	2305.1895	R	Y	293	312
PSM	SLLDCHIIPALLQGLLSPDLK	1102	sp|Q8IUR7-2|ARMC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.551.3	14.75048	3	2315.2750	2315.2923	K	F	86	107
PSM	ADIWSFGITAIELATGAAPYHK	1103	sp|O95747|OXSR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.859.5	23.00138	3	2331.1729	2331.1899	K	Y	208	230
PSM	SSELEESLLVLPFSYVPDILK	1104	sp|Q9UNX4|WDR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.797.8	21.38542	3	2377.2511	2377.2668	K	L	817	838
PSM	DMDLTEVITGTLWNLSSHDSIK	1105	sp|O60716-10|CTND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.475.4	12.71482	3	2474.1853	2474.1999	R	M	411	433
PSM	GGYFLVDFYAPTAAVESMVEHLSR	1106	sp|P82932|RT06_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.667.10	17.89602	3	2658.2617	2658.2788	R	D	61	85
PSM	ALQSNIIPFCDEVMQLLLENLGNENVHR	1107	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	10-UNIMOD:4	ms_run[1]:scan=1.1.966.3	25.8768	5	3265.6001	3265.6223	R	S	535	563
PSM	DQEGQDVLLFIDNIFR	1108	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1530.2	40.93896	3	1920.9487	1920.9581	R	F	295	311
PSM	DQQEAALVDMVNDGVEDLR	1109	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1197.2	32.11663	3	2115.9454	2115.9743	K	C	83	102
PSM	ALLLPDYYLVTVMLSGIK	1110	sp|Q7KZF4|SND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1529.3	40.91335	3	2008.1194	2008.1319	R	C	210	228
PSM	GVLACLDGYMNIALEQTEEYVNGQLK	1111	sp|P62312|LSM6_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.1515.6	40.53502	4	2927.3857	2927.4045	R	N	32	58
PSM	GKYVVLFFYPLDFTFVCPTEIIAFSNR	1112	sp|P32119-2|PRDX2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	17-UNIMOD:4	ms_run[1]:scan=1.1.1304.3	34.92843	4	3242.6333	3242.6515	K	A	35	62
PSM	DLADELALVDVIEDK	1113	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1545.2	41.35185	3	1656.8383	1656.8458	K	L	72	87
PSM	LYQVEYAMEAIGHAGTCLGILANDGVLLAAER	1114	sp|P25789|PSA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	17-UNIMOD:4	ms_run[1]:scan=1.1.1081.5	28.98898	4	3417.6829	3417.7061	R	R	18	50
PSM	EQQEAIEHIDEVQNEIDRLNEQASEEILK	1115	sp|Q01105-2|SET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1430.2	38.24165	4	3448.6369	3448.6593	K	V	27	56
PSM	NAIQLLASFLANNPFSCK	1116	sp|Q15021|CND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	17-UNIMOD:4	ms_run[1]:scan=1.1.1560.9	41.78493	2	2007.0010	2007.0248	K	L	423	441
PSM	LQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLR	1117	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	10-UNIMOD:4,36-UNIMOD:4	ms_run[1]:scan=1.1.1014.6	27.18703	4	4156.0829	4156.1085	R	E	155	193
PSM	LQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLR	1118	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	10-UNIMOD:4,36-UNIMOD:4	ms_run[1]:scan=1.1.1052.9	28.21572	4	4156.0789	4156.1085	R	E	155	193
PSM	IIPAIATTTAAVVGLVCLELYK	1119	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	17-UNIMOD:4	ms_run[1]:scan=1.1.1561.9	41.81265	2	2315.3032	2315.3174	K	V	850	872
PSM	ILVQQTLNILQQLAVAMGPNIK	1120	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1035.5	27.7522	3	2404.3666	2404.3876	K	Q	915	937
PSM	NNIDVFYFSCLIPLNVLFVEDGK	1121	sp|P63010-2|AP2B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	10-UNIMOD:4	ms_run[1]:scan=1.1.1366.6	36.57504	3	2715.3352	2715.3618	K	M	823	846
PSM	TISALAIAALAEAATPYGIESFDSVLK	1122	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1152.6	30.91267	3	2721.4267	2721.4476	R	P	703	730
PSM	VFQSSANYAENFIQSIISTVEPAQR	1123	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1252.5	33.60707	3	2798.3701	2798.3875	K	Q	28	53
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	1124	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1325.2	35.49337	5	3503.9166	3503.9392	K	S	754	787
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1125	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1071.2	28.71677	5	3528.6661	3528.6905	R	R	85	117
PSM	GETSLQSSETHPPEVALPPVGEPPALENSTALLEGVNTVVVTTSAPEALLASWAR	1126	sp|Q7L190|DPPA4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1184.5	31.7804	5	5618.8386	5618.8632	K	I	154	209
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	1127	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.695.7	18.6492	5	4113.1201	4113.1436	K	D	157	198
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1128	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1332.2	35.68312	5	3528.6646	3528.6905	R	R	85	117
PSM	VFQSSANYAENFIQSIISTVEPAQR	1129	sp|P36871|PGM1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1264.3	33.89793	4	2798.3661	2798.3875	K	Q	28	53
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	1130	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.1326.3	35.52215	5	3503.9166	3503.9392	K	S	754	787
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1131	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.253.3	6.7533	5	3601.6591	3601.6891	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	1132	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	27-UNIMOD:4	ms_run[1]:scan=1.1.1560.7	41.7816	4	3436.6745	3436.6973	R	R	85	117
PSM	PLTPLQEEMASLLQQIEIER	1133	sp|Q9H2W6|RM46_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.137.2	3.644183	4	2337.2165	2337.2249	K	S	62	82
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	1134	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	5-UNIMOD:4	ms_run[1]:scan=1.1.94.11	2.495267	4	4320.1537	4320.1835	K	A	198	238
PSM	LCPGGQLPFLLYGTEVHTDTNKIEEFLEAVLCPPR	1135	sp|O00299|CLIC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24	2-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=1.1.1560.9	41.78493	4	4012.9869	4013.0067	K	Y	58	93
PSM	LVNLYGLLHGLQAAVAQQDTLMEAR	1136	sp|Q92974-2|ARHG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	24		ms_run[1]:scan=1.1.164.6	4.3821	4	2723.4253	2723.4428	R	F	741	766
PSM	CDISLQFFLPFSLGK	1137	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1376.6	36.82903	2	1753.8632	1753.8742	K	E	157	172
PSM	CLELFSELAEDK	1138	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1001.4	26.82875	2	1436.6482	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1139	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1365.3	36.54462	2	1435.6460	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1140	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.849.3	22.73667	2	1435.6432	1435.6532	K	E	412	424
PSM	CLELFTELAEDK	1141	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1231.2	33.03527	2	1449.6593	1449.6692	K	E	420	432
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	1142	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.737.3	19.77665	4	2844.402094	2843.416381	R	N	766	791
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	1143	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.713.9	19.14157	3	2844.400571	2843.416381	R	N	766	791
PSM	IGGILANELSVDEAALHAAVIAINEAIDRR	1144	sp|P46940|IQGA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.1558.5	41.72245	4	3114.657294	3113.683312	K	I	202	232
PSM	CILVITWIQHLIPK	1145	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1574.3	42.15785	2	1715.9682	1715.9792	K	I	118	132
PSM	ASVSELACIYSALILHDDEVTVTEDK	1146	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1119.6	30.0236	3	2919.3832	2919.4052	M	I	2	28
PSM	VNPTVFFDIAVDGEPLGR	1147	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.365.2	9.769083	3	1986.9912	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	1148	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.251.2	6.696017	3	1986.9956	1987.0046	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	1149	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:1	ms_run[1]:scan=1.1.213.2	5.672583	3	1986.9902	1987.0042	M	V	2	20
PSM	ALDLFSDNAPPPELLEIINEDIAK	1150	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.317.6	8.484883	3	2637.372671	2636.358515	R	R	265	289
PSM	QELSSELSTLLSSLSR	1151	sp|Q5SRE5|NU188_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=1.1.510.8	13.66888	2	1731.8722	1731.8882	K	Y	1685	1701
PSM	QEAIDWLLGLAVR	1152	sp|Q9Y224|RTRAF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:28	ms_run[1]:scan=1.1.1300.3	34.82421	2	1465.7849	1465.7924	R	L	77	90
PSM	CANLFEALVGTLK	1153	sp|Q9P1F3|ABRAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	24	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1125.2	30.17082	2	1417.7171	1417.7270	K	A	39	52
PSM	SSTSPTTNVLLSPLSVATALSALSLGAEQR	1154	sp|P36955|PEDF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24		ms_run[1]:scan=1.1.719.4	19.29818	3	2971.573271	2970.587346	R	T	70	100
PSM	SHCIAEVENDEMPADLPSLAADFVESK	1155	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	24	3-UNIMOD:4	ms_run[1]:scan=1.1.1379.6	36.91	3	2974.342871	2973.337204	K	D	311	338
PSM	ANTNEVLWAVVAAFTK	1156	sp|Q9H4A6|GOLP3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.25.2	0.6167167	3	1732.9021	1732.9148	K	-	283	299
PSM	NQSLFCWEIPVQIVSHL	1157	sp|P61916|NPC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.22.5	0.5417167	3	2069.0290	2069.0404	K	-	135	152
PSM	EALLLVTVLTSLSK	1158	sp|Q9NVI1-1|FANCI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.6.7	0.1227333	2	1485.8938	1485.9018	K	L	921	935
PSM	LCYVALDFEQEMATAASSSSLEK	1159	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.102.6	2.711183	3	2549.1526	2549.1665	K	S	216	239
PSM	HAQPALLYLVPACIGFPVLVALAK	1160	sp|Q8TCT9-2|HM13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	13-UNIMOD:4	ms_run[1]:scan=1.1.333.2	8.904716	4	2560.4389	2560.4603	K	G	314	338
PSM	TISPEHVIQALESLGFGSYISEVK	1161	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.219.5	5.838083	4	2603.3325	2603.3483	K	E	65	89
PSM	DIVAIILNEFR	1162	sp|P49643|PRI2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.257.2	6.859967	2	1301.7244	1301.7343	K	A	213	224
PSM	FIEAEQVPELEAVLHLVIASSDTR	1163	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	23		ms_run[1]:scan=1.1.125.2	3.318917	4	2665.3704941913206	2665.3962964642797	K	H	250	274
PSM	LYHCAAYNCAISVICCVFNELK	1164	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4,9-UNIMOD:4,15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.55.3	1.42915	4	2704.2073	2704.2270	R	F	1939	1961
PSM	DITYFIQQLLR	1165	sp|Q9C0K3|ARP3C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.173.2	4.61925	3	1408.7632	1408.7714	R	E	70	81
PSM	DAAHLVNQDDPNVLEIWNLVFIQYNR	1166	sp|P49588-2|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.386.5	10.34545	4	3095.5209	3095.5465	R	E	207	233
PSM	DPPLAAVTTAVQELLR	1167	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.145.2	3.86065	3	1692.9328	1692.9410	K	L	955	971
PSM	YSEPDLAVDFDNFVCCLVR	1168	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.161.8	4.304367	3	2318.0185	2318.0348	R	L	663	682
PSM	FLESVEGNQNYPLLLLTLLEK	1169	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.291.3	7.777783	3	2432.3038	2432.3202	K	S	32	53
PSM	FLESVEGNQNYPLLLLTLLEK	1170	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.350.5	9.368834	3	2432.3038	2432.3202	K	S	32	53
PSM	DQAVENILVSPVVVASSLGLVSLGGK	1171	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.309.7	8.266067	3	2550.4102	2550.4269	K	A	61	87
PSM	ALDLFSDNAPPPELLEIINEDIAK	1172	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.454.7	12.18743	3	2636.3422	2636.3585	R	R	317	341
PSM	DLPTSPVDLVINCLDCPENVFLR	1173	sp|Q96F86|EDC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	13-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.265.8	7.087934	3	2685.2956	2685.3142	K	D	398	421
PSM	GEGTGVLGSLSLPLSELLVADQLCLDR	1174	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	24-UNIMOD:4	ms_run[1]:scan=1.1.154.9	4.11615	3	2811.4495	2811.4688	R	W	877	904
PSM	VLSTAGPSEALQPLVYPLAQVIIGCIK	1175	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	25-UNIMOD:4	ms_run[1]:scan=1.1.148.10	3.955367	3	2836.5625	2836.5772	R	L	418	445
PSM	VPFALFESFPEDFYVEGLPEGVPFR	1176	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.210.11	5.6076	3	2887.3954	2887.4109	K	R	716	741
PSM	EDANVFASAMMHALEVLNSQETGPTLPR	1177	sp|Q8N8S7-2|ENAH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.31.3	0.78025	5	3027.4201	3027.4430	K	Q	95	123
PSM	TATFAISILQQIELDLK	1178	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.753.2	20.20683	3	1903.0588	1903.0666	K	A	83	100
PSM	GVNPSLVSWLTTMMGLR	1179	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.960.2	25.72907	2	1860.9538	1860.9590	R	L	899	916
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	1180	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.732.8	19.65457	3	2908.3990	2908.4310	K	N	101	130
PSM	GVNPSLVSWLTTMMGLR	1181	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.979.2	26.22668	3	1860.9475	1860.9590	R	L	899	916
PSM	SLEGDLEDLKDQIAQLEASLAAAK	1182	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.919.2	24.6092	4	2527.2845	2527.3017	K	K	158	182
PSM	LLTAPELILDQWFQLSSSGPNSR	1183	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.649.2	17.39678	4	2571.3145	2571.3333	R	L	574	597
PSM	EQTVQYILTMVDDMLQENHQR	1184	sp|Q9UI12-2|VATH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.742.3	19.9152	4	2590.2065	2590.2156	K	V	87	108
PSM	VPTWSDFPSWAMELLVEK	1185	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.627.3	16.80828	3	2134.0252	2134.0445	R	A	936	954
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	1186	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.675.5	18.10465	4	2875.5021	2875.5179	K	K	591	617
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	1187	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.732.3	19.64123	4	2875.5021	2875.5179	K	K	591	617
PSM	DVQNTFYDIVAELGAMEHAQAVDYIK	1188	sp|P16435|NCPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.988.2	26.46963	4	2939.3821	2939.4011	R	K	638	664
PSM	ILACGGDGTVGWILSTLDQLR	1189	sp|Q13574-2|DGKZ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	4-UNIMOD:4	ms_run[1]:scan=1.1.491.4	13.1529	3	2244.1405	2244.1573	R	L	348	369
PSM	GQVLSVCVEEENIIPYITNVLQNPDLALR	1190	sp|Q00610|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.547.4	14.64865	4	3295.6912941913206	3295.7122282138093	K	M	322	351
PSM	VDIVAINDPFIDLNYMVYMFQYDSTHGK	1191	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	19-UNIMOD:35	ms_run[1]:scan=1.1.928.8	24.86673	4	3323.5565	3323.5519	K	F	28	56
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1192	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.519.6	13.91313	4	3585.6673	3585.6942	R	R	85	117
PSM	GLSGLTQVLLNVLTLNR	1193	sp|Q9UJ14|GGT7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.975.3	26.12252	3	1810.0573	1810.0676	R	N	569	586
PSM	QQIACIGGPPNICLDRLENWITSLAESQLQTR	1194	sp|P40763-2|STAT3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.887.5	23.75492	4	3680.8157	3680.8403	R	Q	247	279
PSM	TGAFSIPVIQIVYETLK	1195	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.591.7	15.84572	2	1878.0394	1878.0502	K	D	53	70
PSM	TATFAISILQQIELDLK	1196	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.812.3	21.78308	3	1903.0519	1903.0666	K	A	83	100
PSM	TATFAISILQQIELDLK	1197	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.734.2	19.69373	3	1903.0537	1903.0666	K	A	83	100
PSM	GPGTSFEFALAIVEALNGK	1198	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.861.2	23.04922	3	1919.9869	1919.9993	R	E	157	176
PSM	FYPEDVAEELIQDITQK	1199	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.550.4	14.72498	3	2036.9836	2036.9942	K	L	84	101
PSM	QFEAPTLAEGFSAILEIPFR	1200	sp|Q96T60-2|PNKP_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.754.3	20.23503	3	2235.1438	2235.1575	K	L	446	466
PSM	INALTAASEAACLIVSVDETIK	1201	sp|Q99832-2|TCPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	12-UNIMOD:4	ms_run[1]:scan=1.1.607.4	16.27365	3	2288.1772	2288.1933	R	N	296	318
PSM	IQFNDLQSLLCATLQNVLRK	1202	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.904.4	24.20822	3	2373.2692	2373.2838	R	V	430	450
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	1203	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.717.10	19.2477	3	2875.5010	2875.5179	K	K	591	617
PSM	GQVLSVCVEEENIIPYITNVLQNPDLALR	1204	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:4	ms_run[1]:scan=1.1.526.9	14.10613	3	3295.6942	3295.7122	K	M	322	351
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	1205	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	27-UNIMOD:4	ms_run[1]:scan=1.1.948.8	25.40605	3	3436.6852	3436.6973	R	R	85	117
PSM	SLADELALVDVLEDK	1206	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1526.3	40.83092	3	1628.8471	1628.8509	K	L	44	59
PSM	TATFAISILQQIELDLK	1207	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1131.2	30.33438	3	1903.0357	1903.0666	K	A	83	100
PSM	FYPEDVAEELIQDITQK	1208	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1240.2	33.27962	3	2036.9836	2036.9942	K	L	84	101
PSM	GYTSWAIGLSVADLAESIMK	1209	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1047.2	28.06552	3	2111.0440	2111.0609	K	N	275	295
PSM	DQQEAALVDMVNDGVEDLR	1210	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1221.3	32.76917	3	2115.9565	2115.9743	K	C	83	102
PSM	FDTLCDLYDTLTITQAVIFCNTK	1211	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	5-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.1535.9	41.0878	3	2751.2974	2751.3136	K	R	265	288
PSM	ESQLALIVCPLEQLLQGINPR	1212	sp|Q92621|NU205_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	9-UNIMOD:4	ms_run[1]:scan=1.1.1509.2	40.36425	4	2390.2849	2390.2991	R	T	869	890
PSM	EGISQEALHTQMLTAVQEISHLIEPLANAAR	1213	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1158.2	31.06633	5	3369.7156	3369.7350	R	A	1691	1722
PSM	NIGLTELVQIIINTTHLEK	1214	sp|Q9Y2D4-2|EXC6B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1115.4	29.90412	3	2148.1969	2148.2154	K	S	550	569
PSM	LGLALNFSVFYYEILNNPELACTLAK	1215	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	22-UNIMOD:4	ms_run[1]:scan=1.1.1210.6	32.47497	4	2972.5165	2972.5357	R	T	168	194
PSM	ELEAVCQDVLSLLDNYLIK	1216	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.1453.6	38.84817	3	2234.1376	2234.1504	K	N	92	111
PSM	SGETEDTFIADLVVGLCTGQIK	1217	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	17-UNIMOD:4	ms_run[1]:scan=1.1.1555.4	41.63583	3	2352.1453	2352.1519	R	T	280	302
PSM	SYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDR	1218	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1457.6	38.95307	6	4832.2573	4832.2875	R	H	230	275
PSM	SLCNLEESITSAGRDDLESFQLEISGFLK	1219	sp|Q52LJ0-2|FA98B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	3-UNIMOD:4	ms_run[1]:scan=1.1.1262.4	33.8512	4	3257.5549	3257.5762	K	E	61	90
PSM	EGISQEALHTQMLTAVQEISHLIEPLANAAR	1220	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1176.3	31.55458	4	3369.7145	3369.7350	R	A	1691	1722
PSM	GFLEFVEDFIQVPR	1221	sp|P51114-2|FXR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1031.7	27.64712	2	1694.8552	1694.8668	R	N	277	291
PSM	DAIITCNPEEFIVEALQLPNFQQSVQEYR	1222	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.1082.5	29.02247	4	3450.6517	3450.6765	R	R	342	371
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	1223	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1335.6	35.77597	4	3503.9193	3503.9392	K	S	754	787
PSM	VVNKLIQFLISLVQSNR	1224	sp|Q00613-2|HSF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1045.3	28.01637	3	1970.1523	1970.1677	K	I	185	202
PSM	QALNLPDVFGLVVLPLELK	1225	sp|Q9Y3I1-2|FBX7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1163.2	31.19865	3	2077.2064	2077.2187	R	L	243	262
PSM	LCYVALDFEQEMATAASSSSLEK	1226	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	2-UNIMOD:4	ms_run[1]:scan=1.1.1014.4	27.18037	3	2549.1547	2549.1665	K	S	216	239
PSM	YGAVDPLLALLAVPDMSSLACGYLR	1227	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	21-UNIMOD:4	ms_run[1]:scan=1.1.1543.9	41.30838	3	2664.3475	2664.3655	K	N	203	228
PSM	YGAVDPLLALLAVPDMSSLACGYLR	1228	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	21-UNIMOD:4	ms_run[1]:scan=1.1.1541.9	41.25308	3	2664.3475	2664.3655	K	N	203	228
PSM	DGPYITAEEAVAVYTTTVHWLESR	1229	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1446.6	38.66003	3	2707.3036	2707.3130	K	R	797	821
PSM	KFESQDTVALLEAILDGIVDPVDSTLR	1230	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1569.8	42.03062	3	2943.5287	2943.5441	K	D	1000	1027
PSM	LGLALNFSVFYYEILNNPELACTLAK	1231	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	22-UNIMOD:4	ms_run[1]:scan=1.1.1250.5	33.55995	3	2972.5132	2972.5357	R	T	168	194
PSM	AFAGDIANQLATDAVQILGGNGFNTEYPVEK	1232	sp|P11310-2|ACADM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1021.5	27.37665	3	3222.5602	3222.5833	K	L	363	394
PSM	ASFEEASNQLINHIEQFLDTNETPYFMK	1233	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1552.11	41.56188	3	3315.5182	3315.5394	K	S	607	635
PSM	TALLDAAGVASLLTTAEVVVTEIPK	1234	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1581.4	42.34758	3	2481.3811	2481.3942	R	E	527	552
PSM	GYTNWAIGLSVADLIESMLK	1235	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1568.11	42.0084	2	2180.1560	2180.1187	K	N	247	267
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1236	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1328.3	35.57597	5	3528.6646	3528.6905	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1237	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.377.9	10.1057	4	3585.6725	3585.6942	R	R	85	117
PSM	IVAPELYIAVGISGAIQHLAGMK	1238	sp|P13804-2|ETFA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1562.7	41.83723	3	2350.2949	2350.3082	K	D	220	243
PSM	SLEGDLEDLKDQIAQLEASLAAAK	1239	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.872.7	23.35193	3	2527.2838	2527.3017	K	K	158	182
PSM	TFEEAAAQLLESSVQNLFK	1240	sp|Q9UKN8|TF3C4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	23		ms_run[1]:scan=1.1.1561.3	41.80265	3	2124.0613	2124.0739	K	Q	517	536
PSM	QLEGDCCSFITQLVNHFWK	1241	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,6-UNIMOD:4,7-UNIMOD:4	ms_run[1]:scan=1.1.989.4	26.50352	3	2364.0522	2364.0662	K	L	2613	2632
PSM	NGFLNLALPFFGFSEPLAAPR	1242	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1364.2	36.51453	3	2278.162271	2277.194625	K	H	924	945
PSM	CLELFSELAEDK	1243	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1578.3	42.26588	2	1435.6472	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1244	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1039.2	27.85575	2	1435.6412	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1245	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1568.3	41.99507	2	1435.6472	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1246	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1172.4	31.44657	2	1435.6444	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1247	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.517.2	13.84903	2	1436.6432	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1248	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1540.6	41.22048	2	1435.6462	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1249	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.594.3	15.91695	2	1435.6450	1435.6536	K	E	412	424
PSM	QDLVISLLPYVLHPLVAK	1250	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.1450.2	38.756	3	2000.1582	2000.1702	K	A	547	565
PSM	CLELFTELAEDK	1251	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1418.2	37.9035	2	1449.6582	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1252	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1018.4	27.2953	2	1450.6622	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1253	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.923.2	24.71705	2	1449.6599	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1254	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1174.3	31.50388	2	1449.6595	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1255	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1338.4	35.84465	2	1449.6601	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1256	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1397.4	37.39275	2	1449.6601	1449.6692	K	E	420	432
PSM	QLDLLCDIPLVGFINSLK	1257	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	6-UNIMOD:4	ms_run[1]:scan=1.1.1495.3	39.98343	3	2058.110471	2057.123099	R	F	411	429
PSM	TASPDYLVVLFGITAGATGAK	1258	sp|Q6NXG1|ESRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.660.2	17.69462	3	2093.0822	2093.1042	M	L	2	23
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	1259	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	11-UNIMOD:4	ms_run[1]:scan=1.1.483.7	12.94143	3	2909.421671	2908.431045	K	N	101	130
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1260	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.806.5	21.63065	4	3586.672494	3585.694213	R	R	85	117
PSM	QNLFQEAEEFLYR	1261	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.563.2	15.07363	3	1668.7672	1668.7782	R	F	22	35
PSM	ASVSELACIYSALILHDDEVTVTEDK	1262	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1573.10	42.14237	3	2919.3912	2919.4052	M	I	2	28
PSM	ASVSELACIYSALILHDDEVTVTEDK	1263	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1195.4	32.07778	3	2919.3882	2919.4052	M	I	2	28
PSM	ASVSELACIYSALILHDDEVTVTEDK	1264	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1214.6	32.59002	3	2919.3922	2919.4052	M	I	2	28
PSM	ASVSELACIYSALILHDDEVTVTEDK	1265	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.245.4	6.54735	3	2919.3982	2919.4054	M	I	2	28
PSM	QLTEMLPSILNQLGADSLTSLR	1266	sp|P20290|BTF3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.1572.5	42.107	3	2382.2322	2382.2462	K	R	142	164
PSM	VNPTVFFDIAVDGEPLGR	1267	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.1567.9	41.97772	2	1986.9952	1987.0046	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	1268	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.136.11	3.6321	2	1986.9902	1987.0042	M	V	2	20
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1269	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	27-UNIMOD:4	ms_run[1]:scan=1.1.589.11	15.7916	4	3513.670494	3512.695593	R	R	85	117
PSM	FYPEDVAEELIQDITQK	1270	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.626.5	16.77793	3	2037.980171	2036.994253	K	L	84	101
PSM	FYPEDVAEELIQDITQK	1271	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.683.2	18.31617	3	2037.981071	2036.994253	K	L	84	101
PSM	GLNTIPLFVQLLYSPIENIQR	1272	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.984.2	26.35995	4	2428.344094	2427.352582	R	V	592	613
PSM	QAAPCVLFFDELDSIAK	1273	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28,5-UNIMOD:4	ms_run[1]:scan=1.1.548.4	14.67072	3	1905.9082	1905.9177	R	A	568	585
PSM	QLSAFGEYVAEILPK	1274	sp|O75489|NDUS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.186.6	4.976167	2	1646.8454	1646.8551	K	Y	57	72
PSM	SDSVTDSGPTFNYLLDMPLWYLTK	1275	sp|P11388|TOP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.492.10	13.18333	3	2763.301271	2762.314935	K	E	1115	1139
PSM	QLQVLAGIYPIAQIQEPYTAVGYLASR	1276	sp|P36915|GNL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.36.11	0.9287	3	2944.5522	2944.5692	R	I	424	451
PSM	QELSSELSTLLSSLSR	1277	sp|Q5SRE5|NU188_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:28	ms_run[1]:scan=1.1.531.2	14.2414	2	1731.8789	1731.8885	K	Y	1685	1701
PSM	AAGELEGGKPLSGLLNALAQDTFHGYPGITEELLR	1278	sp|Q8N668|COMD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:1	ms_run[1]:scan=1.1.668.9	17.92158	4	3678.8632	3678.8892	M	S	2	37
PSM	CMALAQLLVEQNFPAIAIHR	1279	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	23	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.578.4	15.48265	3	2277.1796	2277.1757	R	G	299	319
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1280	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.179.5	4.78585	5	3600.653118	3601.689128	R	R	85	117
PSM	SANYCHTSQGDPIGLILLGEVALGNMYELK	1281	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	5-UNIMOD:4,26-UNIMOD:35	ms_run[1]:scan=1.1.763.3	20.48937	4	3277.569694	3278.595151	K	H	904	934
PSM	DQFPEVYVPTVFENYVADIEVDGK	1282	sp|P61586|RHOA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1141.4	30.61857	3	2773.320671	2772.317044	K	Q	28	52
PSM	IGVGAPVYMAAVLEYLTAEILELAGNAAR	1283	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:35	ms_run[1]:scan=1.1.1576.6	42.21703	4	2989.539294	2990.578696	R	D	41	70
PSM	IGVGAPVYMAAVLEYLTAEILELAGNAAR	1284	sp|O75367|H2AY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23	9-UNIMOD:35	ms_run[1]:scan=1.1.1578.10	42.27755	3	2989.544171	2990.578696	R	D	41	70
PSM	GFDQAPVVDEAGVILGMVTLGNMLSSLLAGK	1285	sp|P0DN79|CBSL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	23		ms_run[1]:scan=1.1.1578.11	42.27922	3	3100.604171	3101.614094	K	V	442	473
PSM	SHQVLAQLLDTLLAIGTK	1286	sp|Q96HW7-2|INT4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.444.2	11.90782	3	1920.1117	1920.1044	K	L	123	141
PSM	SGETEDTFIADLVVGLCTGQIK	1287	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	17-UNIMOD:4	ms_run[1]:scan=1.1.376.5	10.08182	3	2352.1333	2352.1519	R	T	280	302
PSM	DPPLAAVTTAVQELLR	1288	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.129.8	3.437583	2	1692.9116	1692.9410	K	L	955	971
PSM	LCYVALDFEQEMATAASSSSLEK	1289	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	2-UNIMOD:4	ms_run[1]:scan=1.1.28.7	0.7058167	3	2549.1583	2549.1665	K	S	216	239
PSM	TSSCPVIFILDEFDLFAHHK	1290	sp|O43929-2|ORC4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.63.2	1.643467	4	2375.1437	2375.1620	R	N	65	85
PSM	WNVLGLQGALLTHFLQPIYLK	1291	sp|P55265-2|DSRAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.435.2	11.66433	4	2423.3529	2423.3729	R	S	1017	1038
PSM	SNILEAWSEGVALLQDVR	1292	sp|Q9BUA3|SPNDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.127.3	3.3749	3	1999.0279	1999.0374	K	A	126	144
PSM	DITYFIQQLLR	1293	sp|Q9C0K3|ARP3C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.212.3	5.64755	2	1408.7630	1408.7714	R	E	70	81
PSM	VLSTAGPSEALQPLVYPLAQVIIGCIK	1294	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	25-UNIMOD:4	ms_run[1]:scan=1.1.148.4	3.945367	4	2836.5605	2836.5772	R	L	418	445
PSM	VLELAQLLDQIWR	1295	sp|Q9P2I0|CPSF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.306.2	8.176817	3	1595.8957	1595.9035	R	T	243	256
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1296	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.439.6	11.78733	4	3585.6693	3585.6942	R	R	85	117
PSM	GSTPEAAAQVVQWVSFADSDIVPPASTWVFPTLGIMHHNK	1297	sp|P26641-2|EF1G_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.252.3	6.7364	4	4290.0909	4290.1209	R	Q	136	176
PSM	SISTSLPVLDLIDAIAPNAVR	1298	sp|Q14651|PLSI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.349.5	9.348367	3	2164.1959	2164.2103	K	Q	546	567
PSM	RGPECVQYLQQEYLPSLQVAPEIIQEFCQALQQPDAK	1299	sp|O43592|XPOT_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4,28-UNIMOD:4	ms_run[1]:scan=1.1.173.11	4.63425	4	4373.1149	4373.1460	K	V	911	948
PSM	THLYTLILNPDNSFEILVDQSVVNSGNLLNDMTPPVNPSR	1300	sp|P27824-2|CALX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.392.8	10.51405	4	4436.2029	4436.2322	K	E	270	310
PSM	YFILPDSLPLDTLLVDVEPK	1301	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.417.5	11.18062	3	2286.2254	2286.2399	R	V	67	87
PSM	YSEPDLAVDFDNFVCCLVR	1302	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.144.7	3.842033	3	2318.0185	2318.0348	R	L	663	682
PSM	LEQVSSDEGIGTLAENLLEALR	1303	sp|Q5T4S7-2|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.455.5	12.21802	3	2356.2025	2356.2121	K	E	4751	4773
PSM	FIEAEQVPELEAVLHLVIASSDTR	1304	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.123.9	3.276433	3	2665.3750	2665.3963	K	H	250	274
PSM	YGASQVEDMGNIILAMISEPYNHR	1305	sp|Q6NXG1-2|ESRP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.148.9	3.9537	3	2707.2640	2707.2734	R	F	176	200
PSM	YDVPSNAELWQVSWQPFLDGIFPAK	1306	sp|Q9BY44-2|EIF2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.287.7	7.68035	3	2906.4178	2906.4279	K	T	186	211
PSM	LHIQNPSFSQINQLVSTIMSASTTTLR	1307	sp|Q9NRH3|TBG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.176.10	4.7135	3	2986.5325	2986.5546	R	Y	218	245
PSM	SAGDLGIAVCNVPAASVEETADSTLCHILNLYR	1308	sp|Q13363-2|CTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.39.10	1.009717	3	3515.6842	3515.7025	K	R	98	131
PSM	DILATTPPPVQPPILTITCPTFGDWAQLAPAVPGLQGALR	1309	sp|Q66K74-2|MAP1S_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	19-UNIMOD:4	ms_run[1]:scan=1.1.110.9	2.9239	4	4192.2149	4192.2395	R	L	125	165
PSM	FYPEDVAEELIQDITQK	1310	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.798.4	21.41083	3	2036.9767	2036.9942	K	L	84	101
PSM	EYITPFIRPVMQALLHIIR	1311	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.798.2	21.40417	4	2309.2917	2309.3082	K	E	533	552
PSM	DLLQIIFSFSK	1312	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.876.2	23.45082	2	1309.7184	1309.7282	R	A	304	315
PSM	DLVEAVAHILGIR	1313	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.772.2	20.70017	3	1404.8041	1404.8089	R	D	2126	2139
PSM	LTPGCEAEAETEAICFFVQQFTDMEHNR	1314	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.687.3	18.4262	4	3329.4229	3329.4427	K	V	2355	2383
PSM	QLCETSTPLHPQLLPLIDVYINSILTPASK	1315	sp|Q9H0H0|INT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.733.5	19.67508	4	3360.7877	3360.8003	R	S	580	610
PSM	YDHQAEEDLRNWIEEVTGMSIGPNFQLGLK	1316	sp|Q15417-3|CNN3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.516.9	13.83217	4	3488.6465	3488.6670	K	D	24	54
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1317	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.509.7	13.63865	4	3585.6685	3585.6942	R	R	85	117
PSM	LQTENLQSLTEGLLGATHDFQSIVQGCLGDCAK	1318	sp|Q969H4-2|CNKR1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	27-UNIMOD:4,31-UNIMOD:4	ms_run[1]:scan=1.1.766.6	20.57028	4	3602.7061	3602.7345	R	T	74	107
PSM	SVPVSAGGEGETSPYSLEASPLGQLMNMLSHPVIR	1319	sp|Q7Z6Z7-2|HUWE1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.898.5	24.04837	4	3609.7569	3609.7807	K	R	3394	3429
PSM	GVNPSLVSWLTTMMGLR	1320	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.998.3	26.7438	3	1860.9481	1860.9590	R	L	899	916
PSM	ETQPPETVQNWIELLSGETWNPLK	1321	sp|Q9H4A6|GOLP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.643.5	17.24732	3	2808.3778	2808.3970	K	L	142	166
PSM	EQPGNTISAGQEDFPSVLLETAASLPSLSPLSAASFK	1322	sp|Q9NQC3-6|RTN4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.560.10	15.00578	4	3758.8653	3758.8890	K	E	5	42
PSM	NTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGK	1323	sp|Q09028-2|RBBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.784.5	21.03497	4	3824.9005	3824.9236	K	D	26	59
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	1324	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.653.8	17.51492	3	2908.4107	2908.4310	K	N	101	130
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	1325	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.714.6	19.16852	4	4113.1149	4113.1436	K	D	157	198
PSM	AVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSVFR	1326	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.741.8	19.8982	4	4113.1229	4113.1436	K	D	157	198
PSM	NGFLNLALPFFGFSEPLAAPR	1327	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.596.3	15.96807	4	2277.1801	2277.1946	K	H	884	905
PSM	EYITPFIRPVMQALLHIIR	1328	sp|O95373|IPO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.779.2	20.88948	4	2309.2917	2309.3082	K	E	533	552
PSM	IQFNDLQSLLCATLQNVLRK	1329	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	11-UNIMOD:4	ms_run[1]:scan=1.1.890.8	23.83932	3	2373.2692	2373.2838	R	V	430	450
PSM	VNTFSALANIDLALEQGDALALFR	1330	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.944.7	25.29833	3	2561.3314	2561.3489	K	A	303	327
PSM	ALDLFSDNAPPPELLEIINEDIAK	1331	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.516.10	13.83383	3	2636.3416	2636.3585	R	R	317	341
PSM	GGYFLVDFYAPTAAVESMVEHLSR	1332	sp|P82932|RT06_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.648.9	17.38308	3	2658.2617	2658.2788	R	D	61	85
PSM	SLAHLALNDVSLQALPGDVGNLANLVTLELR	1333	sp|Q14160-2|SCRIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.576.3	15.42648	5	3225.7501	3225.7721	R	E	48	79
PSM	SANYCHTSQGDPIGLILLGEVALGNMYELK	1334	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4	ms_run[1]:scan=1.1.740.7	19.87098	3	3262.5832	3262.6002	K	H	904	934
PSM	ALQSNIIPFCDEVMQLLLENLGNENVHR	1335	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	10-UNIMOD:4	ms_run[1]:scan=1.1.969.6	25.96752	3	3265.6042	3265.6223	R	S	535	563
PSM	TPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVR	1336	sp|O43347|MSI1H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.716.9	19.2224	3	3270.7852	3270.8050	R	G	251	285
PSM	LTPGCEAEAETEAICFFVQQFTDMEHNR	1337	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	5-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.694.10	18.62873	3	3329.4262	3329.4427	K	V	2355	2383
PSM	SACVLVSDILGSATGDVQPTMNAIASLAATGLHPGGK	1338	sp|Q15397|PUM3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.738.2	19.80205	5	3578.7901	3578.8073	K	D	506	543
PSM	DTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLK	1339	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.613.7	16.43288	5	3869.8961	3869.9224	K	N	430	467
PSM	LQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLR	1340	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	10-UNIMOD:4,36-UNIMOD:4	ms_run[1]:scan=1.1.999.6	26.77435	5	4156.0896	4156.1085	R	E	155	193
PSM	AVFVDLEPTVIDEVR	1341	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1520.2	40.66503	3	1700.8804	1700.8985	R	T	30	45
PSM	SVVALSPPDLLPVLYLSLNHLGPPQQGLELGVGDGVLLK	1342	sp|P18858|DNLI1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	22		ms_run[1]:scan=1.1.1217.2	32.67087	4	4017.2188941913205	4017.255439834029	R	A	318	357
PSM	SHCIAEVENDEMPADLPSLAADFVESK	1343	sp|P02768-2|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.1448.3	38.70122	4	2973.3185	2973.3372	K	D	119	146
PSM	SHCIAEVENDEMPADLPSLAADFVESK	1344	sp|P02768-2|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	3-UNIMOD:4	ms_run[1]:scan=1.1.1498.4	40.06715	4	2973.3161	2973.3372	K	D	119	146
PSM	IIPAIATTTAAVVGLVCLELYK	1345	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	17-UNIMOD:4	ms_run[1]:scan=1.1.1564.7	41.8923	3	2315.3023	2315.3174	K	V	850	872
PSM	SLADELALVDVLEDK	1346	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1529.8	40.92168	2	1628.8360	1628.8509	K	L	44	59
PSM	DLADELALVDVIEDK	1347	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1526.4	40.83258	3	1656.8380	1656.8458	K	L	72	87
PSM	GGEEPLPEGLFWLLVTGHIPTEEQVSWLSK	1348	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1498.5	40.06882	4	3347.6893	3347.7078	K	E	110	140
PSM	AISCMGQIICNLGDNLGSDLPNTLQIFLER	1349	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.1402.3	37.52892	4	3361.6301	3361.6469	R	L	589	619
PSM	YGAVDPLLALLAVPDMSSLACGYLR	1350	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	21-UNIMOD:4	ms_run[1]:scan=1.1.1511.10	40.43213	3	2664.3475	2664.3655	K	N	203	228
PSM	DQEGQDVLLFIDNIFR	1351	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1491.2	39.87262	3	1920.9472	1920.9581	R	F	295	311
PSM	ITVVGVGQVGMACAISILGK	1352	sp|P07195|LDHB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	13-UNIMOD:4	ms_run[1]:scan=1.1.1525.3	40.80353	3	1972.0753	1972.0850	K	S	24	44
PSM	NVGNAILYETVLTIMDIK	1353	sp|O43747-2|AP1G1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1471.4	39.33197	3	2006.0728	2006.0758	K	S	286	304
PSM	TIGYDPIISPEVSASFGVQQLPLEEIWPLCDFITVHTPLLPSTTGLLNDNTFAQCK	1354	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	30-UNIMOD:4,55-UNIMOD:4	ms_run[1]:scan=1.1.1556.9	41.6727	6	6242.0983	6242.1272	K	K	171	227
PSM	DLISDSNPMVVANAVAALSEIAESHPSSNLLDLNPQSINK	1355	sp|Q10567-2|AP1B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1036.7	27.78273	4	4173.0629	4173.0899	K	L	167	207
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	1356	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1334.3	35.73617	5	3503.9166	3503.9392	K	S	754	787
PSM	GHAADVFEAYTQLLTEMVLR	1357	sp|Q5T4S7-2|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1264.4	33.90294	3	2263.1110	2263.1307	K	L	3147	3167
PSM	YMTGTTVLPFNPAAFGEIVLYLR	1358	sp|Q5VYK3|ECM29_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1140.2	30.59145	3	2572.3234	2572.3400	K	M	578	601
PSM	IGIASQALGIAQTALDCAVNYAENR	1359	sp|P16219|ACADS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	17-UNIMOD:4	ms_run[1]:scan=1.1.1500.9	40.13018	3	2618.2981	2618.3122	R	M	273	298
PSM	LGLALNFSVFYYEILNNPELACTLAK	1360	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	22-UNIMOD:4	ms_run[1]:scan=1.1.1225.7	32.88685	3	2972.5168	2972.5357	R	T	168	194
PSM	YLVTFSPLMDTQDDPQAIIIWDILTGHK	1361	sp|P55884-2|EIF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1025.8	27.48483	3	3229.6132	3229.6369	R	K	387	415
PSM	MDVLQFLEGIPVDENAVHVLVDNNGQGLGQALVQFK	1362	sp|Q9NTZ6|RBM12_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.1265.2	33.93373	4	3905.9737	3905.9986	K	N	558	594
PSM	VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFR	1363	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	27-UNIMOD:4,37-UNIMOD:4	ms_run[1]:scan=1.1.1481.11	39.6154	4	4592.0749	4592.0999	K	T	175	214
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	1364	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22		ms_run[1]:scan=1.1.241.4	6.4347	3	2784.5602	2784.5790	R	T	902	928
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1365	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1352.5	36.20217	4	3528.6729	3528.6905	R	R	85	117
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	1366	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	4-UNIMOD:4	ms_run[1]:scan=1.1.156.4	4.162133	4	2830.4009	2830.4211	K	E	173	198
PSM	LAYSNGKDDEQNFIQNLSLFLCTFLK	1367	sp|O14980|XPO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	22	22-UNIMOD:4	ms_run[1]:scan=1.1.1567.4	41.96938	4	3077.5005	3077.5168	R	E	306	332
PSM	CLELFSELAEDK	1368	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1425.2	38.10478	2	1435.6440	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1369	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1096.4	29.3921	2	1435.6422	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1370	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.689.4	18.48193	2	1435.6458	1435.6536	K	E	412	424
PSM	SLADELALVDVLEDK	1371	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1518.2	40.61035	3	1629.831071	1628.850883	K	L	44	59
PSM	ALMLQGVDLLADAVAVTMGPK	1372	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.947.3	25.366	3	2114.119871	2112.132284	R	G	38	59
PSM	EGISQEALHTQMLTAVQEISHLIEPLANAAR	1373	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1177.2	31.57653	5	3370.719118	3369.735089	R	A	1691	1722
PSM	CLELFTELAEDK	1374	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1250.2	33.54662	2	1450.6672	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1375	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1193.4	32.01686	2	1450.6612	1449.6692	K	E	420	432
PSM	DDAVPNLIQLITNSVEMHAYTVQR	1376	sp|O43747|AP1G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.623.4	16.69723	4	2727.347294	2726.369765	R	L	435	459
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1377	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.1107.6	29.697	4	3586.675694	3585.694213	R	R	85	117
PSM	ASVSELACIYSALILHDDEVTVTEDK	1378	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1081.8	28.99898	3	2919.3942	2919.4052	M	I	2	28
PSM	LPITVLNGAPGFINLCDALNAWQLVK	1379	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	16-UNIMOD:4	ms_run[1]:scan=1.1.496.10	13.29167	3	2837.499971	2836.530957	K	E	226	252
PSM	VNPTVFFDIAVDGEPLGR	1380	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.456.3	12.23525	3	1986.9902	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	1381	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.152.3	4.0522	3	1986.9902	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	1382	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:1	ms_run[1]:scan=1.1.327.5	8.74785	3	1987.9962	1987.0042	M	V	2	20
PSM	QILLGIQELLNEPNIQDPAQAEAYTIYCQNR	1383	sp|P63279|UBC9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28,28-UNIMOD:4	ms_run[1]:scan=1.1.911.7	24.40848	4	3597.7532	3597.7772	K	V	111	142
PSM	LQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLR	1384	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22	10-UNIMOD:4,36-UNIMOD:4	ms_run[1]:scan=1.1.1048.4	28.09742	5	4157.091118	4156.108536	R	E	155	193
PSM	QVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSK	1385	sp|P30049|ATPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.370.8	9.9195	4	4089.2002	4089.2262	R	Y	57	97
PSM	ALDLFSDNAPPPELLEIINEDIAK	1386	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.474.6	12.68955	3	2637.342971	2636.358515	R	R	265	289
PSM	QSQLVVDWLESIAK	1387	sp|P57740|NU107_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	22	1-UNIMOD:28	ms_run[1]:scan=1.1.1216.3	32.63048	2	1597.8249	1597.8346	R	D	265	279
PSM	GGEEPLPEGLFWLLVTGHIPTEEQVSWLSK	1388	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1479.10	39.55915	4	3348.690494	3347.707795	K	E	110	140
PSM	GGEEPLPEGLFWLLVTGHIPTEEQVSWLSK	1389	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.1476.10	39.47787	4	3348.690494	3347.707795	K	E	110	140
PSM	DVPFSVVYFPLFANLNQLGR	1390	sp|Q9H936|GHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	22		ms_run[1]:scan=1.1.709.5	19.02393	3	2295.189971	2295.205189	R	P	197	217
PSM	GELSGHFEDLLLAIVNCVR	1391	sp|P12429|ANXA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	17-UNIMOD:4	ms_run[1]:scan=1.1.29.3	0.7261333	4	2141.0757	2141.0939	K	N	230	249
PSM	AEVQNLGGELVVSGVDSAMSLIQAAK	1392	sp|P35221-3|CTNA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.454.2	12.1791	4	2585.3237	2585.3371	K	N	428	454
PSM	VPFALFESFPEDFYVEGLPEGVPFR	1393	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.161.7	4.3027	4	2887.3965	2887.4109	K	R	716	741
PSM	IQTLSQLLLNLQAVIAHQDSYVETQR	1394	sp|Q6ZSZ5-1|ARHGI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.423.4	11.34338	4	2980.5801	2980.5982	R	A	804	830
PSM	EDANVFASAMMHALEVLNSQETGPTLPR	1395	sp|Q8N8S7-2|ENAH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.47.6	1.217633	4	3027.4217	3027.4430	K	Q	95	123
PSM	DAAHLVNQDDPNVLEIWNLVFIQYNR	1396	sp|P49588-2|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.327.7	8.751184	4	3095.5249	3095.5465	R	E	207	233
PSM	NNSNDIVNAIMELTM	1397	sp|E9PAV3-2|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.132.2	3.508767	3	1677.7576	1677.7702	K	-	911	926
PSM	VGLPLLSPEFLLTGVLK	1398	sp|Q14676-2|MDC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.89.2	2.345183	3	1795.0735	1795.0859	R	Q	1791	1808
PSM	AQELLLILDEYWQNHPELHDIPIYYASSLAK	1399	sp|Q9UKF6|CPSF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.281.6	7.5192	4	3681.8453	3681.8718	R	K	246	277
PSM	AMTTGAIAAMLSTILYSR	1400	sp|P20618|PSB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.151.2	4.02355	3	1869.9568	1869.9692	K	R	110	128
PSM	AFAVVASALGIPSLLPFLK	1401	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.95.3	2.508833	3	1913.1244	1913.1390	R	A	631	650
PSM	NWYIQATCATSGDGLYEGLDWLANQLK	1402	sp|P61204-2|ARF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.224.11	5.9823	3	3086.4232	3086.4444	R	N	115	142
PSM	TLLEGSGLESIISIIHSSLAEPR	1403	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.251.4	6.702683	3	2421.2983	2421.3115	R	V	2483	2506
PSM	LCYVALDFEQEMATAASSSSLEK	1404	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.431.8	11.56727	3	2549.1574	2549.1665	K	S	216	239
PSM	DQAVENILVSPVVVASSLGLVSLGGK	1405	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.422.7	11.31953	3	2550.4042	2550.4269	K	A	61	87
PSM	FFEGPVTGIFSGYVNSMLQEYAK	1406	sp|P55060-3|XPO2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.166.8	4.439417	3	2583.2203	2583.2356	K	N	396	419
PSM	ALGLGVEQLPVVFEDVVLHQATILPK	1407	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.263.9	7.030633	3	2784.5614	2784.5790	R	T	902	928
PSM	VPFALFESFPEDFYVEGLPEGVPFR	1408	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.152.11	4.065533	3	2887.3996	2887.4109	K	R	716	741
PSM	SAGDLGIAVCNVPAASVEETADSTLCHILNLYR	1409	sp|Q13363-2|CTBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.60.3	1.56425	5	3515.6841	3515.7025	K	R	98	131
PSM	GLPFGCSKEEIVQFFSGLEIVPNGITLPVDFQGR	1410	sp|P31943|HNRH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.269.5	7.18595	5	3749.8831	3749.9127	R	S	117	151
PSM	FSNLVLQALLVLLKK	1411	sp|P46459-2|NSF_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.872.2	23.3436	3	1698.0685	1698.0807	R	A	524	539
PSM	MALLQMATVEEAIQALIDLHNYNLGENHHLR	1412	sp|Q9UKA9-2|PTBP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.781.2	20.9438	6	3556.7725	3556.7918	K	V	494	525
PSM	AELATEEFLPVTPILEGFVILR	1413	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.982.3	26.30767	4	2456.3433	2456.3566	R	K	721	743
PSM	IFSAEIIYHLFDAFTK	1414	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.496.3	13.28	3	1913.9803	1913.9927	R	Y	1056	1072
PSM	VNTFSALANIDLALEQGDALALFR	1415	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.936.2	25.0679	4	2561.3309	2561.3489	K	A	303	327
PSM	DYFLFNPVTDIEEIIR	1416	sp|Q6NUK1-2|SCMC1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.487.3	13.03647	3	1982.9884	1982.9989	R	F	130	146
PSM	FTVAMSPELIQQFLQATVSGLHETQPPSVR	1417	sp|Q96P70|IPO9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.496.4	13.28167	5	3310.6816	3310.7020	R	I	505	535
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	1418	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.759.5	20.3715	4	2843.3993	2843.4164	R	N	766	791
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1419	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.610.9	16.35582	4	3585.6669	3585.6942	R	R	85	117
PSM	TGAFSIPVIQIVYETLK	1420	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.624.2	16.7192	3	1878.0385	1878.0502	K	D	53	70
PSM	VDTMIVQAISLLDDLDK	1421	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.963.2	25.79485	3	1887.9661	1887.9863	K	E	158	175
PSM	SLGNVIDPLDVIYGISLQGLHNQLLNSNLDPSEVEK	1422	sp|P26640|SYVC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.787.7	21.11965	4	3903.0017	3903.0265	K	A	866	902
PSM	FYPEDVAEELIQDITQK	1423	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.819.2	21.97213	3	2036.9845	2036.9942	K	L	84	101
PSM	DIPIWGTLIQYIRPVFVSR	1424	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.985.2	26.40185	3	2272.2568	2272.2732	R	S	159	178
PSM	LCYVALDFEQEMATAASSSSLEK	1425	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.586.7	15.70733	3	2549.1475	2549.1665	K	S	216	239
PSM	LLTAPELILDQWFQLSSSGPNSR	1426	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.640.5	17.166	3	2571.3166	2571.3333	R	L	574	597
PSM	LYGSTLNIDLFPALVVEDLVPGSR	1427	sp|Q92626|PXDN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.742.6	19.9252	3	2587.3729	2587.3898	R	L	1204	1228
PSM	TATFAISILQQIELDLK	1428	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1171.2	31.4179	3	1903.0582	1903.0666	K	A	83	100
PSM	ISDGVVLFIDAAEGVMLNTER	1429	sp|Q15029-2|U5S1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1196.3	32.09458	3	2248.1197	2248.1409	R	L	186	207
PSM	DNYVPEVSALDQEIIEVDPDTK	1430	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1514.6	40.50765	3	2488.1707	2488.1857	R	E	82	104
PSM	NLGNSCYLNSVVQVLFSIPDFQR	1431	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.1196.2	32.09125	4	2669.3113	2669.3272	R	K	330	353
PSM	ETPFELIEALLK	1432	sp|Q08211|DHX9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1420.3	37.96092	2	1401.7654	1401.7755	K	Y	631	643
PSM	IGQPSIALEYINTAIESTPTLIELFLVK	1433	sp|Q9BXJ9-4|NAA15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1573.4	42.13237	4	3072.6821	3072.6998	K	A	387	415
PSM	QYKDELLASCLTFLLSLPHNIIELDVR	1434	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	10-UNIMOD:4	ms_run[1]:scan=1.1.1387.4	37.11972	4	3199.6809	3199.6951	K	A	720	747
PSM	YLVTFSPLMDTQDDPQAIIIWDILTGHK	1435	sp|P55884-2|EIF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1043.7	27.96572	4	3229.6153	3229.6369	R	K	387	415
PSM	SGDAPLTVNELGTAYVSATTGAVATALGLNALTK	1436	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1138.2	30.52548	4	3246.6761	3246.6983	R	H	137	171
PSM	EGISQEALHTQMLTAVQEISHLIEPLANAAR	1437	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1157.3	31.04095	4	3369.7145	3369.7350	R	A	1691	1722
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	1438	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	27-UNIMOD:4	ms_run[1]:scan=1.1.1047.9	28.07718	4	3436.6737	3436.6973	R	R	85	117
PSM	LQPSIIFIDEIDSFLR	1439	sp|Q8NBU5-2|ATAD1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1089.4	29.20338	3	1905.0178	1905.0248	K	N	184	200
PSM	DQEGQDVLLFIDNIFR	1440	sp|P06576|ATPB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1510.2	40.39155	3	1920.9451	1920.9581	R	F	295	311
PSM	NSFAYQPLLDLVVQLAR	1441	sp|O75691|UTP20_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1229.2	32.97972	3	1946.0485	1946.0625	K	D	100	117
PSM	GHYTEGAELVDSVLDVVR	1442	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1494.3	39.95617	3	1957.9639	1957.9745	K	K	104	122
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	1443	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1328.2	35.5743	5	3503.9166	3503.9392	K	S	754	787
PSM	DYVLDCNILPPLLQLFSK	1444	sp|P52294|IMA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.1214.4	32.58335	3	2147.1181	2147.1337	R	Q	205	223
PSM	ELEAVCQDVLSLLDNYLIK	1445	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	6-UNIMOD:4	ms_run[1]:scan=1.1.1532.5	40.9987	3	2234.1376	2234.1504	K	N	92	111
PSM	LCYVALDFEQEMATAASSSSLEK	1446	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	2-UNIMOD:4	ms_run[1]:scan=1.1.1501.9	40.15752	3	2549.1487	2549.1665	K	S	216	239
PSM	GVDLDQLLDMSYEQLMQLYSAR	1447	sp|P62841|RS15_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1577.8	42.2473	3	2587.2145	2587.2298	R	Q	19	41
PSM	FQALCNLYGAITIAQAMIFCHTR	1448	sp|Q9NUU7-2|DD19A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	5-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.1158.4	31.078	3	2698.3021	2698.3182	K	K	230	253
PSM	IPQVTTHWLEILQALLLSSNQELQHR	1449	sp|Q9H3U1-2|UN45A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1040.2	27.87802	5	3066.6386	3066.6614	R	G	841	867
PSM	YLVTFSPLMDTQDDPQAIIIWDILTGHK	1450	sp|P55884-2|EIF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1044.6	27.99935	3	3229.6132	3229.6369	R	K	387	415
PSM	SGDAPLTVNELGTAYVSATTGAVATALGLNALTK	1451	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1094.11	29.35008	3	3246.6772	3246.6983	R	H	137	171
PSM	LQSVQALTEIQEFISFISK	1452	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1558.11	41.73245	2	2180.1560	2180.1729	K	Q	3129	3148
PSM	VYELLGLLGEVHPSEMINNAENLFR	1453	sp|P78527|PRKDC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.146.4	3.8911	4	2856.4297	2856.4480	K	A	174	199
PSM	TSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLK	1454	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.987.6	26.45253	5	4845.5601	4845.5857	R	R	729	773
PSM	NLDIERPTYTNLNRLIGQIVSSITASLR	1455	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1562.9	41.84057	4	3156.7013	3156.7255	R	F	181	209
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1456	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.197.4	5.253533	5	3601.6606	3601.6891	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1457	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.174.6	4.653017	4	3601.6625	3601.6891	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1458	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.213.9	5.68425	4	3601.6649	3601.6891	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1459	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.216.8	5.762733	4	3601.6649	3601.6891	R	R	85	117
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	1460	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.359.11	9.621966	3	2908.4134	2908.4310	K	N	101	130
PSM	FGAQLAHIQALISGIEAQLGDVR	1461	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.267.6	7.133584	3	2406.2869	2406.3019	R	A	331	354
PSM	SLEGDLEDLKDQIAQLEASLAAAK	1462	sp|P20700|LMNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.891.7	23.863	3	2527.2838	2527.3017	K	K	158	182
PSM	VDIVAINDPFIDLNYMVYMFQYDSTHGK	1463	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1563.11	41.87155	3	3307.5433	3307.5570	K	F	28	56
PSM	NTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGK	1464	sp|Q09028-2|RBBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.790.8	21.20088	4	3824.9005	3824.9236	K	D	26	59
PSM	PNSGELDPLYVVEVLLR	1465	sp|P42285|MTREX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.1103.3	29.57902	3	1912.0180	1912.0306	K	C	685	702
PSM	WNVLGLQGALLTHFLQPIYLK	1466	sp|P55265-2|DSRAD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21		ms_run[1]:scan=1.1.445.3	11.93995	3	2423.3578	2423.3729	R	S	1017	1038
PSM	IVLGGFSQGGALSLYTALTCPHPLAGIVALSCWLPLHR	1467	sp|O95372|LYPA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	20-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=1.1.1300.5	34.83422	4	4045.1229	4045.1434	R	A	116	154
PSM	VSSDFLDLIQSLLCGQK	1468	sp|O14578-2|CTRO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	21	14-UNIMOD:4	ms_run[1]:scan=1.1.1355.2	36.27768	3	1921.9630	1921.9819	K	E	330	347
PSM	IQPGSQQADFLDALIVSMDVIQHETIGKK	1469	sp|P13010|XRCC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.335.6	8.967134	4	3181.624894	3180.648900	K	F	98	127
PSM	CLELFSELAEDK	1470	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.572.3	15.3215	2	1435.6458	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1471	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1307.3	35.01299	2	1435.6446	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1472	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1191.4	31.95782	2	1435.6446	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1473	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.944.3	25.285	2	1435.6446	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1474	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.868.4	23.24463	2	1435.6432	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1475	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1020.2	27.33632	2	1435.6450	1435.6536	K	E	412	424
PSM	CGAIAEQTPILLLFLLR	1476	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	1-UNIMOD:4	ms_run[1]:scan=1.1.1072.2	28.74032	3	1928.085671	1927.096491	R	N	1277	1294
PSM	GYTNWAIGLSVADLIESMLK	1477	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.1564.3	41.88563	3	2181.129371	2180.118742	K	N	247	267
PSM	QDLVISLLPYVLHPLVAK	1478	sp|Q9UDR5|AASS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.1410.2	37.75347	3	2000.1562	2000.1702	K	A	547	565
PSM	CLELFTELAEDK	1479	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1389.2	37.17567	2	1449.6601	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1480	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1378.4	36.87642	2	1449.6623	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1481	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1476.6	39.4712	2	1449.6615	1449.6692	K	E	420	432
PSM	QQDAQEFFLHLINMVER	1482	sp|P45974|UBP5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.1344.2	35.97768	3	2099.9942	2100.0092	R	N	433	450
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	1483	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	11-UNIMOD:4	ms_run[1]:scan=1.1.1556.3	41.6627	4	2910.4162	2908.4302	K	N	101	130
PSM	QPELPEVIAMLGFR	1484	sp|O60716|CTND1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.1098.3	29.44777	2	1581.8147	1581.8220	R	L	365	379
PSM	ASVSELACIYSALILHDDEVTVTEDK	1485	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1021.4	27.37165	3	2919.3812	2919.4052	M	I	2	28
PSM	QLTEMLPSILNQLGADSLTSLRR	1486	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.1088.7	29.18798	3	2538.3282	2538.3472	K	L	142	165
PSM	VNPTVFFDIAVDGEPLGR	1487	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.575.4	15.40627	3	1986.9942	1987.0042	M	V	2	20
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1488	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1375.5	36.8054	4	3529.673694	3528.690508	R	R	85	117
PSM	TQFLPPNLLALFAPR	1489	sp|P08621|RU17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.1585.4	42.46362	2	1738.9675	1738.9765	M	D	2	17
PSM	FYPEDVAEELIQDITQK	1490	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.301.4	8.045584	3	2038.992671	2036.994253	K	L	84	101
PSM	LGLALNFSVFYYEILNSPEK	1491	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.85.10	2.250867	3	2317.182671	2316.204186	R	A	170	190
PSM	DVTEALILQLFSQIGPCK	1492	sp|P31483|TIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	17-UNIMOD:4	ms_run[1]:scan=1.1.875.3	23.4257	3	2032.052771	2031.071064	R	N	17	35
PSM	ANYLASPPLVIAYAIAGTIR	1493	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.314.2	8.392217	3	2075.152271	2073.162262	R	I	548	568
PSM	SDPAVNAQLDGIISDFEALK	1494	sp|Q9UHD8-5|SEPT9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:1	ms_run[1]:scan=1.1.309.3	8.2594	3	2144.0472	2144.0632	M	R	2	22
PSM	QLSAFGEYVAEILPK	1495	sp|O75489|NDUS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:28	ms_run[1]:scan=1.1.165.7	4.4106	2	1646.8456	1646.8551	K	Y	57	72
PSM	ALDLFSDNAPPPELLEIINEDIAK	1496	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.445.4	11.94495	3	2637.345371	2636.358515	R	R	265	289
PSM	CFLAQPVTLLDIYTHWQQTSELGR	1497	sp|Q13428|TCOF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1480.11	39.58807	3	2858.3852	2858.4052	K	K	38	62
PSM	NWYIQATCATSGDGLYEGLDWLANQLK	1498	sp|P61204|ARF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21	8-UNIMOD:4	ms_run[1]:scan=1.1.214.8	5.709333	4	3087.434094	3086.444387	R	N	152	179
PSM	TATFAISILQQIELDLK	1499	sp|P60842|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.773.2	20.72547	3	1904.062871	1903.066630	K	A	83	100
PSM	CLAAALIVLTESGR	1500	sp|P14618-2|KPYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	21	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.916.4	24.53673	2	1455.7612	1455.7752	K	S	423	437
PSM	NTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGK	1501	sp|Q16576|RBBP7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	21		ms_run[1]:scan=1.1.636.7	17.0544	5	3836.949618	3837.980405	K	D	26	59
PSM	SLADELALVDVLEDK	1502	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.102.5	2.70785	2	1628.8446	1628.8509	K	L	44	59
PSM	DGIEFAFKEPNPQGESHPPLNLAFLDILSEFSSK	1503	sp|Q8N3U4|STAG2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20		ms_run[1]:scan=1.1.12.10	0.28345	4	3772.8176941913202	3772.862456895029	K	L	976	1010
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1504	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.233.2	6.208667	6	3585.6751	3585.6942	R	R	85	117
PSM	AGNYEEALQLYQHAVQYFLHVVK	1505	sp|O75351|VPS4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.198.3	5.278017	4	2719.3553	2719.3758	K	Y	24	47
PSM	GEGTGVLGSLSLPLSELLVADQLCLDR	1506	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	24-UNIMOD:4	ms_run[1]:scan=1.1.142.4	3.7828	4	2811.4477	2811.4688	R	W	877	904
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	1507	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	4-UNIMOD:4	ms_run[1]:scan=1.1.122.5	3.24255	4	2830.4009	2830.4211	K	E	173	198
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	1508	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.386.3	10.33878	4	2908.4109	2908.4310	K	N	101	130
PSM	GMTLVTPLQLLLFASK	1509	sp|Q08211|DHX9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:35	ms_run[1]:scan=1.1.377.2	10.09403	3	1746.9799	1746.9954	K	K	1058	1074
PSM	AMTTGAIAAMLSTILYSR	1510	sp|P20618|PSB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.184.7	4.923967	2	1869.9596	1869.9692	K	R	110	128
PSM	NLATAYDNFVELVANLK	1511	sp|Q8WUM4-2|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.239.2	6.3718	3	1893.9703	1893.9836	K	E	660	677
PSM	FSSVQLLGDLLFHISGVTGK	1512	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.352.2	9.419717	3	2117.1388	2117.1521	R	M	1833	1853
PSM	SISTSLPVLDLIDAIAPNAVR	1513	sp|Q14651|PLSI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.370.3	9.906167	3	2164.1950	2164.2103	K	Q	546	567
PSM	YFILPDSLPLDTLLVDVEPK	1514	sp|P62314|SMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.227.3	6.049267	3	2286.2230	2286.2399	R	V	67	87
PSM	PNSEPASLLELFNSIATQGELVR	1515	sp|P23381|SYWC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.119.7	3.16455	3	2484.2611	2484.2860	M	S	2	25
PSM	ALDLFSDNAPPPELLEIINEDIAK	1516	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.338.8	9.05145	3	2636.3605	2636.3585	R	R	317	341
PSM	FDPTQFQDCIIQGLTETGTDLEAVAK	1517	sp|Q7L1Q6-2|BZW1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	9-UNIMOD:4	ms_run[1]:scan=1.1.426.6	11.43152	3	2896.3660	2896.3801	R	F	27	53
PSM	DQAVENILVSPVVVASSLGLVSLGGK	1518	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.482.8	12.90948	3	2550.4066	2550.4269	K	A	61	87
PSM	ALDLFSDNAPPPELLEIINEDIAK	1519	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.493.3	13.2021	3	2636.3266	2636.3585	R	R	317	341
PSM	EDNTLLYEITAYLEAAGIHNPLNK	1520	sp|Q12768|WASC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.831.3	22.29125	4	2701.3437	2701.3598	K	I	1005	1029
PSM	FYPEDVAEELIQDITQK	1521	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.938.5	25.12713	3	2036.9827	2036.9942	K	L	84	101
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	1522	sp|P56545-2|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.477.6	12.7708	5	3527.7146	3527.7388	K	R	655	688
PSM	GRQEDAEEYLGFILNGLHEEMLNLK	1523	sp|Q14694-2|UBP10_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.517.3	13.85237	4	2917.4093	2917.4279	K	K	567	592
PSM	NLFDNLIEFLQK	1524	sp|Q9UBD5-2|ORC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.654.4	17.53378	3	1492.7833	1492.7926	K	S	68	80
PSM	NLFDNLIEFLQK	1525	sp|Q9UBD5-2|ORC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.635.2	17.01567	3	1492.7833	1492.7926	K	S	68	80
PSM	QLCETSTPLHPQLLPLIDVYINSILTPASK	1526	sp|Q9H0H0|INT2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	3-UNIMOD:4	ms_run[1]:scan=1.1.752.6	20.19158	4	3360.7813	3360.8003	R	S	580	610
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1527	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	27-UNIMOD:4	ms_run[1]:scan=1.1.615.10	16.49152	4	3512.6713	3512.6956	R	R	85	117
PSM	TATFAISILQQIELDLK	1528	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.792.2	21.23995	3	1903.0489	1903.0666	K	A	83	100
PSM	GPGTSFEFALAIVEALNGK	1529	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.802.10	21.5243	2	1919.9840	1919.9993	R	E	157	176
PSM	LGDPAEYAHLVQAIIENPFLNGEVIR	1530	sp|Q99714-2|HCD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.613.10	16.43788	3	2877.4789	2877.5025	R	L	218	244
PSM	CAILTTLIHLVQGLGADSK	1531	sp|Q9UI26-2|IPO11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	1-UNIMOD:4	ms_run[1]:scan=1.1.658.3	17.6404	3	2009.0845	2009.0979	R	N	661	680
PSM	FYPEDVAEELIQDITQK	1532	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.881.4	23.58872	3	2036.9809	2036.9942	K	L	84	101
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	1533	sp|P56545-2|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.499.3	13.36123	5	3527.7201	3527.7388	K	R	655	688
PSM	VDQGTLFELILAANYLDIK	1534	sp|P63208-2|SKP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.565.4	15.1309	3	2135.1373	2135.1514	K	G	95	114
PSM	QLNHFWEIVVQDGITLITK	1535	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.809.3	21.70198	3	2253.1951	2253.2158	K	E	670	689
PSM	SIADCVEALLGCYLTSCGER	1536	sp|Q9UPY3-2|DICER_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4,12-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.592.7	15.8662	3	2273.0002	2273.0126	K	A	1558	1578
PSM	IMSLVDPNHSGLVTFQAFIDFMSR	1537	sp|O43707-2|ACTN4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.700.9	18.78758	3	2724.3229	2724.3404	R	E	595	619
PSM	LQADDFLQDYTLLINILHSEDLGK	1538	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.792.8	21.25495	3	2773.3984	2773.4174	R	D	421	445
PSM	LQADDFLQDYTLLINILHSEDLGK	1539	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.853.7	22.84737	3	2773.3996	2773.4174	R	D	421	445
PSM	QNIQSHLGEALIQDLINYCLSYIAK	1540	sp|O15305-2|PMM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	19-UNIMOD:4	ms_run[1]:scan=1.1.489.5	13.10387	3	2903.4673	2903.4851	R	I	85	110
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	1541	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.864.11	23.14433	3	2934.4669	2934.4862	R	D	133	163
PSM	LTPGCEAEAETEAICFFVQQFTDMEHNR	1542	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	5-UNIMOD:4,15-UNIMOD:4	ms_run[1]:scan=1.1.696.3	18.66948	5	3329.4181	3329.4427	K	V	2355	2383
PSM	GSGLLGSQPQPVIPASVIPEELISQAQVVLQGK	1543	sp|O95071-2|UBR5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.865.5	23.16093	4	3338.8213	3338.8450	R	S	168	201
PSM	DTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLK	1544	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.618.10	16.57177	4	3869.8941	3869.9224	K	N	430	467
PSM	LCYVALDFEQEMATAASSSSLEK	1545	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.1525.2	40.80187	4	2549.1640941913206	2549.1665567026694	K	S	216	239
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	1546	sp|Q9NTI5|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20		ms_run[1]:scan=1.1.1295.3	34.6865	5	3503.92161773915	3503.9391910941	K	S	754	787
PSM	ALVLDCHYPEDEVGQEDEAESDIFSIR	1547	sp|Q07021|C1QBP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.1528.5	40.88903	4	3135.3860941913204	3135.3978895183295	K	E	181	208
PSM	VSDTVVEPYNATLSVHQLVENTDETYCIDNEALYDICFR	1548	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	20	27-UNIMOD:4,37-UNIMOD:4	ms_run[1]:scan=1.1.1460.10	39.04342	5	4592.08461773915	4592.09994047276	K	T	175	214
PSM	ELEAVCQDVLSLLDNYLIK	1549	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.1485.2	39.70937	4	2234.1373	2234.1504	K	N	92	111
PSM	IGIASQALGIAQTALDCAVNYAENR	1550	sp|P16219|ACADS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	17-UNIMOD:4	ms_run[1]:scan=1.1.1494.4	39.95783	4	2618.2997	2618.3122	R	M	273	298
PSM	KYSVWIGGSILASLSTFQQMWISK	1551	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1473.2	39.38303	4	2729.3997	2729.4251	R	Q	336	360
PSM	MFQNFPTELLLSLAVEPLTANFHK	1552	sp|Q92820|GGH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1375.4	36.8004	4	2759.4161	2759.4356	R	W	173	197
PSM	DQQEAALVDMVNDGVEDLR	1553	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1416.2	37.86958	3	2115.9601	2115.9743	K	C	83	102
PSM	SVFQTINQFLDLTLFTHR	1554	sp|P53985-2|MOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1170.3	31.39258	3	2179.1287	2179.1426	R	G	244	262
PSM	ISWFGSPTTSFLALSQLSPFLENFQSR	1555	sp|Q96N64|PWP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1314.2	35.19825	4	3059.5237	3059.5393	R	F	693	720
PSM	SGDAPLTVNELGTAYVSATTGAVATALGLNALTK	1556	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1107.3	29.687	4	3246.6761	3246.6983	R	H	137	171
PSM	SLADELALVDVLEDK	1557	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1527.2	40.85668	3	1628.8384	1628.8509	K	L	44	59
PSM	EGISQEALHTQMLTAVQEISHLIEPLANAAR	1558	sp|Q9Y490|TLN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1148.6	30.80438	4	3369.7145	3369.7350	R	A	1691	1722
PSM	GAALLSWVNSLHVADPVEAVLQLQDCSIFIK	1559	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	26-UNIMOD:4	ms_run[1]:scan=1.1.1112.8	29.83007	4	3392.7593	3392.7802	R	I	8	39
PSM	FLNTTFSFFPPFVSCIQDISCQHAALLSLDPAAVSAGCLASLQQPVGIR	1560	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	15-UNIMOD:4,21-UNIMOD:4,38-UNIMOD:4	ms_run[1]:scan=1.1.1386.3	37.10272	6	5350.6231	5350.6618	R	L	2843	2892
PSM	HDSEQDNSDNNTIFVQGLGENVTIESVADYFK	1561	sp|P35637-2|FUS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1504.9	40.23932	4	3584.6165	3584.6179	R	Q	274	306
PSM	LGLVFDDVVGIVEIINSK	1562	sp|Q01518|CAP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1307.2	35.00965	3	1929.0724	1929.0823	K	D	378	396
PSM	YAGLQPYLDQINVIEEQVAALEQAAYK	1563	sp|Q6QNY1-2|BL1S2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1290.3	34.56575	3	3036.5242	3036.5444	K	L	55	82
PSM	GALDNLLSQLIAELGMDKK	1564	sp|Q5T4S7-2|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1521.4	40.69588	3	2028.0754	2028.0925	K	D	3019	3038
PSM	YLASGAIDGIINIFDIATGK	1565	sp|Q9GZS3|WDR61_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1107.2	29.68533	3	2051.0788	2051.0939	K	L	162	182
PSM	QLDLLCDIPLVGFINSLK	1566	sp|O43818|U3IP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.1514.3	40.50265	3	2057.1118	2057.1231	R	F	411	429
PSM	DQQEAALVDMVNDGVEDLR	1567	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1007.4	26.98745	3	2115.9556	2115.9743	K	C	83	102
PSM	ELEAVCQDVLSLLDNYLIK	1568	sp|P61981|1433G_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	6-UNIMOD:4	ms_run[1]:scan=1.1.1468.11	39.26193	2	2234.1374	2234.1504	K	N	92	111
PSM	ILVQQTLNILQQLAVAMGPNIK	1569	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1049.4	28.12448	3	2404.3666	2404.3876	K	Q	915	937
PSM	EITAIESSVPCQLLESVLQELK	1570	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.1461.9	39.06758	3	2485.2820	2485.2985	R	G	635	657
PSM	YAGLQPYLDQINVIEEQVAALEQAAYK	1571	sp|Q6QNY1-2|BL1S2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1267.5	33.98523	3	3036.5242	3036.5444	K	L	55	82
PSM	ISWFGSPTTSFLALSQLSPFLENFQSR	1572	sp|Q96N64|PWP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1321.6	35.40022	3	3059.5192	3059.5393	R	F	693	720
PSM	FCDAFNIPLITFVDVPGFLPGTAQEYGGIIR	1573	sp|P05166-2|PCCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.1298.8	34.78045	3	3426.7072	3426.7323	R	H	400	431
PSM	WSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKR	1574	sp|P49459-2|UBE2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1210.7	32.4783	5	4461.1491	4461.1724	R	E	66	106
PSM	MTQIMFETFNTPAMYVAIQAVLSLYASGR	1575	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1560.4	41.7766	4	3252.5953	3252.6021	K	T	119	148
PSM	MTQIMFETFNVPAMYVAIQAVLSLYASGR	1576	sp|P62736|ACTA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1560.4	41.7766	4	3250.6457	3250.6229	K	T	121	150
PSM	SDSVTDSGPTFNYLLDMPLWYLTK	1577	sp|P11388-2|TOP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.471.5	12.6067	4	2762.2961	2762.3149	K	E	1141	1165
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1578	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.177.4	4.730484	5	3601.6586	3601.6891	R	R	85	117
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	1579	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.317.4	8.478217	5	3536.8571	3536.8813	K	A	311	345
PSM	PLTPLQEEMASLLQQIEIER	1580	sp|Q9H2W6|RM46_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.137.7	3.652517	3	2337.2074	2337.2249	K	S	62	82
PSM	EQNGDSLVHAAFVAESAVAGSAEANAFSVLQHVLGAGPHVK	1581	sp|P22695|QCR2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1556.5	41.66603	5	4084.0126	4084.0403	R	R	260	301
PSM	ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK	1582	sp|Q9H299|SH3L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20	13-UNIMOD:4	ms_run[1]:scan=1.1.783.5	21.00798	4	3814.7765	3814.8036	K	L	59	92
PSM	SGPPGEEAQVASQFIADVIENSQIIQK	1583	sp|Q96B26|EXOS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.150.4	3.9998	4	2854.4141	2854.4348	R	E	95	122
PSM	VIAGFSLLNLLFK	1584	sp|Q9HCJ6|VAT1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.483.3	12.9281	2	1433.8568	1433.8646	K	Q	312	325
PSM	NIGLTELVQIIINTTHLEK	1585	sp|Q9Y2D4-2|EXC6B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	20		ms_run[1]:scan=1.1.1111.4	29.79638	3	2148.1969	2148.2154	K	S	550	569
PSM	DDDIAALVVDNGSGMCK	1586	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.1498.8	40.07382	2	1820.7782	1820.7912	M	A	2	19
PSM	YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR	1587	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1345.4	36.014	5	4099.986618	4099.014953	K	K	337	373
PSM	CLEIYDMIGQAISSSR	1588	sp|Q5T4S7|UBR4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1079.6	28.93798	2	1824.8242	1824.8382	K	R	381	397
PSM	QLDSYKNGFLNLALPFFGFSEPLAAPR	1589	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.32.9	0.8206334	3	3012.518171	3011.554529	R	H	918	945
PSM	CLELFSELAEDK	1590	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.906.5	24.26375	2	1435.6468	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1591	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1096.3	29.39043	2	1435.6422	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1592	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1058.3	28.36417	2	1436.6422	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1593	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.789.4	21.16192	2	1436.6492	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1594	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.659.3	17.66762	2	1435.6452	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1595	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1326.4	35.52548	2	1435.6412	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1596	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1229.3	32.98138	2	1435.6440	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1597	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.982.5	26.311	2	1436.6472	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1598	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1077.2	28.8756	2	1435.6442	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1599	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.925.3	24.77255	2	1435.6440	1435.6536	K	E	412	424
PSM	VVAFGQWAGVAGMINILHGMGLR	1600	sp|Q9UDR5|AASS_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.492.8	13.18	3	2397.253871	2396.260947	R	L	147	170
PSM	CLQILAAGLFLPGSVGITDPCESGNFR	1601	sp|Q12905|ILF2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.1581.7	42.35258	3	2874.3902	2874.4042	R	V	271	298
PSM	CLELFTELAEDK	1602	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.865.4	23.15927	2	1450.6602	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1603	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.747.4	20.05357	2	1450.6642	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1604	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.845.5	22.6365	2	1449.6592	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1605	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1330.5	35.63323	2	1449.6605	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1606	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.806.2	21.62065	2	1450.6632	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1607	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1358.5	36.36658	2	1450.6582	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1608	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.787.2	21.10465	2	1449.6593	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1609	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.671.4	17.99472	2	1449.6593	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1610	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.766.3	20.56028	2	1450.6622	1449.6692	K	E	420	432
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1611	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.1127.5	30.23653	4	3586.675694	3585.694213	R	R	85	117
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	1612	sp|P56545|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.495.11	13.26623	3	3528.716171	3527.738855	K	R	115	148
PSM	DMDLTEVITGTLWNLSSHDSIK	1613	sp|O60716|CTND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.494.4	13.22733	3	2475.181271	2474.199906	R	M	465	487
PSM	ASVSELACIYSALILHDDEVTVTEDK	1614	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1292.7	34.61934	3	2919.3862	2919.4052	M	I	2	28
PSM	ASVSELACIYSALILHDDEVTVTEDK	1615	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1100.8	29.50822	3	2920.3842	2919.4052	M	I	2	28
PSM	VNPTVFFDIAVDGEPLGR	1616	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.418.2	11.20267	3	1986.9932	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	1617	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.244.5	6.517017	3	1986.9956	1987.0046	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	1618	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.730.3	19.5938	3	1986.9953	1987.0046	M	V	2	20
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1619	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1403.7	37.55642	4	3529.678494	3528.690508	R	R	85	117
PSM	SDPAVNAQLDGIISDFEALK	1620	sp|Q9UHD8-5|SEPT9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:1	ms_run[1]:scan=1.1.304.5	8.127983	3	2144.0472	2144.0632	M	R	2	22
PSM	TLMVDPSQEVQENYNFLLQLQEELLK	1621	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1423.4	38.04332	4	3121.550094	3120.568918	R	E	289	315
PSM	QVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSK	1622	sp|P30049|ATPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	20	1-UNIMOD:28	ms_run[1]:scan=1.1.351.11	9.405933	4	4089.2032	4089.2262	R	Y	57	97
PSM	GTASFPQTIYCGFDPTADSLHVGHLLALLGLFHLQR	1623	sp|Q9Y2Z4|SYYM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.688.7	18.46007	5	3952.982118	3952.009414	R	A	68	104
PSM	HIQDAPEEFISELAEYLIK	1624	sp|O94874|UFL1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1310.3	35.09398	3	2245.117571	2244.131415	K	P	489	508
PSM	ALDLFSDNAPPPELLEIINEDIAK	1625	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.90.10	2.3857	3	2638.347671	2636.358515	R	R	265	289
PSM	PLTPLQEEMASLLQQIEIER	1626	sp|Q9H2W6|RM46_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.151.7	4.031883	3	2336.207771	2337.224998	K	S	62	82
PSM	VPFALFESFPEDFYVEGLPEGVPFR	1627	sp|P78347|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.231.8	6.16975	3	2888.412671	2887.410885	K	R	757	782
PSM	LLAVEACVNIAQLLPQEDLEALVMPTLR	1628	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	7-UNIMOD:4	ms_run[1]:scan=1.1.283.2	7.557683	4	3117.653694	3118.677029	R	Q	222	250
PSM	SREEAAAGTIPGALNIPVSELESALQMEPAAFQALYSAEK	1629	sp|Q8NFU3|TSTD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.285.9	7.6263	4	4158.030894	4159.078341	R	P	28	68
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	1630	sp|P68104|EF1A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	11-UNIMOD:4	ms_run[1]:scan=1.1.712.8	19.11463	3	2907.483371	2908.431045	K	N	101	130
PSM	LCYVALDFEQEMATAASSSSLEK	1631	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	2-UNIMOD:4	ms_run[1]:scan=1.1.814.5	21.84373	3	2550.160571	2549.166557	K	S	216	239
PSM	ALQSNIIPFCDEVMQLLLENLGNENVHR	1632	sp|Q14974|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	10-UNIMOD:4,14-UNIMOD:35	ms_run[1]:scan=1.1.946.9	25.34918	4	3280.585294	3281.617283	R	S	680	708
PSM	GHYTEGAELVDSVLDVVR	1633	sp|Q13885|TBB2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20		ms_run[1]:scan=1.1.1156.2	31.01547	3	1958.957771	1957.974521	K	K	104	122
PSM	YSVWIGGSILASLSTFQQMWISKQEYDESGPSIVHR	1634	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	20	19-UNIMOD:35	ms_run[1]:scan=1.1.1351.3	36.16868	5	4113.978618	4115.009868	K	K	337	373
PSM	DPPLAAVTTAVQELLR	1635	sp|Q15477|SKIV2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.71.2	1.859633	3	1692.9328	1692.9410	K	L	955	971
PSM	LLESSPEPLSFIVFIPEWR	1636	sp|Q9H4Z3|PCIF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.13.4	0.2995667	3	2258.1958	2258.1987	R	E	571	590
PSM	LGLALNFSVFYYEILNSPEK	1637	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.104.7	2.7585	3	2316.1864	2316.2041	R	A	93	113
PSM	LGLALNFSVFYYEILNSPEK	1638	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.8.7	0.174	3	2316.2020	2316.2041	R	A	93	113
PSM	DYPVVSIEDPFDQDDWGAWQK	1639	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.262.3	7.00025	3	2509.1092	2509.1074	K	F	193	214
PSM	FIEAEQVPELEAVLHLVIASSDTR	1640	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	19		ms_run[1]:scan=1.1.106.6	2.811017	4	2665.3772941913203	2665.3962964642797	K	H	250	274
PSM	ALAAQLPVLPWSEVTFLAPVTWPDK	1641	sp|Q6P2I3|FAH2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.53.3	1.374717	4	2748.4761	2748.4891	R	V	83	108
PSM	LLDGEAALPAVVFLHGLFGSK	1642	sp|Q8NFV4-2|ABHDB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.374.6	10.01933	3	2153.1754	2153.1885	R	T	59	80
PSM	LGLALNFSVFYYEIQNAPEQACLLAK	1643	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	22-UNIMOD:4	ms_run[1]:scan=1.1.111.5	2.9446	4	2971.4977	2971.5153	R	Q	173	199
PSM	VQALTTDISLIFAALK	1644	sp|Q6PKG0-3|LARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.40.2	1.02205	3	1702.9747	1702.9869	R	D	370	386
PSM	VNDVVPWVLDVILNK	1645	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.58.2	1.5087	3	1721.9602	1721.9716	K	H	935	950
PSM	AFAVVASALGIPSLLPFLK	1646	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.74.3	1.94225	3	1913.1244	1913.1390	R	A	631	650
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	1647	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.105.6	2.79215	4	4320.1537	4320.1835	K	A	198	238
PSM	SISTSLPVLDLIDAIAPNAVR	1648	sp|Q14651|PLSI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.389.2	10.41838	3	2164.1947	2164.2103	K	Q	546	567
PSM	TGDAISVMSEVAQTLLTQDVR	1649	sp|Q99943|PLCA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.159.5	4.245	3	2233.1125	2233.1260	R	V	152	173
PSM	GSGTQLFDHIAECLANFMDK	1650	sp|P52789|HXK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	13-UNIMOD:4	ms_run[1]:scan=1.1.23.4	0.5731667	3	2253.0037	2253.0194	R	L	121	141
PSM	YSEPDLAVDFDNFVCCLVR	1651	sp|P07384|CAN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	15-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.183.3	4.8879	3	2318.0185	2318.0348	R	L	663	682
PSM	QYDADLEQILIQWITTQCR	1652	sp|P37802-2|TAGL2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	18-UNIMOD:4	ms_run[1]:scan=1.1.418.7	11.21433	3	2393.1556	2393.1685	K	K	42	61
PSM	ASLDRPFTNLESAFYSIVGLSSLGAQVPDAK	1653	sp|P04844-2|RPN2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.301.8	8.05225	4	3252.6473	3252.6666	K	K	39	70
PSM	DQAVENILVSPVVVASSLGLVSLGGK	1654	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.334.9	8.94355	3	2550.4102	2550.4269	K	A	61	87
PSM	MGSENLNEQLEEFLANIGTSVQNVR	1655	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.98.7	2.603267	3	2791.3282	2791.3446	K	R	213	238
PSM	GEGTGVLGSLSLPLSELLVADQLCLDR	1656	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	24-UNIMOD:4	ms_run[1]:scan=1.1.115.11	3.062783	3	2811.4501	2811.4688	R	W	877	904
PSM	VPFALFESFPEDFYVEGLPEGVPFR	1657	sp|P78347-2|GTF2I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.132.11	3.523767	3	2887.3975	2887.4109	K	R	716	741
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1658	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.317.5	8.48155	5	3585.6731	3585.6942	R	R	85	117
PSM	DQQEAALVDMVNDGVEDLR	1659	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.811.2	21.75605	3	2115.9619	2115.9743	K	C	83	102
PSM	CAILTTLIHLVQGLGADSK	1660	sp|Q9UI26|IPO11_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	19	1-UNIMOD:4	ms_run[1]:scan=1.1.665.2	17.8302	4	2009.08849419132	2009.0979469973902	R	N	621	640
PSM	IQFNDLQSLLCATLQNVLRK	1661	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	11-UNIMOD:4	ms_run[1]:scan=1.1.892.2	23.88147	4	2373.2689	2373.2838	R	V	430	450
PSM	FYPEDVAEELIQDITQK	1662	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.759.3	20.36817	3	2036.9818	2036.9942	K	L	84	101
PSM	VPTWSDFPSWAMELLVEK	1663	sp|Q96KR1|ZFR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.608.4	16.29397	3	2134.0282	2134.0445	R	A	936	954
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1664	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.769.3	20.64148	5	3585.6701	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1665	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.541.2	14.47778	5	3585.6681	3585.6942	R	R	85	117
PSM	ASFEEASNQLINHIEQFLDTNETPYFMK	1666	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	27-UNIMOD:35	ms_run[1]:scan=1.1.882.8	23.62392	4	3331.5141	3331.5343	K	S	607	635
PSM	ALDLFSDNAPPPELLEIINEDIAK	1667	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.561.7	15.02778	3	2636.3404	2636.3585	R	R	317	341
PSM	LTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	1668	sp|P13797-2|PLST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	22-UNIMOD:4	ms_run[1]:scan=1.1.688.11	18.46673	4	3561.8397	3561.8613	K	A	166	199
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1669	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.941.6	25.21785	4	3585.6693	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1670	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.586.8	15.71067	4	3585.6661	3585.6942	R	R	85	117
PSM	QQAVQLNIFTAVLSALK	1671	sp|Q9P2D3-3|HTR5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.560.2	14.99245	3	1843.0459	1843.0567	R	G	819	836
PSM	GPGTSFEFALAIVEALNGK	1672	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.827.8	22.20035	2	1919.9862	1919.9993	R	E	157	176
PSM	GLPFGCSKEEIVQFFQGLEIVPNGITLTMDYQGR	1673	sp|P31942-2|HNRH3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.507.5	13.5912	4	3842.8757	3842.9012	R	S	22	56
PSM	NIVSLLLSMLGHDEDNTR	1674	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.946.3	25.33918	3	2025.9931	2026.0153	K	I	2426	2444
PSM	FYPEDVAEELIQDITQK	1675	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.976.3	26.14603	3	2036.9827	2036.9942	K	L	84	101
PSM	VALFYLLNPYTILSCVAK	1676	sp|Q9H490-2|PIGU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	15-UNIMOD:4	ms_run[1]:scan=1.1.981.3	26.2807	3	2084.1256	2084.1380	K	S	120	138
PSM	GYTSWAIGLSVADLAESIMK	1677	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.984.4	26.36328	3	2111.0476	2111.0609	K	N	275	295
PSM	DQQEAALVDMVNDGVEDLR	1678	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.612.4	16.40117	3	2115.9583	2115.9743	K	C	83	102
PSM	DQQEAALVDMVNDGVEDLR	1679	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.656.3	17.58962	3	2115.9586	2115.9743	K	C	83	102
PSM	EQSDFCPWYTGLPFIPYLDNLPNFNR	1680	sp|Q8IYD1|ERF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.559.9	14.9805	3	3202.4632	3202.4859	K	S	400	426
PSM	LFALNLGLPFATPEEFFLK	1681	sp|Q96T60-2|PNKP_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.600.6	16.0814	3	2166.1603	2166.1765	R	W	273	292
PSM	SLLDCHIIPALLQGLLSPDLK	1682	sp|Q8IUR7-2|ARMC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.570.8	15.27262	3	2315.2744	2315.2923	K	F	86	107
PSM	VGEAVQNTLGAVVTAIDIPLGLVK	1683	sp|Q9HBF4-2|ZFYV1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.737.7	19.78665	3	2376.3478	2376.3628	K	D	266	290
PSM	LCYVALDFEQEMATAASSSSLEK	1684	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	2-UNIMOD:4	ms_run[1]:scan=1.1.637.9	17.08147	3	2549.1433	2549.1665	K	S	216	239
PSM	VNTFSALANIDLALEQGDALALFR	1685	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.925.7	24.77922	3	2561.3314	2561.3489	K	A	303	327
PSM	EDNTLLYEITAYLEAAGIHNPLNK	1686	sp|Q12768|WASC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.835.3	22.3815	3	2701.3429	2701.3598	K	I	1005	1029
PSM	DDAVPNLIQLITNSVEMHAYTVQR	1687	sp|O43747-2|AP1G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.616.8	16.51503	3	2726.3431	2726.3698	R	L	438	462
PSM	TLMEDVENSFFLNVNSQVTTVCQALAK	1688	sp|P50897|PPT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	22-UNIMOD:4	ms_run[1]:scan=1.1.685.2	18.37032	4	3057.4569	3057.4787	K	D	75	102
PSM	MNEEQIAAVCLAVLQALSVLHAQGVIHR	1689	sp|O96013-2|PAK4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	10-UNIMOD:4	ms_run[1]:scan=1.1.478.2	12.7913	5	3069.6086	3069.6216	R	D	247	275
PSM	TIPGDTAWLLYDTYGFPVDLTGLIAEEK	1690	sp|P49588-2|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.676.7	18.1419	3	3097.5352	3097.5536	K	G	413	441
PSM	EQSDFCPWYTGLPFIPYLDNLPNFNR	1691	sp|Q8IYD1|ERF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4	ms_run[1]:scan=1.1.572.5	15.32817	4	3202.4793	3202.4859	K	S	400	426
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	1692	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	27-UNIMOD:4	ms_run[1]:scan=1.1.817.11	21.93128	3	3436.6732	3436.6973	R	R	85	117
PSM	FYPEDVAEELIQDITQK	1693	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1358.4	36.36158	3	2036.9662	2036.9942	K	L	84	101
PSM	AEEGGEGATVPSAAATTTEVVTEVELLLYK	1694	sp|Q6ZN55-2|ZN574_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1231.4	33.0436	3	3034.4992	3034.5234	K	C	275	305
PSM	ILVQQTLNILQQLAVAMGPNIK	1695	sp|Q14008-2|CKAP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1046.2	28.03848	4	2404.3709	2404.3876	K	Q	915	937
PSM	AGTLTVEELGATLTSLLAQAQAQAR	1696	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1211.2	32.4954	4	2512.3317	2512.3497	R	A	2477	2502
PSM	FYPEDVAEELIQDITQK	1697	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1202.2	32.25295	3	2036.9842	2036.9942	K	L	84	101
PSM	DQQEAALVDMVNDGVEDLR	1698	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1372.6	36.71628	3	2115.9580	2115.9743	K	C	83	102
PSM	VLTLSEDSPYETLHSFISNAVAPFFK	1699	sp|Q14204|DYHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1556.3	41.6627	4	2911.4465	2911.4644	R	S	137	163
PSM	LGLALNFSVFYYEILNNPELACTLAK	1700	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	22-UNIMOD:4	ms_run[1]:scan=1.1.1248.3	33.4962	4	2972.5113	2972.5357	R	T	168	194
PSM	TVPPAVTGITFLSGGQSEEEASINLNAINK	1701	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1481.8	39.6104	4	3056.5489	3056.5666	R	C	314	344
PSM	EQQEAIEHIDEVQNEIDRLNEQASEEILK	1702	sp|Q01105-2|SET_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1449.4	38.73703	4	3448.6369	3448.6593	K	V	27	56
PSM	HAFEIIHLLTGENPLQVLVNAIINSGPREDSTR	1703	sp|P46782|RS5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1566.6	41.9454	4	3652.9073	3652.9325	K	I	95	128
PSM	SNEGKLEGLTDEFEELEFLSTINVGLTSIANLPK	1704	sp|P39687|AN32A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1552.9	41.55855	4	3706.868894	3706.882919	R	L	29	63
PSM	GHYTEGAELVDSVLDVVR	1705	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1489.4	39.82163	3	1957.9624	1957.9745	K	K	104	122
PSM	GHYTEGAELVDSVLDVVR	1706	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1466.4	39.19584	3	1957.9630	1957.9745	K	K	104	122
PSM	GYTSWAIGLSVADLAESIMK	1707	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1027.3	27.52575	3	2111.0479	2111.0609	K	N	275	295
PSM	LLLLIPTDPAIQEALDQLDSLGR	1708	sp|Q9UPU5|UBP24_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1445.6	38.62458	3	2503.3777	2503.3897	K	K	1104	1127
PSM	AGTLTVEELGATLTSLLAQAQAQAR	1709	sp|P58107|EPIPL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1178.5	31.6085	3	2512.3312	2512.3497	R	A	2477	2502
PSM	ISIPMCLSLGLVGLSFCGADVGGFFK	1710	sp|Q14697-2|GANAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	6-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.1176.4	31.55958	3	2744.3587	2744.3740	K	N	650	676
PSM	KSEMESVLAQLDNYGQQELADLFVNYNVK	1711	sp|P41250|GARS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1226.2	32.90055	5	3344.6006	3344.6234	K	S	236	265
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1712	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	27-UNIMOD:4	ms_run[1]:scan=1.1.1342.3	35.94007	4	3512.6741	3512.6956	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1713	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	27-UNIMOD:4	ms_run[1]:scan=1.1.1379.7	36.91333	3	3512.6752	3512.6956	R	R	85	117
PSM	RIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVR	1714	sp|P43686-2|PRS6B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1022.2	27.39028	5	3708.9166	3708.9475	K	I	50	84
PSM	RIQSIPLVIGQFLEAVDQNTAIVGSTTGSNYYVR	1715	sp|P43686-2|PRS6B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1056.3	28.31365	5	3708.9201	3708.9475	K	I	50	84
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	1716	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.176.3	4.701833	4	2830.4021	2830.4211	K	E	173	198
PSM	LGLCEFPDNDQFSNLEALLIQIGPK	1717	sp|P43246|MSH2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	4-UNIMOD:4	ms_run[1]:scan=1.1.119.11	3.171217	3	2830.4029	2830.4211	K	E	173	198
PSM	PYTLMSMVANLLYEK	1718	sp|P49720|PSB3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.487.2	13.0348	3	1771.8778	1771.8888	K	R	84	99
PSM	FDQLFDDESDPFEVLK	1719	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.750.7	20.14105	2	1942.8878	1942.8837	R	A	17	33
PSM	DSSLFDIFTLSCNLLK	1720	sp|Q9UIA9|XPO7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	12-UNIMOD:4	ms_run[1]:scan=1.1.624.9	16.73087	2	1871.9204	1871.9339	R	Q	183	199
PSM	PNSGELDPLYVVEVLLR	1721	sp|P42285|MTREX_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.1122.3	30.09137	3	1912.0195	1912.0306	K	C	685	702
PSM	NPEDPTEVPGGFLSDLNLASLHVVDAALVDCSVALAK	1722	sp|P47897-2|SYQ_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	31-UNIMOD:4	ms_run[1]:scan=1.1.814.7	21.8504	4	3832.8929	3832.9193	K	P	689	726
PSM	SPGSGLYSNLQQYDLPYPEAIFELPFFFHNPK	1723	sp|Q9NTG7-2|SIR3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19		ms_run[1]:scan=1.1.502.7	13.4558	4	3714.7757	3714.8035	R	P	17	49
PSM	SADALPAPVPGANSIPWVLEQILCLQQQQLQQIQLTEQIR	1724	sp|Q9UJQ4-2|SALL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	19	24-UNIMOD:4	ms_run[1]:scan=1.1.1570.11	42.06282	4	4493.3389	4493.3740	R	I	197	237
PSM	NGFLNLALPFFGFSEPLAAPR	1725	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1384.2	37.03358	3	2278.162271	2277.194625	K	H	924	945
PSM	CLELFSELAEDK	1726	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.48.6	1.244633	2	1435.6474	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1727	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.729.3	19.56328	2	1435.6452	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1728	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.963.4	25.79818	2	1435.6412	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1729	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1482.3	39.62942	2	1435.6446	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1730	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1520.5	40.67003	2	1436.6482	1435.6532	K	E	412	424
PSM	YIPDAMNLILLLVTEKLEDVALQILLACPVSK	1731	sp|P42704|LPPRC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	28-UNIMOD:4	ms_run[1]:scan=1.1.1575.9	42.19475	4	3595.966094	3595.002052	R	E	334	366
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	1732	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.336.4	8.989133	5	3537.859618	3536.881360	K	A	311	345
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	1733	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.341.3	9.12245	5	3537.859618	3536.881360	K	A	311	345
PSM	TLEEAVNNIITFLGMQPCER	1734	sp|Q9UBF2|COPG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	18-UNIMOD:4	ms_run[1]:scan=1.1.1398.2	37.41465	3	2335.119671	2334.134803	K	S	793	813
PSM	CLELFTELAEDK	1735	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.961.4	25.74425	2	1449.6572	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1736	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1133.3	30.38845	2	1449.6582	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1737	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.632.3	16.93603	2	1449.6572	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1738	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.904.2	24.20488	2	1449.6639	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1739	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.536.4	14.3476	2	1449.6637	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1740	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.496.6	13.285	2	1449.6647	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1741	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1038.4	27.82537	2	1449.6599	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1742	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.594.4	15.92028	2	1449.6613	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1743	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1114.3	29.87557	2	1449.6703	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1744	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1529.5	40.91668	2	1449.6629	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1745	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1019.3	27.30915	2	1449.6617	1449.6692	K	E	420	432
PSM	LLTAPELILDQWFQLSSSGPNSR	1746	sp|Q9BSJ8|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.678.5	18.1859	3	2572.316171	2571.333303	R	L	564	587
PSM	QNLFQEAEEFLYR	1747	sp|Q9UL46|PSME2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.543.4	14.53702	2	1668.7672	1668.7782	R	F	22	35
PSM	ASVSELACIYSALILHDDEVTVTEDK	1748	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1062.8	28.48533	3	2920.3862	2919.4052	M	I	2	28
PSM	VNPTVFFDIAVDGEPLGR	1749	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:1	ms_run[1]:scan=1.1.477.4	12.76747	3	1986.9882	1987.0042	M	V	2	20
PSM	VLVTGAAGQIAYSLLYSIGNGSVFGK	1750	sp|P40925|MDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.718.8	19.27287	3	2585.371571	2584.390090	R	D	7	33
PSM	FYPEDVAEELIQDITQK	1751	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1015.3	27.20398	3	2037.985571	2036.994253	K	L	84	101
PSM	QLSQSLLPAIVELAEDAK	1752	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28	ms_run[1]:scan=1.1.866.2	23.18268	3	1907.0072	1907.0242	R	W	399	417
PSM	GLNTIPLFVQLLYSPIENIQR	1753	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.929.5	24.88703	3	2428.338371	2427.352582	R	V	592	613
PSM	CSVALLNETESVLSYLDK	1754	sp|Q9BTC8|MTA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1404.3	37.57722	3	2022.9672	2022.9812	K	E	109	127
PSM	LQSLNLTGNCLDSFPAELFRPGALPLLSELAAADNCLR	1755	sp|Q8N1G4|LRC47_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	10-UNIMOD:4,36-UNIMOD:4	ms_run[1]:scan=1.1.1058.6	28.37417	5	4157.091118	4156.108536	R	E	155	193
PSM	SLAHLALNDVSLQALPGDVGNLANLVTLELR	1756	sp|Q14160|SCRIB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.593.7	15.89323	4	3226.749294	3225.772127	R	E	129	160
PSM	ETQPPETVQNWIELLSGETWNPLK	1757	sp|Q9H4A6|GOLP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.619.5	16.59018	4	2809.389294	2808.397026	K	L	142	166
PSM	FDTLCDLYDTLTITQAVIFCNTK	1758	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.1516.9	40.56728	3	2752.304471	2751.313556	K	R	265	288
PSM	GIDQCIPLFVQLVLER	1759	sp|O15397|IPO8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4	ms_run[1]:scan=1.1.63.3	1.645133	3	1900.006571	1899.028805	R	L	753	769
PSM	CMALAQLLVEQNFPAIAIHR	1760	sp|O00148|DX39A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.589.9	15.78827	3	2277.1796	2277.1757	R	G	299	319
PSM	DLPTSPVDLVINCLDCPENVFLR	1761	sp|Q96F86|EDC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	13-UNIMOD:4,16-UNIMOD:4	ms_run[1]:scan=1.1.284.6	7.596167	3	2687.292371	2685.314224	K	D	398	421
PSM	QLIFCTLAALAEER	1762	sp|Q7Z2T5|TRM1L_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	19	1-UNIMOD:28,5-UNIMOD:4	ms_run[1]:scan=1.1.874.4	23.40032	2	1616.8127	1616.8227	R	K	261	275
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1763	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.228.2	6.074383	5	3600.653618	3601.689128	R	R	85	117
PSM	SHCIAEVENDEMPADLPSLAADFVESK	1764	sp|P02768|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	3-UNIMOD:4	ms_run[1]:scan=1.1.1070.5	28.7014	3	2974.329971	2973.337204	K	D	311	338
PSM	ALMLQGVDLLADAVAVTMGPK	1765	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1085.3	29.09362	3	2113.116071	2112.132284	R	G	38	59
PSM	FQALCNLYGAITIAQAMIFCHTR	1766	sp|Q9NUU7|DD19A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	5-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.1139.7	30.56103	3	2697.300671	2698.318204	K	K	320	343
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1767	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.1146.4	30.74863	4	3584.639694	3585.694213	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1768	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1329.8	35.61622	3	3527.660171	3528.690508	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1769	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1407.8	37.66973	4	3527.676894	3528.690508	R	R	85	117
PSM	TLMVDPSQEVQENYNFLLQLQEELLK	1770	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	19		ms_run[1]:scan=1.1.1414.3	37.81668	4	3121.551694	3120.568918	R	E	289	315
PSM	ANYLASPPLVIAYAIAGTIR	1771	sp|P21399|ACOC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.255.3	6.804234	3	2073.1468	2073.1622	R	I	548	568
PSM	LCYVALDFEQEMATAASSSSLEK	1772	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.143.9	3.818267	3	2549.1721	2549.1665	K	S	216	239
PSM	DETGAIFIDRDPTVFAPILNFLR	1773	sp|Q8TBC3-2|SHKB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.331.4	8.866	3	2619.3484	2619.3697	K	T	58	81
PSM	QQEPIQILLIFLQK	1774	sp|Q6P3W7|SCYL2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.52.2	1.345983	3	1709.9974	1710.0080	K	M	419	433
PSM	SGTAYSLVAPDEIPYLLDLHLFLGR	1775	sp|Q8TDD1-2|DDX54_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.161.3	4.296033	4	2759.4353	2759.4534	R	S	435	460
PSM	WALSSLLQQLLK	1776	sp|Q6UWE0-2|LRSM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.123.3	3.266433	2	1398.8142	1398.8235	R	E	482	494
PSM	VLSTAGPSEALQPLVYPLAQVIIGCIK	1777	sp|Q9Y3T9|NOC2L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	25-UNIMOD:4	ms_run[1]:scan=1.1.186.3	4.966166	4	2836.5525	2836.5772	R	L	418	445
PSM	IPTAKPELFAYPLDWSIVDSILMER	1778	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.265.2	7.072933	4	2903.4945	2903.5143	K	R	745	770
PSM	LQRPLPEDLAEALASGVILCQLANQLRPR	1779	sp|O75427|LRCH4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	20-UNIMOD:4	ms_run[1]:scan=1.1.375.6	10.04802	4	3240.7517	3240.7764	R	S	552	581
PSM	LNLEEWILEQLTR	1780	sp|Q96C90|PP14B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.361.2	9.661	3	1655.8792	1655.8882	R	L	69	82
PSM	SAVELVQEFLNDLNK	1781	sp|Q9H900-2|ZWILC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.57.2	1.48175	3	1717.8802	1717.8886	K	L	180	195
PSM	CALMEALVLISNQFK	1782	sp|Q9HAV4|XPO5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	1-UNIMOD:4	ms_run[1]:scan=1.1.297.3	7.936083	3	1735.8910	1735.9001	K	N	646	661
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	1783	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.103.11	2.738117	4	4320.1537	4320.1835	K	A	198	238
PSM	TVQDLTSVVQTLLQQMQDK	1784	sp|O75506|HSBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.391.4	10.47548	3	2174.1061	2174.1253	K	F	8	27
PSM	QANWLSVSNIIQLGGTIIGSAR	1785	sp|P17858-2|PFKAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.207.3	5.514783	3	2297.2303	2297.2492	K	C	114	136
PSM	TLLEGSGLESIISIIHSSLAEPR	1786	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.292.7	7.8081	3	2421.2890	2421.3115	R	V	2483	2506
PSM	DQAVENILVSPVVVASSLGLVSLGGK	1787	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.462.8	12.36895	3	2550.4069	2550.4269	K	A	61	87
PSM	HAQPALLYLVPACIGFPVLVALAK	1788	sp|Q8TCT9-2|HM13_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	13-UNIMOD:4	ms_run[1]:scan=1.1.286.2	7.640067	3	2560.4407	2560.4603	K	G	314	338
PSM	ALDLFSDNAPPPELLEIINEDIAK	1789	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.227.6	6.054266	3	2636.3437	2636.3585	R	R	317	341
PSM	FIEAEQVPELEAVLHLVIASSDTR	1790	sp|Q5VYK3|ECM29_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.104.10	2.7635	3	2665.3741	2665.3963	K	H	250	274
PSM	YALQMEQLNGILLHLESELAQTR	1791	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	5-UNIMOD:35	ms_run[1]:scan=1.1.231.7	6.166417	3	2685.3577	2685.3795	R	A	331	354
PSM	YGASQVEDMGNIILAMISEPYNHR	1792	sp|Q6NXG1-2|ESRP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.168.11	4.4985	3	2707.2640	2707.2734	R	F	176	200
PSM	AIMNLVTGVTSLTFNPTTEILAIASEK	1793	sp|Q9Y5J1|UTP18_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.371.10	9.944917	3	2833.4965	2833.5147	K	M	468	495
PSM	TGAFSIPVIQIVYETLK	1794	sp|Q92499-2|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.471.3	12.60337	3	1878.0424	1878.0502	K	D	53	70
PSM	DQQEAALVDMVNDGVEDLR	1795	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.528.6	14.15225	3	2115.9742	2115.9743	K	C	83	102
PSM	LQADDFLQDYTLLINILHSEDLGK	1796	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.892.7	23.89647	3	2773.3954	2773.4174	R	D	421	445
PSM	EFGAGPLFNQILPLLMSPTLEDQER	1797	sp|O75533|SF3B1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.776.5	20.81825	3	2814.4237	2814.4262	R	H	525	550
PSM	TIPGDTAWLLYDTYGFPVDLTGLIAEEK	1798	sp|P49588-2|SYAC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.698.8	18.73715	3	3097.5562	3097.5536	K	G	413	441
PSM	QLNHFWEIVVQDGITLITK	1799	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.748.2	20.0723	4	2253.2013	2253.2158	K	E	670	689
PSM	SLLDCHIIPALLQGLLSPDLK	1800	sp|Q8IUR7-2|ARMC8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.564.2	15.10055	4	2315.2729	2315.2923	K	F	86	107
PSM	LLTAPELILDQWFQLSSSGPNSR	1801	sp|Q9BSJ8-2|ESYT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.678.2	18.1809	4	2571.3145	2571.3333	R	L	574	597
PSM	VLVTGAAGQIAYSLLYSIGNGSVFGK	1802	sp|P40925-3|MDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.723.2	19.3963	4	2584.3769	2584.3901	R	D	25	51
PSM	LANQFAIYKPVTDFFLQLVDAGK	1803	sp|P42704|LPPRC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.648.2	17.36808	4	2597.3749	2597.3894	R	V	1244	1267
PSM	DDAVPNLIQLITNSVEMHAYTVQR	1804	sp|O43747-2|AP1G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.609.3	16.31902	4	2726.3497	2726.3698	R	L	438	462
PSM	SDSVTDSGPTFNYLLDMPLWYLTK	1805	sp|P11388-2|TOP2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.480.3	12.847	4	2762.2965	2762.3149	K	E	1141	1165
PSM	DCAVLSAIIDLIK	1806	sp|Q9H2U1-2|DHX36_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.598.2	16.0205	3	1429.7782	1429.7850	R	T	962	975
PSM	MTENTLLFAFVEGTLAQAVK	1807	sp|Q9NU22|MDN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.997.3	26.71645	3	2182.1185	2182.1344	K	K	809	829
PSM	GSVPLGLATVLQDLLR	1808	sp|Q8WUX9-2|CHMP7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.647.2	17.34092	3	1650.9580	1650.9669	K	R	85	101
PSM	ELSSLLSIISEEAGGGSTFEGLSTAFHHYFSK	1809	sp|Q9UKZ1|CNO11_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.523.9	14.02188	4	3400.6285	3400.6463	K	A	67	99
PSM	VLVTGAAGQIAYSLLYSIGNGSVFGK	1810	sp|P40925-3|MDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.705.10	18.92442	3	2584.3726	2584.3901	R	D	25	51
PSM	TQTPFTPENLFLAMLSVVHCNSR	1811	sp|Q8NEY8-3|PPHLN_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	20-UNIMOD:4	ms_run[1]:scan=1.1.907.11	24.30062	3	2661.2884	2661.3043	R	K	403	426
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1812	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.1004.10	26.91625	4	3585.6709	3585.6942	R	R	85	117
PSM	EAMDPIAELLSQLSGVR	1813	sp|Q9P0J7|KCMF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.751.7	20.16463	2	1827.9306	1827.9400	R	R	194	211
PSM	INLSLSALGNVIAALAGNR	1814	sp|O14782|KIF3C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.643.2	17.23398	3	1866.0568	1866.0686	K	S	293	312
PSM	VDTMIVQAISLLDDLDK	1815	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.982.4	26.30933	3	1887.9700	1887.9863	K	E	158	175
PSM	GPGTSFEFALAIVEALNGK	1816	sp|Q99497|PARK7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.783.2	20.99798	3	1919.9869	1919.9993	R	E	157	176
PSM	VAACELLHSMVMFMLGK	1817	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.850.3	22.76282	3	1935.9331	1935.9443	K	A	928	945
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	1818	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.644.8	17.27423	3	2908.4149	2908.4310	K	N	101	130
PSM	FGVICLEDLIHEIAFPGK	1819	sp|Q6DKI1|RL7L_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.602.2	16.1304	3	2057.0554	2057.0656	K	H	180	198
PSM	TTSNDIVEIFTVLGIEAVR	1820	sp|P24928|RPB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.525.3	14.066	3	2076.0973	2076.1103	R	K	1357	1376
PSM	DQQEAALVDMVNDGVEDLR	1821	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.897.3	24.01808	3	2115.9586	2115.9743	K	C	83	102
PSM	VDQGTLFELILAANYLDIK	1822	sp|P63208-2|SKP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.545.7	14.5945	3	2135.1379	2135.1514	K	G	95	114
PSM	VDQGTLFELILAANYLDIK	1823	sp|P63208-2|SKP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.545.8	14.59617	3	2135.1379	2135.1514	K	G	95	114
PSM	LALMLNDMELVEDIFTSCK	1824	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	18-UNIMOD:4	ms_run[1]:scan=1.1.538.4	14.40008	3	2241.0556	2241.0731	R	D	109	128
PSM	GLNTIPLFVQLLYSPIENIQR	1825	sp|P35222|CTNB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.981.5	26.28403	3	2427.3388	2427.3526	R	V	592	613
PSM	SELAALPPSVQEEHGQLLALLAELLR	1826	sp|Q7L2E3-2|DHX30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.906.10	24.27208	3	2796.5176	2796.5385	R	G	1183	1209
PSM	SLPPVMAQNLSIPLAFACLLHLANEK	1827	sp|Q15003|CND2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	18-UNIMOD:4	ms_run[1]:scan=1.1.926.8	24.81285	3	2846.4991	2846.5186	R	N	697	723
PSM	SANYCHTSQGDPIGLILLGEVALGNMYELK	1828	sp|P09874|PARP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.758.5	20.34437	4	3262.5833	3262.6002	K	H	904	934
PSM	DTSPGSAYQEGGGLYALGLIHANHGGDIIDYLLNQLK	1829	sp|Q99460-2|PSMD1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.610.10	16.35748	4	3869.8941	3869.9224	K	N	430	467
PSM	VDTMIVQAISLLDDLDK	1830	sp|Q9Y2X3|NOP58_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1026.2	27.50027	3	1887.9715	1887.9863	K	E	158	175
PSM	FDQLFDDESDPFEVLK	1831	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1424.2	38.06565	3	1942.8658	1942.8837	R	A	17	33
PSM	DQQEAALVDMVNDGVEDLR	1832	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1128.4	30.25527	3	2115.9517	2115.9743	K	C	83	102
PSM	LPVMTMIPDVDCLLWAIGR	1833	sp|P00390-2|GSHR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	12-UNIMOD:4	ms_run[1]:scan=1.1.1010.3	27.06848	3	2199.1093	2199.1254	R	V	274	293
PSM	SSQSWSLAADAGLLQFLQEFSQQTISR	1834	sp|Q9Y4E1|WAC2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	18		ms_run[1]:scan=1.1.1399.4	37.44363	4	2997.4732941913203	2997.4832139757195	R	T	31	58
PSM	VIAGTIDQTTGEVLSVFQAVLR	1835	sp|Q03001|DYST_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1177.5	31.58487	3	2316.2572	2316.2689	K	G	1554	1576
PSM	DNYVPEVSALDQEIIEVDPDTK	1836	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1184.4	31.7754	3	2488.2097	2488.1857	R	E	82	104
PSM	IYDDDFFQNLDGVANALDNVDAR	1837	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1405.6	37.61482	3	2599.1812	2599.1827	R	M	519	542
PSM	EITAIESSVPCQLLESVLQELK	1838	sp|O75694-2|NU155_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.1447.3	38.67393	4	2485.2853	2485.2985	R	G	635	657
PSM	DVTEVLILQLFSQIGPCK	1839	sp|Q01085-2|TIAR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	17-UNIMOD:4	ms_run[1]:scan=1.1.1277.3	34.2298	3	2059.0885	2059.1024	R	S	19	37
PSM	SVFQTINQFLDLTLFTHR	1840	sp|P53985-2|MOT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1151.5	30.88558	3	2179.1287	2179.1426	R	G	244	262
PSM	IRPLGFTEEVEVILQYICECECQSEGIPESPK	1841	sp|P05556-2|ITB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	18-UNIMOD:4,20-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.1502.3	40.17485	5	3808.7751	3808.7998	K	C	445	477
PSM	TVPPAVTGITFLSGGQSEEEASINLNAINK	1842	sp|P04075-2|ALDOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1500.5	40.12352	4	3056.5453	3056.5666	R	C	314	344
PSM	QPTELDALVFGHLYTILTTQLTNDELSEK	1843	sp|O75431-2|MTX2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1050.7	28.15487	4	3288.6525	3288.6765	K	V	197	226
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	1844	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	27-UNIMOD:4	ms_run[1]:scan=1.1.1267.3	33.97523	4	3436.6713	3436.6973	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1845	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	27-UNIMOD:4	ms_run[1]:scan=1.1.1541.8	41.25142	4	3512.6737	3512.6956	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1846	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.1046.10	28.05348	4	3585.6685	3585.6942	R	R	85	117
PSM	VDLQQQIMTIIDELGK	1847	sp|Q5SQI0-3|ATAT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1236.2	33.17143	3	1842.9601	1842.9761	R	A	37	53
PSM	VASVASTLETTFETISTLSGVDLENGTCSHPLIPDK	1848	sp|Q9NSE4|SYIM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	28-UNIMOD:4	ms_run[1]:scan=1.1.1189.6	31.91198	4	3788.8381	3788.8666	K	A	337	373
PSM	FDQLFDDESDPFEVLK	1849	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1522.10	40.73317	2	1942.8714	1942.8837	R	A	17	33
PSM	GHYTEGAELVDSVLDVVR	1850	sp|P07437|TBB5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1439.2	38.45562	3	1957.9615	1957.9745	K	K	104	122
PSM	DIPIWGTLIQYIRPVFVSR	1851	sp|Q8NF37|PCAT1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1023.3	27.42058	3	2272.2568	2272.2732	R	S	159	178
PSM	DGADIHSDLFISIAQALLGGTAR	1852	sp|Q96EY1-2|DNJA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1116.3	29.93253	3	2340.1921	2340.2074	R	A	342	365
PSM	GVPQIEVTFDIDANGILNVSAVDK	1853	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.1529.9	40.92335	3	2513.2816	2513.3013	R	S	470	494
PSM	LCYVALDFEQEMATAASSSSLEK	1854	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	2-UNIMOD:4	ms_run[1]:scan=1.1.1304.6	34.93843	3	2549.1520	2549.1665	K	S	216	239
PSM	IGIASQALGIAQTALDCAVNYAENR	1855	sp|P16219|ACADS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	17-UNIMOD:4	ms_run[1]:scan=1.1.1488.11	39.80607	3	2618.2939	2618.3122	R	M	273	298
PSM	IVPVDIYIPGCPPTAEALLYGILQLQR	1856	sp|O75251|NDUS7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	11-UNIMOD:4	ms_run[1]:scan=1.1.1152.7	30.916	3	3008.6272	3008.6409	R	K	173	200
PSM	VDIVAINDPFIDLNYMVYMFQYDSTHGK	1857	sp|P04406|G3P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	19-UNIMOD:35	ms_run[1]:scan=1.1.1558.6	41.72412	4	3323.5533	3323.5519	K	F	28	56
PSM	SGPPGEEAQVASQFIADVIENSQIIQK	1858	sp|Q96B26|EXOS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.116.10	3.0882	3	2854.4131	2854.4348	R	E	95	122
PSM	LVNLYGLLHGLQAAVAQQDTLMEAR	1859	sp|Q92974-2|ARHG2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18		ms_run[1]:scan=1.1.185.3	4.940084	4	2723.4253	2723.4428	R	F	741	766
PSM	ELNIDVADVESLLVQCILDNTIHGR	1860	sp|P61201-2|CSN2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	18	16-UNIMOD:4	ms_run[1]:scan=1.1.1556.2	41.66103	4	2835.4317	2835.4436	K	I	384	409
PSM	DDDIAALVVDNGSGMCK	1861	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.1407.9	37.67307	2	1821.7712	1820.7912	M	A	2	19
PSM	QIFILLFQR	1862	sp|P55060|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28	ms_run[1]:scan=1.1.254.2	6.777117	2	1159.6649	1159.6748	K	L	769	778
PSM	EATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK	1863	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.569.6	15.24228	5	3866.996118	3866.014893	K	A	354	389
PSM	YSPDCIIIVVSNPVDILTYVTWK	1864	sp|P07195|LDHB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	5-UNIMOD:4	ms_run[1]:scan=1.1.1143.8	30.66758	3	2695.377371	2694.397877	K	L	128	151
PSM	ALMLQGVDLLADAVAVTMGPK	1865	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.917.3	24.56363	3	2114.118971	2112.132284	R	G	38	59
PSM	CLELFTELAEDK	1866	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1550.4	41.49362	2	1449.6592	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1867	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1153.4	30.9312	2	1449.6582	1449.6692	K	E	420	432
PSM	ASVSELACIYSALILHDDEVTVTEDK	1868	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1330.11	35.64323	3	2919.3872	2919.4052	M	I	2	28
PSM	QLTEMLPSILNQLGADSLTSLRR	1869	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28	ms_run[1]:scan=1.1.1050.9	28.1582	3	2538.3282	2538.3472	K	L	142	165
PSM	VNPTVFFDIAVDGEPLGR	1870	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.346.2	9.255617	3	1986.9922	1987.0042	M	V	2	20
PSM	TGAFSIPVIQIVYETLK	1871	sp|Q92499|DDX1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.490.3	13.11733	3	1879.043771	1878.050252	K	D	53	70
PSM	FYPEDVAEELIQDITQK	1872	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1074.2	28.79765	3	2037.988871	2036.994253	K	L	84	101
PSM	LGLALNFSVFYYEILNSPEK	1873	sp|P31946|1433B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.47.9	1.222633	3	2317.176071	2316.204186	R	A	170	190
PSM	QAAPCVLFFDELDSIAK	1874	sp|P55072|TERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28,5-UNIMOD:4	ms_run[1]:scan=1.1.471.4	12.60503	3	1905.9082	1905.9182	R	A	568	585
PSM	SGPPGEEAQVASQFIADVIENSQIIQK	1875	sp|Q96B26|EXOS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.154.10	4.117816	3	2855.426771	2854.434868	R	E	95	122
PSM	IPTAKPELFAYPLDWSIVDSILMER	1876	sp|P49756|RBM25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.250.6	6.682367	3	2904.495371	2903.514304	K	R	745	770
PSM	DILATTPPPVQPPILTITCPTFGDWAQLAPAVPGLQGALR	1877	sp|Q66K74|MAP1S_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	19-UNIMOD:4	ms_run[1]:scan=1.1.91.10	2.414183	4	4193.210894	4192.239474	R	L	151	191
PSM	AQGLPWSCTMEDVLNFFSDCR	1878	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	8-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.1480.9	39.58473	3	2533.071071	2532.087201	R	I	154	175
PSM	QVIQQNPALLPALLQQLGQENPQLLQQISR	1879	sp|P54725|RD23A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:28	ms_run[1]:scan=1.1.126.7	3.354433	4	3360.8282	3360.8512	R	H	246	276
PSM	ADLLGSILSSMEKPPSLGDQETR	1880	sp|O75391|SPAG7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	1-UNIMOD:1	ms_run[1]:scan=1.1.420.9	11.26873	3	2485.2202	2485.2362	M	R	2	25
PSM	EVMCQLGLHQKANR	1881	sp|A4D0V7|CPED1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	18	4-UNIMOD:4	ms_run[1]:scan=1.1.872.7	23.35193	2	1683.8102	1682.8342	K	L	170	184
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1882	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.182.11	4.875134	3	3600.665171	3601.689128	R	R	85	117
PSM	GVPQIEVTFDIDANGILNVSAVDK	1883	sp|P11142|HSP7C_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.639.4	17.13888	3	2514.283271	2513.301334	R	S	470	494
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	1884	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18	27-UNIMOD:4	ms_run[1]:scan=1.1.879.10	23.54623	4	3435.664094	3436.697307	R	R	85	117
PSM	ALDLFSDNAPPPELLEIINEDIAK	1885	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1064.6	28.5327	3	2637.321071	2636.358515	R	R	265	289
PSM	GLIDGVVEADLVEALQEFGPISYVVVMPK	1886	sp|P14866|HNRPL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	18		ms_run[1]:scan=1.1.1574.2	42.15619	4	3085.608894	3086.624977	R	K	108	137
PSM	ALDLFSDNAPPPELLEIINEDIAK	1887	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.274.9	7.327267	3	2636.3449	2636.3585	R	R	317	341
PSM	ALDLFSDNAPPPELLEIINEDIAK	1888	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.387.5	10.36938	3	2636.3521	2636.3585	R	R	317	341
PSM	TLPTLQELHLSDNLLGDAGLQLLCEGLLDPQCR	1889	sp|P13489|RINI_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	17	24-UNIMOD:4,32-UNIMOD:4	ms_run[1]:scan=1.1.6.11	0.1294	4	3701.8472941913205	3701.8756820732197	R	L	111	144
PSM	ERPPNPIEFLASYLLK	1890	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.111.2	2.9396	4	1886.0249	1886.0301	K	N	75	91
PSM	GSGTQLFDHIAECLANFMDK	1891	sp|P52789|HXK2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	13-UNIMOD:4	ms_run[1]:scan=1.1.47.3	1.212633	4	2253.0045	2253.0194	R	L	121	141
PSM	YALQMEQLNGILLHLESELAQTR	1892	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	5-UNIMOD:35	ms_run[1]:scan=1.1.240.3	6.40695	4	2685.3553	2685.3795	R	A	331	354
PSM	ETGDETTVWQALTLLEEGLTHSPSNAQFK	1893	sp|Q14CX7-2|NAA25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.386.6	10.34878	4	3201.5249	3201.5466	R	L	481	510
PSM	ETGDETTVWQALTLLEEGLTHSPSNAQFK	1894	sp|Q14CX7-2|NAA25_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.367.2	9.8299	4	3201.5249	3201.5466	R	L	481	510
PSM	DGFESVFPLSHLQYFYPEELDQLLCGSK	1895	sp|Q14669-2|TRIPC_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	25-UNIMOD:4	ms_run[1]:scan=1.1.459.6	12.32982	4	3317.5377	3317.5591	R	A	1876	1904
PSM	NNSNDIVNAIMELTM	1896	sp|E9PAV3-2|NACAM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.139.7	3.706633	2	1677.7604	1677.7702	K	-	911	926
PSM	ALAAQLPVLPWSEVTFLAPVTWPDK	1897	sp|Q6P2I3|FAH2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.53.10	1.386383	3	2748.4708	2748.4891	R	V	83	108
PSM	SGTAYSLVAPDEIPYLLDLHLFLGR	1898	sp|Q8TDD1-2|DDX54_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.153.7	4.089117	3	2759.4409	2759.4534	R	S	435	460
PSM	GLPFGCTKEEIVQFFSGLEIVPNGITLPVDPEGK	1899	sp|P52597|HNRPF_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.206.9	5.49845	4	3686.8633	3686.8906	R	I	117	151
PSM	FYPEDVAEELIQDITQK	1900	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.385.3	10.31175	3	2036.9797	2036.9942	K	L	84	101
PSM	NWYIQATCATSGDGLYEGLDWLANQLK	1901	sp|P61204-2|ARF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	8-UNIMOD:4	ms_run[1]:scan=1.1.221.11	5.90175	3	3086.4232	3086.4444	R	N	115	142
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	1902	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.95.7	2.5155	6	4320.1483	4320.1835	K	A	198	238
PSM	LGLALNFSVFYYEILNSPEK	1903	sp|P63104-2|1433Z_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.123.5	3.269767	3	2316.1933	2316.2041	R	A	93	113
PSM	TEVSLSAFALLFSELVQHCQSR	1904	sp|Q8IUR0|TPPC5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	19-UNIMOD:4	ms_run[1]:scan=1.1.384.5	10.29155	3	2521.2469	2521.2635	R	V	22	44
PSM	ALDLFSDNAPPPELLEIINEDIAK	1905	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.28.9	0.70915	3	2636.3365	2636.3585	R	R	317	341
PSM	ALDLFSDNAPPPELLEIINEDIAK	1906	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.318.4	8.505167	3	2636.3707	2636.3585	R	R	317	341
PSM	LGLALNFSVFYYEIQNAPEQACLLAK	1907	sp|Q04917|1433F_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	22-UNIMOD:4	ms_run[1]:scan=1.1.105.5	2.788817	3	2971.4959	2971.5153	R	Q	173	199
PSM	VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKK	1908	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	21-UNIMOD:4	ms_run[1]:scan=1.1.198.4	5.279683	5	4208.1651	4208.1927	R	Q	59	100
PSM	DQQEAALVDMVNDGVEDLR	1909	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.592.4	15.8612	3	2115.9631	2115.9743	K	C	83	102
PSM	LEQVSSDEGIGTLAENLLEALR	1910	sp|Q5T4S7-2|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.537.4	14.37808	3	2356.1764	2356.2121	K	E	4751	4773
PSM	DNYVPEVSALDQEIIEVDPDTK	1911	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.673.4	18.0555	3	2488.1914	2488.1857	R	E	82	104
PSM	DNYVPEVSALDQEIIEVDPDTK	1912	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.849.5	22.73998	3	2488.2145	2488.1857	R	E	82	104
PSM	ALDLFSDNAPPPELLEIINEDIAK	1913	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.540.7	14.45898	3	2636.3425	2636.3585	R	R	317	341
PSM	ALDLFSDNAPPPELLEIINEDIAK	1914	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.745.9	20.00298	3	2636.3437	2636.3585	R	R	317	341
PSM	SHCIAEVENDEMPADLPSLAADFVESK	1915	sp|P02768-2|ALBU_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.889.7	23.81225	3	2973.3115	2973.3372	K	D	119	146
PSM	GYTSWAIGLSVADLAESIMK	1916	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.989.6	26.51018	2	2111.0514	2111.0609	K	N	275	295
PSM	GVNPSLVSWLTTMMGLR	1917	sp|P46379-2|BAG6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.959.2	25.6868	3	1860.9493	1860.9590	R	L	899	916
PSM	VLVTGAAGQIAYSLLYSIGNGSVFGK	1918	sp|P40925-3|MDHC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.703.2	18.85857	4	2584.3733	2584.3901	R	D	25	51
PSM	EDNTLLYEITAYLEAAGIHNPLNK	1919	sp|Q12768|WASC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.812.6	21.78808	4	2701.3437	2701.3598	K	I	1005	1029
PSM	LQADDFLQDYTLLINILHSEDLGK	1920	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.820.4	22.00082	4	2773.3989	2773.4174	R	D	421	445
PSM	DTSLASFIPAVNDLTSDLFR	1921	sp|Q96CS2-2|HAUS1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.735.4	19.72917	3	2181.0826	2181.0954	K	T	33	53
PSM	EAIETIVAAMSNLVPPVELANPENQFR	1922	sp|Q5JWF2-2|GNAS1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.471.7	12.61003	4	2951.4881	2951.5062	K	V	730	757
PSM	GQVLSVCVEEENIIPYITNVLQNPDLALR	1923	sp|Q00610-2|CLH1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.569.9	15.24728	4	3295.6869	3295.7122	K	M	322	351
PSM	AMQALLQIQQGLQTLQTEAPGLVPSLGSFGISR	1924	sp|Q9NRR5|UBQL4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.545.11	14.60117	4	3451.8265	3451.8497	R	T	465	498
PSM	LTPFIIQENLNLALNSASAIGCHVVNIGAEDLR	1925	sp|P13797-2|PLST_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	22-UNIMOD:4	ms_run[1]:scan=1.1.660.6	17.70795	4	3561.8373	3561.8613	K	A	166	199
PSM	TSTVDLPIENQLLWQIDREMLNLYIENEGK	1926	sp|P34932|HSP74_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.798.5	21.41417	4	3573.7785	3573.8024	K	M	574	604
PSM	TATFAISILQQIELDLK	1927	sp|P60842-2|IF4A1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.676.3	18.12857	3	1903.0537	1903.0666	K	A	83	100
PSM	GIVSLSDILQALVLTGGEK	1928	sp|P54619-2|AAKG1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.724.2	19.42333	3	1912.0747	1912.0881	K	K	279	298
PSM	NTPFLYDLVMTHALEWPSLTAQWLPDVTRPEGK	1929	sp|Q09028-2|RBBP4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.799.5	21.4412	4	3824.9005	3824.9236	K	D	26	59
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	1930	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.669.10	17.95208	3	2875.4995	2875.5179	K	K	591	617
PSM	NIVSLLLSMLGHDEDNTR	1931	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.943.2	25.25785	3	2025.9931	2026.0153	K	I	2426	2444
PSM	ALMLQGVDLLADAVAVTMGPK	1932	sp|P10809|CH60_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	3-UNIMOD:35	ms_run[1]:scan=1.1.940.5	25.18095	3	2128.1134	2128.1272	R	G	38	59
PSM	IQFNDLQSLLCATLQNVLRK	1933	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	11-UNIMOD:4	ms_run[1]:scan=1.1.921.5	24.66817	3	2373.2692	2373.2838	R	V	430	450
PSM	ALDLFSDNAPPPELLEIINEDIAK	1934	sp|Q15084-2|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.725.5	19.45527	3	2636.3479	2636.3585	R	R	317	341
PSM	IALTDAYLLYTPSQIALTAILSSASR	1935	sp|P51946|CCNH_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.936.8	25.0779	3	2751.4894	2751.5058	R	A	198	224
PSM	ETQPPETVQNWIELLSGETWNPLK	1936	sp|Q9H4A6|GOLP3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.605.9	16.2215	3	2808.3802	2808.3970	K	L	142	166
PSM	GFGYAEFEDLDSLLSALSLNEESLGNRR	1937	sp|P23588|IF4B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.504.10	13.51007	3	3101.4742	3101.4941	K	I	138	166
PSM	ATPPQIVNGDQYCGDYELFVEAVEQNTLQEFLK	1938	sp|Q9H299|SH3L3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	13-UNIMOD:4	ms_run[1]:scan=1.1.825.10	22.14557	4	3814.7801	3814.8036	K	L	59	92
PSM	DLADELALVDVIEDK	1939	sp|P00338-3|LDHA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1477.2	39.49158	3	1656.8272	1656.8458	K	L	72	87
PSM	LLQTDDEEEAGLLELLK	1940	sp|P55060-3|XPO2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1539.3	41.18773	3	1928.0134	1927.9990	K	S	252	269
PSM	DYPVVSIEDPFDQDDWGAWQK	1941	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1285.4	34.42758	3	2509.094771	2509.107385	K	F	286	307
PSM	ILNDVQDRFEVNISELPDEIDISSYIEQTR	1942	sp|Q13838|DX39B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	17		ms_run[1]:scan=1.1.1451.8	38.79168	4	3549.7268941913203	3549.7474867124397	K	-	399	429
PSM	GFNDDVLLQIVHFLLNRPK	1943	sp|Q9NP92|RT30_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1455.2	38.8913	4	2237.2157	2237.2321	K	E	412	431
PSM	DLDFTIDLDFK	1944	sp|Q99873-2|ANM1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1540.3	41.21548	2	1340.6398	1340.6500	R	G	322	333
PSM	FQALCNLYGAITIAQAMIFCHTR	1945	sp|Q9NUU7-2|DD19A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	5-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.1139.4	30.5527	4	2698.2989	2698.3182	K	K	230	253
PSM	FYPEDVAEELIQDITQK	1946	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1054.2	28.2545	3	2036.9800	2036.9942	K	L	84	101
PSM	TDMIQALGGVEGILEHTLFK	1947	sp|Q6P2Q9|PRP8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1291.2	34.5792	3	2171.1172	2171.1296	R	G	1472	1492
PSM	TFGIWTLLSSVIR	1948	sp|Q9UKR5|ERG28_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1077.5	28.8806	2	1491.8354	1491.8450	R	C	52	65
PSM	TLMVDPSQEVQENYNFLLQLQEELLK	1949	sp|Q9Y5B9|SP16H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	3-UNIMOD:35	ms_run[1]:scan=1.1.1409.2	37.71825	4	3136.5493	3136.5638	R	E	289	315
PSM	SGDAPLTVNELGTAYVSATTGAVATALGLNALTK	1950	sp|Q9H9B4|SFXN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1094.10	29.34842	4	3246.6761	3246.6983	R	H	137	171
PSM	GAALLSWVNSLHVADPVEAVLQLQDCSIFIK	1951	sp|Q14980-2|NUMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	26-UNIMOD:4	ms_run[1]:scan=1.1.1091.7	29.26227	4	3392.7561	3392.7802	R	I	8	39
PSM	DAIITCNPEEFIVEALQLPNFQQSVQEYR	1952	sp|Q9BQ52-2|RNZ2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.1061.4	28.45332	4	3450.6517	3450.6765	R	R	342	371
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1953	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	7-UNIMOD:35,27-UNIMOD:4	ms_run[1]:scan=1.1.1033.5	27.69808	4	3528.6669	3528.6905	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1954	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.1547.6	41.41365	4	3585.6737	3585.6942	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1955	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.1573.7	42.13737	4	3585.6737	3585.6942	R	R	85	117
PSM	FDQLFDDESDPFEVLK	1956	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1372.5	36.71461	3	1942.8706	1942.8837	R	A	17	33
PSM	EGPEGANLFIYHLPQEFGDQDLLQMFMPFGNVVSAK	1957	sp|Q92879-2|CELF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1326.7	35.53548	4	4037.9069	4037.9332	K	V	392	428
PSM	FYPEDVAEELIQDITQK	1958	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1319.2	35.3329	3	2036.9776	2036.9942	K	L	84	101
PSM	FYPEDVAEELIQDITQK	1959	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1112.2	29.82007	3	2036.9833	2036.9942	K	L	84	101
PSM	DYVLDCNILPPLLQLFSK	1960	sp|P52294|IMA5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	6-UNIMOD:4	ms_run[1]:scan=1.1.1175.4	31.52593	3	2147.1250	2147.1337	R	Q	205	223
PSM	WSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKR	1961	sp|P49459-2|UBE2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1222.8	32.80268	4	4461.1549	4461.1724	R	E	66	106
PSM	SDIANILDWMLNQDFTTAYR	1962	sp|P40937-2|RFC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1020.6	27.34965	3	2386.1131	2386.1263	K	N	224	244
PSM	CPSCFYNLLNLFCELTCSPR	1963	sp|O15118|NPC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	1-UNIMOD:4,4-UNIMOD:4,13-UNIMOD:4,17-UNIMOD:4	ms_run[1]:scan=1.1.1382.6	36.99458	3	2550.1165	2550.1164	R	Q	97	117
PSM	LCYVALDFEQEMATAASSSSLEK	1964	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.1167.6	31.31818	3	2549.1541	2549.1665	K	S	216	239
PSM	TISALAIAALAEAATPYGIESFDSVLK	1965	sp|O75533|SF3B1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1114.10	29.8889	3	2721.4267	2721.4476	R	P	703	730
PSM	NQLEIQNLQEDWDHFEPLLSSLLR	1966	sp|Q8NCN5|PDPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1085.10	29.10695	3	2936.4568	2936.4668	K	R	318	342
PSM	GTEWVDPEDPTVIAENELLGAAAAIEAAAK	1967	sp|Q9Y490|TLN1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1506.11	40.29748	3	3050.4952	3050.5084	K	K	2292	2322
PSM	FWEVISDEHGIDPTGTYHGDSDLQLDR	1968	sp|P07437|TBB5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1480.5	39.57807	4	3101.3853	3101.4003	K	I	20	47
PSM	IQFNDLQSLLCATLQNVLR	1969	sp|Q14974-2|IMB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	11-UNIMOD:4	ms_run[1]:scan=1.1.1558.3	41.71912	3	2245.1740	2245.1889	R	K	430	449
PSM	EATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK	1970	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.568.5	15.2137	5	3865.9931	3866.0149	K	A	354	389
PSM	LGLALNFSVFYYEILNNPELACTLAK	1971	sp|P27348|1433T_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	22-UNIMOD:4	ms_run[1]:scan=1.1.1169.8	31.37552	3	2972.5189	2972.5357	R	T	168	194
PSM	VNTFSALANIDLALEQGDALALFR	1972	sp|P46940|IQGA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.940.9	25.19095	3	2561.3314	2561.3489	K	A	303	327
PSM	DEFPEVYVPTVFENYVADIEVDGK	1973	sp|P62745|RHOB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17		ms_run[1]:scan=1.1.1141.4	30.61857	3	2773.3207	2773.3011	K	Q	28	52
PSM	RSEAPVLPDVCLGLGSPSPGPR	1974	sp|Q99687-2|MEIS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	11-UNIMOD:4	ms_run[1]:scan=1.1.980.4	26.25708	3	2260.2067	2260.1634	R	W	288	310
PSM	MIIEGCEILLDTSQTFVRQGSLIQVPMSEK	1975	sp|Q13972-3|RGRF1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	17	6-UNIMOD:4,27-UNIMOD:35	ms_run[1]:scan=1.1.1560.11	41.78827	3	3437.6707	3437.7244	R	G	442	472
PSM	QLFSSLFSGILK	1976	sp|P78527|PRKDC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.119.2	3.156217	2	1321.7180	1321.7277	K	E	2807	2819
PSM	DDDIAALVVDNGSGMCK	1977	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,16-UNIMOD:4	ms_run[1]:scan=1.1.1537.10	41.1445	2	1821.7662	1820.7912	M	A	2	19
PSM	QLDSYKNGFLNLALPFFGFSEPLAAPR	1978	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.43.8	1.113067	4	3012.516494	3011.554529	R	H	918	945
PSM	CLELFSELAEDK	1979	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.670.3	17.96588	2	1435.6456	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1980	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1153.3	30.92953	2	1435.6452	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1981	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.887.3	23.74825	2	1435.6452	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1982	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1463.3	39.11225	2	1435.6432	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1983	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1404.7	37.58389	2	1435.6452	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1984	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1115.5	29.90578	2	1435.6444	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1985	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.502.2	13.4408	2	1435.6470	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1986	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1444.4	38.59575	2	1435.6450	1435.6536	K	E	412	424
PSM	CLELFSELAEDK	1987	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.808.4	21.6766	2	1435.6432	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	1988	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.651.4	17.45258	2	1435.6452	1435.6536	K	E	412	424
PSM	EAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLR	1989	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	23-UNIMOD:4	ms_run[1]:scan=1.1.711.6	19.0876	7	6253.2012	6252.2422	K	R	399	461
PSM	CLELFTELAEDK	1990	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.980.3	26.25375	2	1449.6609	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	1991	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1495.5	39.98677	2	1449.6552	1449.6692	K	E	420	432
PSM	CLQQALHTFQNDIHVYPIWLCPFILPSQPGLVHPK	1992	sp|Q15392|DHC24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.1371.3	36.68438	6	4149.0852	4149.1112	K	G	393	428
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1993	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.387.8	10.37938	3	3586.670171	3585.694213	R	R	85	117
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	1994	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.765.11	20.54327	4	3586.670894	3585.694213	R	R	85	117
PSM	ASVSELACIYSALILHDDEVTVTEDK	1995	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1552.10	41.56021	3	2919.3912	2919.4052	M	I	2	28
PSM	ASVSELACIYSALILHDDEVTVTEDK	1996	sp|P05386|RLA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1,8-UNIMOD:4	ms_run[1]:scan=1.1.1002.3	26.8556	3	2919.3902	2919.4052	M	I	2	28
PSM	LPITVLNGAPGFINLCDALNAWQLVK	1997	sp|P31939|PUR9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	16-UNIMOD:4	ms_run[1]:scan=1.1.999.8	26.78102	3	2837.496671	2836.530957	K	E	226	252
PSM	QLTEMLPSILNQLGADSLTSLRR	1998	sp|P20290|BTF3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.1031.6	27.64378	3	2539.3292	2538.3472	K	L	142	165
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	1999	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	27-UNIMOD:4	ms_run[1]:scan=1.1.1477.10	39.50492	4	3513.675294	3512.695593	R	R	85	117
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	2000	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	27-UNIMOD:4	ms_run[1]:scan=1.1.1458.8	38.98528	4	3513.675294	3512.695593	R	R	85	117
PSM	QIFNVNNLNLPQVALSFGFK	2001	sp|Q9NVP1|DDX18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.924.2	24.74402	3	2245.1672	2245.1892	K	V	597	617
PSM	SGPPGEEAQVASQFIADVIENSQIIQK	2002	sp|Q96B26|EXOS8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17		ms_run[1]:scan=1.1.135.9	3.60175	3	2855.4222	2854.4342	R	E	95	122
PSM	QVDVPTLTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSK	2003	sp|P30049|ATPD_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.384.4	10.28823	5	4089.1972	4089.2262	R	Y	57	97
PSM	TISPEHVIQALESLGFGSYISEVK	2004	sp|Q01658|NC2B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.238.3	6.346317	4	2604.342894	2603.348284	K	E	65	89
PSM	FCDAFNIPLITFVDVPGFLPGTAQEYGGIIR	2005	sp|P05166|PCCB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	2-UNIMOD:4	ms_run[1]:scan=1.1.1280.6	34.31772	4	3427.703694	3426.732236	R	H	380	411
PSM	GIDQCIPLFVQLVLER	2006	sp|O15397|IPO8_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	5-UNIMOD:4	ms_run[1]:scan=1.1.82.2	2.156583	3	1900.006571	1899.028805	R	L	753	769
PSM	QAFLDELESSDLPVALLLAQHK	2007	sp|P51948|MAT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.258.6	6.898633	3	2420.2592	2419.2632	K	D	181	203
PSM	NQSVFNFCAIPQVMAIATLAACYNNQQVFK	2008	sp|P37268|FDFT_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	8-UNIMOD:4,22-UNIMOD:4	ms_run[1]:scan=1.1.942.9	25.24123	4	3447.634494	3446.657374	R	G	282	312
PSM	CGFSLALGALPGFLLK	2009	sp|Q9BTW9|TBCD_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.984.7	26.36828	2	1645.8782	1645.8892	R	G	773	789
PSM	FAPQFSGYQQQDCQELLAFLLDGLHEDLNR	2010	sp|Q9Y4E8|UBP15_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4	ms_run[1]:scan=1.1.427.7	11.46237	4	3552.666094	3551.677969	R	I	369	399
PSM	AVWIQAQQLQGEALHQMQALYGQHFPIEVR	2011	sp|P51692|STA5B_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:1	ms_run[1]:scan=1.1.233.7	6.217	4	3530.7582	3530.7872	M	H	2	32
PSM	QVINNACATQAIVSVLLNCTHQDVHLGETLSEFK	2012	sp|Q9Y5K5|UCHL5_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28,7-UNIMOD:4,19-UNIMOD:4	ms_run[1]:scan=1.1.97.10	2.576183	4	3791.8342	3791.8602	K	E	82	116
PSM	DSCEPVMQFFGFYWPEMLK	2013	sp|Q8N474|SFRP1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	3-UNIMOD:4	ms_run[1]:scan=1.1.1033.4	27.69475	3	2411.035871	2410.047234	R	C	138	157
PSM	QLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALK	2014	sp|P33991|MCM4_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28,15-UNIMOD:35	ms_run[1]:scan=1.1.740.6	19.86765	5	5119.5731	5119.5788	R	T	225	268
PSM	QQQEGLSHLISIIKDDLEDIK	2015	sp|Q7Z3B4|NUP54_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:28	ms_run[1]:scan=1.1.535.4	14.32457	3	2404.2372	2404.2482	K	L	469	490
PSM	EVFDSAILSAIEHK	2016	sp|Q96L33|RHOV_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	17	1-UNIMOD:27	ms_run[1]:scan=1.1.1554.6	41.61049	2	1541.7982	1539.7932	K	A	196	210
PSM	TATYNGPPASPSLSHEATPLSQTR	2017	sp|P27448|MARK3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.68.11	1.7936	3	2485.266071	2482.208831	R	S	574	598
PSM	LLAVEACVNIAQLLPQEDLEALVMPTLR	2018	sp|P30153|2AAA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	7-UNIMOD:4	ms_run[1]:scan=1.1.274.7	7.323933	4	3117.653694	3118.677029	R	Q	222	250
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	2019	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.483.4	12.93143	5	3586.667618	3585.694213	R	R	85	117
PSM	DVPFSVVYFPLFANLNQLGR	2020	sp|Q9H936|GHC1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.728.4	19.53455	3	2295.189971	2295.205189	R	P	197	217
PSM	ALDLFSDNAPPPELLEIINEDIAK	2021	sp|Q15084|PDIA6_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17		ms_run[1]:scan=1.1.1026.4	27.51193	3	2637.345071	2636.358515	R	R	265	289
PSM	VSSDFLDLIQSLLCGQK	2022	sp|O14578|CTRO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	17	14-UNIMOD:4	ms_run[1]:scan=1.1.1335.2	35.76263	3	1920.956771	1921.981914	K	E	330	347
PSM	ITLNDLIPAFQNLLK	2023	sp|P30154-2|2AAB_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.6.2	0.1144	3	1711.9792	1711.9872	K	D	290	305
PSM	QTAQDWPATSLNCIAILFLR	2024	sp|Q96EY7|PTCD3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	16	13-UNIMOD:4	ms_run[1]:scan=1.1.28.3	0.69915	4	2317.1732941913206	2317.1888872601094	R	A	566	586
PSM	QANWLSVSNIIQLGGTIIGSAR	2025	sp|P17858-2|PFKAL_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.227.4	6.050933	3	2297.2351	2297.2492	K	C	114	136
PSM	SGETEDTFIADLVVGLCTGQIK	2026	sp|P06733-2|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	17-UNIMOD:4	ms_run[1]:scan=1.1.425.4	11.40103	3	2352.1498	2352.1519	R	T	280	302
PSM	ILDNGEWTPTLQHYLSYTEESLLPVMQHLAK	2027	sp|P14635|CCNB1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1000663, ProteinPilot, ]	16		ms_run[1]:scan=1.1.5.9	0.1039667	4	3625.7940941913203	3625.8126702516397	K	N	355	386
PSM	MGSENLNEQLEEFLANIGTSVQNVR	2028	sp|Q9UKG1|DP13A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.79.7	2.087183	3	2791.3351	2791.3446	K	R	213	238
PSM	GDVTFLEDVLNEIQLR	2029	sp|Q5T160|SYRM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.124.2	3.291917	3	1859.9473	1859.9629	R	M	388	404
PSM	YALQMEQLNGILLHLESELAQTR	2030	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.277.3	7.398	4	2669.3521	2669.3846	R	A	331	354
PSM	YALQMEQLNGILLHLESELAQTR	2031	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	5-UNIMOD:35	ms_run[1]:scan=1.1.215.4	5.729434	4	2685.3521	2685.3795	R	A	331	354
PSM	SLTGVVNAQALTSAFSPHTKPWIGLAEALGTLMR	2032	sp|O43175|SERA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.360.2	9.633933	5	3536.8511	3536.8813	K	A	311	345
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	2033	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.393.4	10.53122	5	3585.6706	3585.6942	R	R	85	117
PSM	TVQDLTSVVQTLLQQMQDK	2034	sp|O75506|HSBP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.382.4	10.23933	3	2174.1091	2174.1253	K	F	8	27
PSM	EQLPESAYMHQLLGLNLLFLLSQNR	2035	sp|P48556|PSMD8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.122.8	3.24755	4	2926.5133	2926.5374	K	V	180	205
PSM	FTVAMSPELIQQFLQATVSGLHETQPPSVR	2036	sp|Q96P70|IPO9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.450.8	12.08028	4	3310.6769	3310.7020	R	I	505	535
PSM	KASFEEASNQLINHIEQFLDTNETPYFMK	2037	sp|P13010|XRCC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.135.5	3.595083	4	3443.6137	3443.6343	K	S	606	635
PSM	LAATTFISQGIPVYLFSDITPTPFVPFTVSHLK	2038	sp|Q96G03|PGM2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.118.8	3.144217	4	3606.9105	3606.9378	R	L	123	156
PSM	NAFGLHLIDFMSEILK	2039	sp|Q15003|CND2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.292.3	7.801434	3	1846.9516	1846.9651	K	Q	127	143
PSM	ERPPNPIEFLASYLLK	2040	sp|Q9C005|DPY30_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.142.2	3.779467	3	1886.0173	1886.0301	K	N	75	91
PSM	AIQIDTWLQVIPQLIAR	2041	sp|P42345|MTOR_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.107.3	2.832867	3	1977.1264	1977.1411	K	I	1929	1946
PSM	STTTAEDIEQFLLNYLK	2042	sp|O43156|TTI1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.378.2	10.121	3	1984.9840	1984.9993	K	E	802	819
PSM	DILATTPPPVQPPILTITCPTFGDWAQLAPAVPGLQGALR	2043	sp|Q66K74-2|MAP1S_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	19-UNIMOD:4	ms_run[1]:scan=1.1.133.11	3.550867	4	4192.2189	4192.2395	R	L	125	165
PSM	VEVECSSLQEAVQAAEAGADLVLLDNFKPEELHPTATVLK	2044	sp|Q15274|NADC_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	5-UNIMOD:4	ms_run[1]:scan=1.1.106.11	2.81935	4	4320.1537	4320.1835	K	A	198	238
PSM	DQAVENILVSPVVVASSLGLVSLGGK	2045	sp|P50454|SERPH_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.353.7	9.45995	3	2550.4099	2550.4269	K	A	61	87
PSM	YDVPSNAELWQVSWQPFLDGIFPAK	2046	sp|Q9BY44-2|EIF2A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.297.5	7.939417	4	2906.4161	2906.4279	K	T	186	211
PSM	EAGLNVTTSHSPAAPGEQGFGECLLAVALAGAPYQAVGLVQGTTPVLQGLNGAVFRPEVPLRR	2047	sp|O43175|SERA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	23-UNIMOD:4	ms_run[1]:scan=1.1.183.9	4.901233	6	6408.3043	6408.3441	K	D	399	462
PSM	VATGKLPINHQIIYQLQDVFNLLPDVSLQEFVK	2048	sp|P51665|PSMD7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.414.4	11.09938	5	3779.0416	3779.0662	K	A	215	248
PSM	LEQVSSDEGIGTLAENLLEALR	2049	sp|Q5T4S7-2|UBR4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.777.3	20.83867	3	2356.1788	2356.2121	K	E	4751	4773
PSM	VGQTAFDVADEDILGYLEELQK	2050	sp|O14974-2|MYPT1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.488.4	13.07177	3	2452.1992	2452.2009	K	K	264	286
PSM	LQADDFLQDYTLLINILHSEDLGK	2051	sp|Q9UBT2-2|SAE2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.913.8	24.45933	3	2773.3942	2773.4174	R	D	421	445
PSM	NMITGTSQADCAVLIVAAGVGEFEAGISK	2052	sp|Q5VTE0|EF1A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	11-UNIMOD:4	ms_run[1]:scan=1.1.774.8	20.7644	3	2908.4140	2908.4310	K	N	101	130
PSM	IFSAEIIYHLFDAFTK	2053	sp|O60841|IF2P_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.477.3	12.7658	3	1913.9800	1913.9927	R	Y	1056	1072
PSM	DDAVPNLIQLITNSVEMHAYTVQR	2054	sp|O43747-2|AP1G1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.612.3	16.3995	4	2726.3497	2726.3698	R	L	438	462
PSM	NSTIVFPLPIDMLQGIIGAK	2055	sp|P27105-2|STOM_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.792.3	21.24162	3	2126.1682	2126.1809	K	H	99	119
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	2056	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.797.5	21.38042	4	2843.4009	2843.4164	R	N	766	791
PSM	VLETPQEIHTVSSEAVSLLEEVITPR	2057	sp|Q9H0A0-2|NAT10_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.692.2	18.55993	4	2875.5021	2875.5179	K	K	591	617
PSM	TGPAATTLPDGAAAESLVESSEVAVIGFFK	2058	sp|P07237|PDIA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.819.5	21.98213	4	2934.4669	2934.4862	R	D	133	163
PSM	NLFDNLIEFLQK	2059	sp|Q9UBD5-2|ORC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.662.4	17.75735	2	1492.7838	1492.7926	K	S	68	80
PSM	NGFLNLALPFFGFSEPLAAPR	2060	sp|P22314-2|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.654.6	17.53712	3	2277.1801	2277.1946	K	H	884	905
PSM	IVTVNSILGIISVPLSIGYCASK	2061	sp|Q9Y394-2|DHRS7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	20-UNIMOD:4	ms_run[1]:scan=1.1.690.9	18.51748	3	2403.3283	2403.3447	K	H	135	158
PSM	AELATEEFLPVTPILEGFVILR	2062	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.925.4	24.77422	3	2456.3395	2456.3566	R	K	721	743
PSM	TPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVR	2063	sp|O43347|MSI1H_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.723.8	19.4063	4	3270.7837	3270.8050	R	G	251	285
PSM	FYCLPDNYEIIDSSLEDITYVLKPTFTK	2064	sp|Q53GS9-2|SNUT2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	3-UNIMOD:4	ms_run[1]:scan=1.1.796.2	21.34977	4	3383.6297	3383.6523	K	Q	69	97
PSM	IASITDHLIAMLADYFK	2065	sp|Q8IUR7-2|ARMC8_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1000.3	26.7948	3	1920.9901	1921.0019	R	Y	303	320
PSM	EATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK	2066	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.582.7	15.59915	4	3865.9929	3866.0149	K	A	354	389
PSM	FNPSVFFLDFLVVPPSR	2067	sp|O95602|RPA1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.921.2	24.66317	3	1980.0388	1980.0509	R	Y	292	309
PSM	NIVSLLLSMLGHDEDNTR	2068	sp|Q92616|GCN1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.908.3	24.3211	3	2026.0009	2026.0153	K	I	2426	2444
PSM	FYPEDVAEELIQDITQK	2069	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.900.3	24.09878	3	2036.9827	2036.9942	K	L	84	101
PSM	FYPEDVAEELIQDITQK	2070	sp|P15311|EZRI_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.957.3	25.63792	3	2036.9860	2036.9942	K	L	84	101
PSM	IDLLQAFSQLICTCNSLK	2071	sp|Q9NVH2-2|INT7_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	12-UNIMOD:4,14-UNIMOD:4	ms_run[1]:scan=1.1.497.6	13.31213	3	2123.0620	2123.0755	R	T	625	643
PSM	VDQGTLFELILAANYLDIK	2072	sp|P63208-2|SKP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.589.6	15.78327	3	2135.1337	2135.1514	K	G	95	114
PSM	SIFWELQDIIPFGNNPIFR	2073	sp|Q15392-2|DHC24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.867.7	23.2178	3	2305.1722	2305.1895	R	Y	293	312
PSM	FSGNFLVNLLGQWADVSGGGPAR	2074	sp|Q9H9S3-2|S61A2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.765.6	20.53493	3	2361.1717	2361.1866	R	S	312	335
PSM	SSELEESLLVLPFSYVPDILK	2075	sp|Q9UNX4|WDR3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.778.5	20.86572	3	2377.2535	2377.2668	K	L	817	838
PSM	SDIANILDWMLNQDFTTAYR	2076	sp|P40937-2|RFC5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.981.4	26.28237	3	2386.1131	2386.1263	K	N	224	244
PSM	EQSDFCPWYTGLPFIPYLDNLPNFNR	2077	sp|Q8IYD1|ERF3B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.581.11	15.57557	3	3202.4662	3202.4859	K	S	400	426
PSM	NPALEAFLAQFSQLEDKFPGQSSFLWQR	2078	sp|Q8NFQ8|TOIP2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.482.7	12.90782	4	3253.6033	3253.6196	K	G	249	277
PSM	FQSSAVMALQEASEAYLVGLFEDTNLCAIHAK	2079	sp|Q71DI3|H32_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	27-UNIMOD:4	ms_run[1]:scan=1.1.581.4	15.5639	5	3512.6681	3512.6956	R	R	85	117
PSM	AAGELGIAVCNIPSAAVEETADSTICHILNLYR	2080	sp|P56545-2|CTBP2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	10-UNIMOD:4,26-UNIMOD:4	ms_run[1]:scan=1.1.514.6	13.7809	3	3527.7142	3527.7388	K	R	655	688
PSM	EATWTMSNITAGRQDQIQQVVNHGLVPFLVSVLSK	2081	sp|P52292|IMA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.566.6	15.16135	5	3865.9931	3866.0149	K	A	354	389
PSM	TSSAEYNVNNLVSPVLFQEALWHVPEHAVVLEIAPHALLQAVLK	2082	sp|P49327|FAS_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.968.9	25.9408	5	4845.5596	4845.5857	R	R	729	773
PSM	AVFVDLEPTVIDEVR	2083	sp|Q71U36-2|TBA1A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1539.2	41.18607	3	1700.8909	1700.8985	R	T	30	45
PSM	FDQLFDDESDPFEVLK	2084	sp|Q8NC51-2|PAIRB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1007.3	26.98412	3	1942.8799	1942.8837	R	A	17	33
PSM	AAFDDAIAELDTLSEESYK	2085	sp|P62258-2|1433E_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1487.4	39.7673	3	2086.9564	2086.9582	K	D	175	194
PSM	EGLELPEDEEEK	2086	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1181.2	31.69953	2	1415.6270	1415.6303	K	K	539	551
PSM	AELATEEFLPVTPILEGFVILR	2087	sp|Q13200-2|PSMD2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1032.6	27.67097	3	2456.3377	2456.3566	R	K	721	743
PSM	DNYVPEVSALDQEIIEVDPDTK	2088	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1203.3	32.28322	3	2488.2151	2488.1857	R	E	82	104
PSM	VSSDFLDLIQSLLCGQK	2089	sp|O14578-2|CTRO_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	14-UNIMOD:4	ms_run[1]:scan=1.1.1337.2	35.8167	2	1921.9650	1921.9819	K	E	330	347
PSM	DGADIHSDLFISIAQALLGGTAR	2090	sp|Q96EY1-2|DNJA3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1118.3	29.98335	4	2340.1933	2340.2074	R	A	342	365
PSM	NLGNSCYLNSVVQVLFSIPDFQR	2091	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.1168.2	31.33513	4	2669.3113	2669.3272	R	K	330	353
PSM	QSGAFLSTSEGLILQLVGDAVHPQFK	2092	sp|Q96AB3-2|ISOC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1192.2	31.98315	4	2741.4241	2741.4388	R	E	169	195
PSM	FDTLCDLYDTLTITQAVIFCNTK	2093	sp|P38919|IF4A3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	5-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.1535.4	41.07947	4	2751.2993	2751.3136	K	R	265	288
PSM	EGLELPEDEEEK	2094	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1263.2	33.86878	2	1415.6208	1415.6303	K	K	539	551
PSM	NQLEIQNLQEDWDHFEPLLSSLLR	2095	sp|Q8NCN5|PDPR_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1094.5	29.34008	4	2936.4561	2936.4668	K	R	318	342
PSM	QVQELIINKDPTLLDNFLDEIIAFQADK	2096	sp|Q92797|SYMPK_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1232.7	33.06885	4	3242.6849	3242.7074	K	S	57	85
PSM	QGLLGAPPAMPLLNGPALSTALLQLALQTQGQK	2097	sp|Q8IY67-2|RAVR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1305.7	34.96552	4	3309.8253	3309.8482	K	K	359	392
PSM	GGEEPLPEGLFWLLVTGHIPTEEQVSWLSK	2098	sp|O75390|CISY_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1458.7	38.98195	4	3347.6897	3347.7078	K	E	110	140
PSM	EYIFVSNIDNLGATVDLYILNHLMNPPNGK	2099	sp|Q16851-2|UGPA_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1514.7	40.50932	4	3373.6833	3373.7016	K	R	234	264
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	2100	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1334.5	35.7395	4	3503.9193	3503.9392	K	S	754	787
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	2101	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.1198.5	32.14865	4	3585.6673	3585.6942	R	R	85	117
PSM	AQDGFTQWCEQMLHALNTANNLDVPTFVSFLK	2102	sp|Q6Y7W6-3|GGYF2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	9-UNIMOD:4	ms_run[1]:scan=1.1.1163.10	31.21198	4	3694.7385	3694.7549	K	E	1152	1184
PSM	TMPNILDDIIASVVENK	2103	sp|Q15652-3|JHD2C_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1102.2	29.55208	3	1870.9558	1870.9710	R	I	1922	1939
PSM	QALNLPDVFGLVVLPLELK	2104	sp|Q9Y3I1-2|FBX7_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1144.2	30.68463	3	2077.2064	2077.2187	R	L	243	262
PSM	DNYVPEVSALDQEIIEVDPDTK	2105	sp|P08708|RS17_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1543.5	41.30172	3	2488.1851	2488.1857	R	E	82	104
PSM	AQGLPWSCTMEDVLNFFSDCR	2106	sp|Q12849|GRSF1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	8-UNIMOD:4,20-UNIMOD:4	ms_run[1]:scan=1.1.1466.10	39.20583	3	2532.0766	2532.0872	R	I	154	175
PSM	LCYVALDFEQEMATAASSSSLEK	2107	sp|P60709|ACTB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	2-UNIMOD:4	ms_run[1]:scan=1.1.1216.5	32.63382	3	2549.1493	2549.1665	K	S	216	239
PSM	NLGNSCYLNSVVQVLFSIPDFQR	2108	sp|P45974-2|UBP5_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	6-UNIMOD:4	ms_run[1]:scan=1.1.1207.5	32.3975	3	2669.3122	2669.3272	R	K	330	353
PSM	QSGAFLSTSEGLILQLVGDAVHPQFK	2109	sp|Q96AB3-2|ISOC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1198.7	32.15532	3	2741.4217	2741.4388	R	E	169	195
PSM	GVQPLLDAVLEYLPNPSEVQNYAILNK	2110	sp|Q96RP9-2|EFGM_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1137.10	30.51002	3	2996.5681	2996.5858	K	E	324	351
PSM	DSNTILLPSNPGDVTSMVAQAMGVYGALTK	2111	sp|Q9UJZ1-2|STML2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1229.7	32.99472	3	3049.4902	3049.5100	K	A	247	277
PSM	AISCMGQIICNLGDNLGSDLPNTLQIFLER	2112	sp|Q86VP6|CAND1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	4-UNIMOD:4,10-UNIMOD:4	ms_run[1]:scan=1.1.1461.10	39.06925	4	3361.6301	3361.6469	R	L	589	619
PSM	SYEAVAAAAASVYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDR	2113	sp|Q9BWF3|RBM4_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1477.8	39.50158	6	4832.2573	4832.2875	R	H	230	275
PSM	LGSIFGLGLAYAGSNREDVLTLLLPVMGDSK	2114	sp|Q13200-2|PSMD2_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.514.4	13.77423	4	3205.6825	3205.7057	R	S	320	351
PSM	SLDPSNLEHLITPLVTIGHIALLAPDQFAAPLK	2115	sp|Q9NTI5-2|PDS5B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1325.3	35.49503	5	3503.9166	3503.9392	K	S	754	787
PSM	GDLENAFLNLVQCIQNKPLYFADR	2116	sp|P07355-2|ANXA2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	13-UNIMOD:4	ms_run[1]:scan=1.1.77.2	2.02165	5	2837.3946	2837.4170	K	L	268	292
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	2117	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.186.4	4.9695	5	3585.6736	3585.6942	R	R	85	117
PSM	FQSAAIGALQEASEAYLVGLFEDTNLCAIHAK	2118	sp|P84243|H33_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	27-UNIMOD:4	ms_run[1]:scan=1.1.814.6	21.84707	4	3436.6733	3436.6973	R	R	85	117
PSM	AMTTGAIAAMLSTILYSR	2119	sp|P20618|PSB1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	2-UNIMOD:35,10-UNIMOD:35	ms_run[1]:scan=1.1.162.2	4.321317	3	1901.9452	1901.9590	K	R	110	128
PSM	VAVSADPNVPNVVVTGLTLVCSSAPGPLELDLTGDLESFKK	2120	sp|P52565-2|GDIR1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	21-UNIMOD:4	ms_run[1]:scan=1.1.203.4	5.411267	6	4208.1721	4208.1927	R	Q	59	100
PSM	YLDLSHNNLTFLPADIGLLQNLQNLAITANR	2121	sp|Q8IWT6|LRC8A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.268.5	7.16905	4	3464.8161	3464.8416	R	I	689	720
PSM	TLSSSTQASLEIDSLFEGIDFYTSITR	2122	sp|P0DMV8-2|HS71A_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.751.8	20.16797	3	2980.4956	2980.4553	R	A	218	245
PSM	KAQNIMESFENPFR	2123	sp|Q01780-2|EXOSX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	6-UNIMOD:35	ms_run[1]:scan=1.1.1493.11	39.94218	2	1725.8178	1725.8144	K	M	680	694
PSM	RSEAPVLPDVCLGLGSPSPGPR	2124	sp|Q99687-2|MEIS3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	11-UNIMOD:4	ms_run[1]:scan=1.1.961.5	25.74592	3	2260.2067	2260.1634	R	W	288	310
PSM	AQVMLELKTR	2125	sp|Q96MR6|CFA57_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	4-UNIMOD:35	ms_run[1]:scan=1.1.242.2	6.454683	2	1203.6448	1203.6645	K	V	698	708
PSM	QLSSELGDLEKHSSLPALK	2126	sp|Q99801-2|NKX31_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16		ms_run[1]:scan=1.1.1562.5	41.8339	3	2051.0635	2051.0898	K	E	134	153
PSM	QEILTALDRDASCR	2127	sp|P51805|PLXA3_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001207, Mascot, ]	16	13-UNIMOD:4	ms_run[1]:scan=1.1.1555.5	41.6375	2	1646.8276	1646.8046	R	K	1839	1853
PSM	CLELFSELAEDK	2128	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.737.4	19.77832	2	1436.6462	1435.6532	K	E	412	424
PSM	CLELFSELAEDK	2129	sp|P08238|HS90B_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.827.3	22.18702	2	1436.6452	1435.6532	K	E	412	424
PSM	DQQEAALVDMVNDGVEDLR	2130	sp|P09211|GSTP1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1455.4	38.89463	3	2116.969271	2115.974263	K	C	83	102
PSM	CLELFTELAEDK	2131	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.1575.3	42.18475	2	1449.6592	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	2132	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.684.5	18.34828	2	1449.6592	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	2133	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.476.3	12.7387	2	1449.6647	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	2134	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.942.3	25.23123	2	1449.6615	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	2135	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.999.3	26.76768	2	1450.6602	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	2136	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.652.5	17.48123	2	1449.6582	1449.6692	K	E	420	432
PSM	CLELFTELAEDK	2137	sp|P07900|HS90A_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.728.2	19.53122	2	1449.6605	1449.6692	K	E	420	432
PSM	EKMTQIMFEAFNTPAMYVAIQAVLSLYASGR	2138	sp|Q562R1|ACTBL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:35,7-UNIMOD:35,16-UNIMOD:35	ms_run[1]:scan=1.1.1062.3	28.472	5	3529.667118	3527.713886	R	T	118	149
PSM	SNDPQMVAENFVPPLLDAVLIDYQR	2139	sp|O14980|XPO1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.669.3	17.93875	4	2844.391694	2843.416381	R	N	766	791
PSM	CSAAALDVLANVYRDELLPHILPLLK	2140	sp|Q92973|TNPO1_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	1-UNIMOD:4	ms_run[1]:scan=1.1.677.5	18.15902	4	2904.574094	2903.594286	K	E	386	412
PSM	CLQQALHTFQNDIHVYPIWLCPFILPSQPGLVHPK	2141	sp|Q15392|DHC24_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4,21-UNIMOD:4	ms_run[1]:scan=1.1.1384.5	37.03858	5	4149.0842	4149.1112	K	G	393	428
PSM	FQSSAVMALQEACEAYLVGLFEDTNLCAIHAK	2142	sp|P68431|H31_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	7-UNIMOD:35,13-UNIMOD:4,27-UNIMOD:4	ms_run[1]:scan=1.1.419.4	11.24468	4	3602.662494	3601.689128	R	R	85	117
PSM	YALQMEQLNGILLHLESELAQTR	2143	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.748.6	20.08397	3	2670.351671	2669.384687	R	A	331	354
PSM	YALQMEQLNGILLHLESELAQTR	2144	sp|P05783|K1C18_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.750.2	20.12605	4	2670.358894	2669.384687	R	A	331	354
PSM	VNPTVFFDIAVDGEPLGR	2145	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.72.5	1.891567	3	1986.9902	1987.0042	M	V	2	20
PSM	VNPTVFFDIAVDGEPLGR	2146	sp|P62937|PPIA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:1	ms_run[1]:scan=1.1.73.3	1.915233	3	1986.9902	1987.0042	M	V	2	20
PSM	FGAQLAHIQALISGIEAQLGDVR	2147	sp|P08727|K1C19_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.294.6	7.8686	3	2407.284671	2406.301943	R	A	331	354
PSM	QSGAFLSTSEGLILQLVGDAVHPQFK	2148	sp|Q96AB3|ISOC2_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1239.7	33.2642	3	2742.419771	2741.438831	R	E	153	179
PSM	NLSDLIDLVPSLCEDLLSSVDQPLK	2149	sp|P47756|CAPZB_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	13-UNIMOD:4	ms_run[1]:scan=1.1.1563.4	41.85988	4	2783.416094	2782.431028	K	I	24	49
PSM	CDPAPFYLFDEIDQALDAQHR	2150	sp|Q9UQE7|SMC3_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:385,1-UNIMOD:4	ms_run[1]:scan=1.1.825.6	22.1389	3	2503.0982	2503.1112	K	K	1134	1155
PSM	QAFQGDSIPVFDLLILGVGPDGHTCSLFPDHPLLQER	2151	sp|O95336|6PGL_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1001476, X!Tandem, ]	16	1-UNIMOD:28,25-UNIMOD:4	ms_run[1]:scan=1.1.894.4	23.94545	4	4071.9902	4071.0192	R	E	132	169
PSM	ILCQDNPSHNVFCSPVSISSALAMVLLGAK	2152	sp|P50453|SPB9_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	3-UNIMOD:4,13-UNIMOD:4	ms_run[1]:scan=1.1.160.3	4.268983	5	3226.591118	3227.614112	K	G	18	48
PSM	SGETEDTFIADLVVGLCTGQIK	2153	sp|P06733|ENOA_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16	17-UNIMOD:4	ms_run[1]:scan=1.1.221.9	5.898417	3	2353.155071	2352.151893	R	T	373	395
PSM	NLATAYDNFVELVANLK	2154	sp|Q8WUM4|PDC6I_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.227.9	6.0626	2	1892.943447	1893.983629	K	E	655	672
PSM	IYDDDFFQNLDGVANALDNVDAR	2155	sp|P22314|UBA1_HUMAN	0	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1501.11	40.16085	3	2600.173871	2599.182676	R	M	559	582
PSM	LEGDSTDLSDQIAELQAQIAELK	2156	sp|P35579|MYH9_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1510.6	40.39822	3	2485.250171	2486.238794	K	M	1053	1076
PSM	GHYAERVGAGAPVYLAAVLEYLTAEILELAGNAAR	2157	sp|P16104|H2AX_HUMAN	1	userFasta.sprot_human_mix_20181121	userFasta.sprot_human_mix_20181121	[MS, MS:1002251, Comet, ]	16		ms_run[1]:scan=1.1.1583.10	42.4116	3	3628.850171	3627.904932	K	D	38	73