Accession number	Protein names	Entry name	Gene names	Organism	Taxonomic lineage (ALL)	Gene ontology (biological process)	Gene ontology (cellular component)	Gene ontology (molecular function)	Sequence	Q-value	Intensity 1_RD1_01_26986	Intensity 1_RD1_01_26987	Intensity 1_RD1_01_26988	Intensity 2_RD2_01_26990	Intensity 2_RD2_01_26991	Intensity 2_RD2_01_26992	Intensity 3_RD3_01_26994	Intensity 3_RD3_01_26995	Intensity 3_RD3_01_26996	Intensity 4_RD4_01_26998	Intensity 4_RD4_01_26999	Intensity 4_RD4_01_27000	Intensity 5_RD5_01_27002	Intensity 5_RD5_01_27003	Intensity 5_RD5_01_27004	Intensity 6_RD6_01_27006	Intensity 6_RD6_01_27007	Intensity 6_RD6_01_27008	Intensity 7_RD7_01_27010	Intensity 7_RD7_01_27011	Intensity 7_RD7_01_27012	Intensity 8_RD8_01_27014	Intensity 8_RD8_01_27015	Intensity 8_RD8_01_27016	Intensity 9_RE1_01_27018	Intensity 9_RE1_01_27019	Intensity 9_RE1_01_27020	Intensity 10_RE2_01_27022	Intensity 10_RE2_01_27023	Intensity 10_RE2_01_27024	Intensity 11_RE3_01_27026	Intensity 11_RE3_01_27027	Intensity 11_RE3_01_27028	Intensity 12_RE4_01_27030	Intensity 12_RE4_01_27031	Intensity 12_RE4_01_27032	Intensity 13_RE5_01_27035	Intensity 13_RE5_01_27036	Intensity 13_RE5_01_27037	Intensity 14_RE6_01_27039	Intensity 14_RE6_01_27040	Intensity 14_RE6_01_27041	Intensity 15_RE7_01_27043	Intensity 15_RE7_01_27044	Intensity 15_RE7_01_27045	Intensity 16_RE8_01_27047	Intensity 16_RE8_01_27048	Intensity 16_RE8_01_27049	Intensity 17_BA1_01_27051	Intensity 17_BA1_01_27052	Intensity 17_BA1_01_27053	Intensity 18_BA2_01_27055	Intensity 18_BA2_01_27056	Intensity 18_BA2_01_27057	Intensity 19_BA3_01_27059	Intensity 19_BA3_01_27060	Intensity 19_BA3_01_27061	Intensity 20_BA4_01_27063	Intensity 20_BA4_01_27064	Intensity 20_BA4_01_27065	Intensity 21_BA5_01_27067	Intensity 21_BA5_01_27068	Intensity 21_BA5_01_27069	Intensity 22_BA6_01_27071	Intensity 22_BA6_01_27072	Intensity 22_BA6_01_27073	1	2	3	4	5	6	7	8	9	10	11	12	13	14	15	16	17	18	19	20	21	22
A0A1G5VTW4	CRISPR-associated endonuclease Cas9 (EC 3.1.-.-)	A0A1G5VTW4_9FIRM	cas9 SAMN02910343_00868	Allisonella histaminiformans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Allisonella, Allisonella histaminiformans"	 maintenance of CRISPR repeat elements [GO:0043571];defense response to virus [GO:0051607]		 endonuclease activity [GO:0004519]; metal ion binding [GO:0046872]; RNA binding [GO:0003723];DNA binding [GO:0003677]	LGWRGKYR	0.95111	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6422.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6422.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1G5WMY4	Putative ATP-binding cassette transporter	A0A1G5WMY4_9FIRM	SAMN02910343_01439	Allisonella histaminiformans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Allisonella, Allisonella histaminiformans"		integral component of membrane [GO:0016021]	 ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626];ATPase activity [GO:0016887]	IQDPNDRGGGSFAER	0.95462	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	84530	91742	48420	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	56458	0	0	0	0	0	0	0	0	0	0	162240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	91742	0	0	0	0	0	0	0	0	56458	0	0	0	162240	0	0	0
G9YER3	Uncharacterized protein	G9YER3_9FIRM	HMPREF0080_00123	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"				EPDAIAR	0.95388	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12071	28594	14659	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28594	0	0
G9YEV5	Organophosphate reductase family protein	G9YEV5_9FIRM	HMPREF0080_00165	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"			oxidoreductase activity [GO:0016491]	QLANSMR	0.95075	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50261	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50261	0	0	0	0	0	0	0	0	0	0	0	0	0
G9YEW7	Cytidylyltransferase	G9YEW7_9FIRM	HMPREF0080_00176	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"	biosynthetic process [GO:0009058]		nucleotidyltransferase activity [GO:0016779]	EPELQLIR	1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25726	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25726	0	0	0	0	0	0	0	0	0	0	0	0
G9YFI0	"ABC transporter, ATP-binding protein"	G9YFI0_9FIRM	HMPREF0080_00392	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"		integral component of membrane [GO:0016021]	 ATP binding [GO:0005524];ATPase activity [GO:0016887]	DVAAEASLWTHPRPFGK	0.9524	0	0	0	0	0	434040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	434040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
G9YG82	Radical SAM protein family	G9YG82_9FIRM	HMPREF0080_00646	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"			 iron-sulfur cluster binding [GO:0051536];catalytic activity [GO:0003824]	CGQWTHHLALESDIMRDR	0.95027	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23609	133550	13483	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	133550	13483	0	0	0	0	0	0	0	0	0	0	0	0
G9YG95	"RND transporter, HAE1/HME family, permease protein"	G9YG95_9FIRM	HMPREF0080_00659	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"		integral component of membrane [GO:0016021]	transmembrane transporter activity [GO:0022857]	RNLTEISLRNK	0.95522	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47365	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47365	0	0
G9YH11	DNA-directed RNA polymerase subunit beta' (RNAP subunit beta') (EC 2.7.7.6) (RNA polymerase subunit beta') (Transcriptase subunit beta')	G9YH11_9FIRM	rpoC HMPREF0080_00936	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"	"transcription, DNA-templated [GO:0006351]"		 DNA-directed 5'-3' RNA polymerase activity [GO:0003899]; magnesium ion binding [GO:0000287]; zinc ion binding [GO:0008270];DNA binding [GO:0003677]	IDQEAVAAFK	1	0	0	0	0	0	0	0	0	34682	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10516	0	0	0	0	7967	11989	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34682	0	0	0	0	0	0	0	0	0	10516	0	11989	0	0	0	0	0	0	0
G9YH26	Putative stage V sporulation protein B	G9YH26_9FIRM	HMPREF0080_00951	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"		integral component of membrane [GO:0016021]		FGFFPKK	0.95063	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15576	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15576	0	0	0	0	0	0	0	0	0	0	0	0	0	0
G9YH31	Uncharacterized protein	G9YH31_9FIRM	HMPREF0080_00956	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"				DECLRAER	0.95068	0	0	0	0	0	0	0	0	0	0	0	0	0	152030	0	0	0	0	0	51527	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	152030	0	51527	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
G9YHE9	Deoxyribose-phosphate aldolase (DERA) (EC 4.1.2.4) (2-deoxy-D-ribose 5-phosphate aldolase) (Phosphodeoxyriboaldolase) (Deoxyriboaldolase)	G9YHE9_9FIRM	deoC HMPREF0080_01080	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"	 deoxyribonucleotide catabolic process [GO:0009264]; deoxyribose phosphate catabolic process [GO:0046386];carbohydrate catabolic process [GO:0016052]	cytoplasm [GO:0005737]	deoxyribose-phosphate aldolase activity [GO:0004139]	PDATPADIVRLCDEAK	0.96452	0	0	0	0	0	0	0	0	1806200	290480	352970	0	0	0	0	0	111170	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7123.8	0	0	0	0	0	0	0	0	0	0	9453.8	0	0	0	0	0	40852	10131	0	15765	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1806200	352970	0	111170	0	0	0	0	7123.8	0	0	0	9453.8	0	40852	15765	0	0	0	0
G9YHM7	"Putative R-phenyllactate dehydratase, small subunit"	G9YHM7_9FIRM	HMPREF0080_01161	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"				HVPTFIQPR	0.97321	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32062	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32062
G9YJB2	"ABC transporter, ATP-binding protein"	G9YJB2_9FIRM	HMPREF0080_01757	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"			 ATP binding [GO:0005524]; ATPase-coupled amino acid transmembrane transporter activity [GO:0015424];ATPase activity [GO:0016887]	STFLRCFCELEKIDK	0.96	17470	0	14656	0	0	0	0	0	0	0	6811.3	0	0	17208	0	0	0	0	0	0	0	0	0	0	12853	0	22013	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17470	0	0	6811.3	17208	0	0	0	22013	0	0	0	0	0	0	0	0	0	0	0	0	0
G9YJH8	Uncharacterized protein	G9YJH8_9FIRM	HMPREF0080_01829	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"				VAGTIMVK	0.95532	0	0	0	0	0	0	55673	0	0	0	0	26801	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	55673	26801	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
G9YJL2	LICD family protein	G9YJL2_9FIRM	HMPREF0080_01865	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"				IVKMQYR	0.95471	0	5772.8	0	0	0	0	0	0	0	0	0	0	452330	0	12200	0	0	0	0	0	0	0	0	0	0	0	0	106980	148230	428030	0	0	0	0	11698	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31743	0	0	0	0	0	0	0	0	18147	0	0	0	0	5772.8	0	0	0	452330	0	0	0	0	428030	0	11698	0	0	0	0	0	31743	0	0	18147	0
G9YJW0	PDDEXK_1 domain-containing protein	G9YJW0_9FIRM	HMPREF0080_01966	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"				SNRFAGFYLSETDVAELLDK	0.95415	0	0	0	0	0	0	0	0	172690	0	13006	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	172690	13006	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
G9YKD2	"CRISPR-associated protein, Csm1 family"	G9YKD2_9FIRM	HMPREF0080_02142	Anaeroglobus geminatus F0357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Anaeroglobus, Anaeroglobus geminatus, Anaeroglobus geminatus F0357"				DDTGIER	0.95511	0	0	0	0	0	0	0	0	0	84545	0	0	0	0	0	70177	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	84545	0	70177	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R5SJB3	Uncharacterized protein	R5SJB3_9FIRM	BN540_00299	Dialister invisus CAG:218	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister invisus CAG:218"				DFNWTYPR	0.95738	0	0	0	0	0	0	166090	50979	50712	0	0	0	0	0	0	0	132000	98471	61003	248170	97120	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	272120	118900	635630	167580	67741	473190	69305	30567	0	201490	159080	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	166090	0	0	132000	248170	0	0	0	0	0	0	0	635630	473190	69305	201490	0	0	0	0
R5SJQ6	Voltage-gated chloride channel family protein	R5SJQ6_9FIRM	BN540_01582	Dialister invisus CAG:218	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister invisus CAG:218"	potassium ion transport [GO:0006813]	integral component of membrane [GO:0016021]	 voltage-gated chloride channel activity [GO:0005247];cation transmembrane transporter activity [GO:0008324]	IVWLRIFKWK	1.0588	0	0	3205.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1262900	1133500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	183910	0	0	0	1840200	547310	386660	0	0	0	0	4602.3	0	0	4376.1	0	3205.4	0	0	0	0	0	0	0	0	1262900	0	0	0	0	0	0	183910	0	1840200	0	4602.3	4376.1
R5SML5	Septum site-determining protein MinD	R5SML5_9FIRM	BN540_00598	Dialister invisus CAG:218	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister invisus CAG:218"				ENGVALK	0.95309	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2120.7	39428	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39428	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R5SUS6	Uncharacterized protein	R5SUS6_9FIRM	BN540_00697	Dialister invisus CAG:218	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister invisus CAG:218"		integral component of membrane [GO:0016021]		DNEFDLYGEKLVEQGWEIDK	0.9539	0	0	0	0	0	0	0	0	56806	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	56806	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R5T1M4	Uncharacterized protein	R5T1M4_9FIRM	BN540_01249	Dialister invisus CAG:218	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister invisus CAG:218"			catalytic activity [GO:0003824]	LDLDELVEDFNVFK	0.96461	0	0	0	0	0	0	0	0	0	0	0	416870	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25733	0	52208	9593.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25432	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	416870	0	0	0	0	0	25733	52208	0	0	0	0	0	25432	0	0	0	0	0
R5T1P4	Uncharacterized protein	R5T1P4_9FIRM	BN540_01266	Dialister invisus CAG:218	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister invisus CAG:218"				DTESSVTRTSETRQR	0.9507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25161	0	43977	11162	0	0	0	0	0	0	0	0	14130	30912	0	0	0	0	0	113610	30851	13518	0	9359.4	15441	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25161	43977	0	0	14130	30912	0	113610	15441	0	0	0	0
R5T597	ABC transporter periplasmic substrate-binding protein	R5T597_9FIRM	BN540_00449	Dialister invisus CAG:218	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister invisus CAG:218"	polyamine transport [GO:0015846]	periplasmic space [GO:0042597]	polyamine binding [GO:0019808]	EAAPAEKK	0.95154	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33369	0	0	0	0	0	0	0	0	0	0	123790	43477	52898	49722	7843.1	0	0	0	0	0	0	51561	0	0	0	0	0	0	0	0	0	0	0	0	8292.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33369	0	0	0	123790	49722	0	51561	0	0	0	0	8292.5	0	0	0	0
R5T7Z3	4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase (flavodoxin) (EC 1.17.7.3) (1-hydroxy-2-methyl-2-(E)-butenyl 4-diphosphate synthase)	R5T7Z3_9FIRM	ispG BN540_01029	Dialister invisus CAG:218	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister invisus CAG:218"	" terpenoid biosynthetic process [GO:0016114]"";""isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway [GO:0019288]"		" 4 iron, 4 sulfur cluster binding [GO:0051539]; iron ion binding [GO:0005506]"";""4-hydroxy-3-methylbut-2-en-1-yl diphosphate synthase activity [GO:0046429]"	GFLLGAK	0.95502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51141	0	0	0	0	0	0	0	0	0	0	0	0	0
R5TAN5	Uncharacterized protein	R5TAN5_9FIRM	BN540_00441	Dialister invisus CAG:218	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister invisus CAG:218"				FFRRDIALR	0.95246	0	0	0	0	0	0	0	256580	308610	0	0	0	0	0	0	0	0	19949	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	308610	0	0	19949	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
C9LP68	"Resolvase, N-terminal domain protein"	C9LP68_9FIRM	GCWU000321_01347	Dialister invisus DSM 15470	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister invisus, Dialister invisus DSM 15470"			 recombinase activity [GO:0000150];DNA binding [GO:0003677]	AANGAGRR	0.95197	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10021	0	4098.9	0	51964	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15812	16515	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10021	4098.9	51964	0	0	0	0	0	0	16515	0	0	0	0	0	0	0
C9LQV5	"Exonuclease SbcCD, C subunit"	C9LQV5_9FIRM	GCWU000321_01937	Dialister invisus DSM 15470	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister invisus, Dialister invisus DSM 15470"			exonuclease activity [GO:0004527]	AAGDVEKYKK	0.97959	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13307	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13307	0	0
F2BV96	GTP diphosphokinase (EC 2.7.6.5)	F2BV96_9FIRM	relA HMPREF9083_0113	Dialister micraerophilus DSM 19965	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister micraerophilus DSM 19965"	guanosine tetraphosphate metabolic process [GO:0015969]		 kinase activity [GO:0016301];GTP diphosphokinase activity [GO:0008728]	AEYYTESLKNNNEKCQNR	0.95023	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22502	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F2BWE4	DNA gyrase subunit A (EC 5.6.2.2)	F2BWE4_9FIRM	gyrA HMPREF9083_0511	Dialister micraerophilus DSM 19965	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister micraerophilus DSM 19965"	 DNA topological change [GO:0006265];DNA-dependent DNA replication [GO:0006261]	 cytoplasm [GO:0005737];chromosome [GO:0005694]	" DNA binding [GO:0003677]; DNA topoisomerase type II (double strand cut, ATP-hydrolyzing) activity [GO:0003918]"";""ATP binding [GO:0005524]"	FGDERRTQFEK	0.95026	0	0	0	6372.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33387	121620	0	10162	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6372.2	0	0	0	0	0	0	0	33387	121620	0	0	0	0	0	0	0	0	0	0	0
F2BWQ3	Uncharacterized protein	F2BWQ3_9FIRM	HMPREF9083_0632	Dialister micraerophilus DSM 19965	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister micraerophilus DSM 19965"	pathogenesis [GO:0009405]	 outer membrane [GO:0019867];integral component of membrane [GO:0016021]		DDTYIRITITEGK	0.98969	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3503.3	0	0	0	0	0	0	0	0	0	0	4117.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3503.3	0	0	0	4117.2	0	0	0	0	0	0
F2BWU3	Methyltransferase (EC 2.1.1.-)	F2BWU3_9FIRM	mod2 HMPREF9083_0661	Dialister micraerophilus DSM 19965	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister micraerophilus DSM 19965"	DNA methylation [GO:0006306]		 N-methyltransferase activity [GO:0008170];DNA binding [GO:0003677]	QVEYFRSTFKVDEESVR	0.9539	41080	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41080	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F2BWV7	1-deoxy-D-xylulose-5-phosphate synthase (EC 2.2.1.7)	F2BWV7_9FIRM	dxs HMPREF9083_0675	Dialister micraerophilus DSM 19965	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister micraerophilus DSM 19965"	 terpenoid biosynthetic process [GO:0016114]; thiamine biosynthetic process [GO:0009228];1-deoxy-D-xylulose 5-phosphate biosynthetic process [GO:0052865]		 metal ion binding [GO:0046872];1-deoxy-D-xylulose-5-phosphate synthase activity [GO:0008661]	IAQKVKEK	0.95373	0	0	37395	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37395	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F2BWX1	"Trk family K+ transporter, membrane protein"	F2BWX1_9FIRM	HMPREF9083_0689	Dialister micraerophilus DSM 19965	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister micraerophilus DSM 19965"		integral component of membrane [GO:0016021]	 potassium:chloride symporter activity [GO:0015379];metal ion binding [GO:0046872]	GVYSLIRYK	0.9685	0	19907	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31462	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19907	0	0	0	0	0	0	0	0	0	0	31462	0	0	0	0	0	0	0	0	0	0
F2BY20	"ABC superfamily ATP binding cassette transporter, ABC/membrane protein"	F2BY20_9FIRM	HMPREF9083_1088	Dialister micraerophilus DSM 19965	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister micraerophilus DSM 19965"		integral component of membrane [GO:0016021]	 ATP binding [GO:0005524]; ATPase-coupled transmembrane transporter activity [GO:0042626];ATPase activity [GO:0016887]	GEMVLIEDVKNIASR	0.95868	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8707.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8707.3	0	0	0
F2BY79	Dihydroorotate dehydrogenase (DHOD) (DHODase) (DHOdehase) (EC 1.3.-.-)	F2BY79_9FIRM	pyrD HMPREF9083_1147	Dialister micraerophilus DSM 19965	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister micraerophilus DSM 19965"	'de novo' UMP biosynthetic process [GO:0044205]	cytoplasm [GO:0005737]	dihydroorotate dehydrogenase activity [GO:0004152]	EEYGKVAR	0.9537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67068	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67068	0	0	0	0	0	0	0	0	0	0	0	0	0
F2BYF6	Protease HtpX homolog (EC 3.4.24.-)	F2BYF6_9FIRM	htpX HMPREF9083_1224	Dialister micraerophilus DSM 19965	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister micraerophilus DSM 19965"		 plasma membrane [GO:0005886];integral component of membrane [GO:0016021]	 zinc ion binding [GO:0008270];metalloendopeptidase activity [GO:0004222]	LDDYAHRR	0.9542	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57165	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22378	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57165	0	0	0	0	0	0	22378	0	0	0	0	0	0	0	0
E4L788	Uncharacterized protein	E4L788_9FIRM	HMPREF9220_1381	Dialister microaerophilus UPII 345-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister microaerophilus UPII 345-E"				DESYLFGMK	0.95428	49948	0	18490	0	37935	206470	0	0	0	0	0	0	0	0	0	10604	0	0	0	0	0	0	0	0	0	8469.6	24076	6677.3	2983.4	0	5267.6	0	5286.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6265.1	0	0	0	7863.9	4185.9	16976	0	13676	0	0	0	0	0	0	0	0	0	49948	206470	0	0	0	10604	0	0	24076	6677.3	5286.5	0	0	0	0	0	6265.1	7863.9	16976	0	0	0
E4L837	Ribosomal RNA small subunit methyltransferase I (EC 2.1.1.198) (16S rRNA 2'-O-ribose C1402 methyltransferase) (rRNA (cytidine-2'-O-)-methyltransferase RsmI)	E4L837_9FIRM	rsmI HMPREF9220_1019	Dialister microaerophilus UPII 345-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister microaerophilus UPII 345-E"	enzyme-directed rRNA 2'-O-methylation [GO:0000453]	cytoplasm [GO:0005737]	rRNA (cytosine-2'-O-)-methyltransferase activity [GO:0070677]	LLLNHFNIHKRIIAYHEHNK	0.95543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	222300	0	0	0	0	0	25607	18624	0	43612	0	0	0	0	0	0	0	0	0	33328	29687	0	0	0	0	52032	82924	0	0	0	0	0	0	0	0	0	137980	0	0	0	0	161020	214400	0	0	0	0	0	0	61343	0	75091	0	0	0	0	222300	0	25607	43612	0	0	0	33328	0	82924	0	0	137980	0	214400	0	0	75091
E4L844	Leucine--tRNA ligase (EC 6.1.1.4) (Leucyl-tRNA synthetase) (LeuRS)	E4L844_9FIRM	leuS HMPREF9220_1026	Dialister microaerophilus UPII 345-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister microaerophilus UPII 345-E"	leucyl-tRNA aminoacylation [GO:0006429]	cytoplasm [GO:0005737]	 ATP binding [GO:0005524]; leucine-tRNA ligase activity [GO:0004823];aminoacyl-tRNA editing activity [GO:0002161]	DVLGEDYLK	0.95238	0	0	131200	0	0	0	242610	100910	117590	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	107320	12329	0	0	3654.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	131200	0	242610	0	0	0	0	0	107320	3654.9	0	0	0	0	0	0	0	0	0	0	0	0
E4L8Q1	GTPase Obg (EC 3.6.5.-) (GTP-binding protein Obg)	E4L8Q1_9FIRM	cgtA obg HMPREF9220_0971	Dialister microaerophilus UPII 345-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister microaerophilus UPII 345-E"	ribosome biogenesis [GO:0042254]	cytoplasm [GO:0005737]	 GTP binding [GO:0005525]; magnesium ion binding [GO:0000287];GTPase activity [GO:0003924]	ENIIHFDDFPR	0.95133	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49818	0	14781	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53879	0	0	0	0	0	46440	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49818	14781	0	0	0	0	0	0	0	0	0	53879	0	46440	0	0
E4L9S0	Heptosyltransferase	E4L9S0_9FIRM	HMPREF9220_0501	Dialister microaerophilus UPII 345-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister microaerophilus UPII 345-E"			"transferase activity, transferring glycosyl groups [GO:0016757]"	LDKKDINNEIYFNEK	0.95966	0	0	0	0	0	0	0	141270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7621.3	0	2969.5	0	11658	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12777	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	141270	0	0	0	0	0	7621.3	2969.5	11658	0	0	0	0	0	12777	0	0	0	0	0
E4L9V0	RNA polymerase sigma factor SigA	E4L9V0_9FIRM	rpoD sigA HMPREF9220_0108	Dialister microaerophilus UPII 345-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister microaerophilus UPII 345-E"	transcription initiation from bacterial-type RNA polymerase promoter [GO:0001123]	cytoplasm [GO:0005737]	 DNA-binding transcription factor activity [GO:0003700]; sigma factor activity [GO:0016987];DNA binding [GO:0003677]	DWEKQEK	0.96046	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	149220	0	0	0	51335	185540	0	0	0	0	0	29678	32382	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	149220	0	185540	0	32382	0	0	0
E4LA52	Caudovirus prohead protease	E4LA52_9FIRM	HMPREF9220_0619	Dialister microaerophilus UPII 345-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister micraerophilus, Dialister microaerophilus UPII 345-E"			peptidase activity [GO:0008233]	EIFINDDMGTVVK	0.95278	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49558	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26240	0	0	0	0	0	49558	0	0	0	0	0	0	0
A0A1B3WET8	YadA_anchor domain-containing protein	A0A1B3WET8_9FIRM	BCB69_05665	Dialister pneumosintes	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister pneumosintes"				AEKVQELADVQK	0.95967	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	86585	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	86585	0	0	0	0
A0A1B3WFA6	Alanyl-tRNA editing protein	A0A1B3WFA6_9FIRM	BCB69_01355	Dialister pneumosintes	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister pneumosintes"	alanyl-tRNA aminoacylation [GO:0006419]		 ATP binding [GO:0005524]; nucleic acid binding [GO:0003676];alanine-tRNA ligase activity [GO:0004813]	DRESGIVYNFYSDK	0.95288	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8429.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	358880	0	0	0	0	0	8429.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	358880
A0A1B3WFD3	DUF2318 domain-containing protein	A0A1B3WFD3_9FIRM	BCB69_04910	Dialister pneumosintes	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister pneumosintes"		integral component of membrane [GO:0016021]		CPVRHVEQNPAQYRK	0.95775	0	0	0	0	0	0	283480	0	0	210330	134340	0	0	0	23937	0	0	0	0	0	0	0	0	0	142390	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34020	0	0	0	16616	9659.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	283480	210330	23937	0	0	0	142390	0	0	0	0	0	0	0	34020	16616	0	0	0	0
A0A354WQR5	Uncharacterized protein	A0A354WQR5_9FIRM	DDY92_00490	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."				WSQLHYQR	0.95619	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	213880	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	213880
A0A354WR73	Ribosome maturation factor RimM	A0A354WR73_9FIRM	rimM DDY92_01370	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."	 rRNA processing [GO:0006364];ribosomal small subunit biogenesis [GO:0042274]	 ribosome [GO:0005840];cytoplasm [GO:0005737]	ribosome binding [GO:0043022]	AGGVQIK	0.95602	0	0	0	0	0	0	74406	164960	99519	51821	60470	13601	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	164960	60470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A354WR93	DUF3084 domain-containing protein	A0A354WR93_9FIRM	DDY92_01495	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."		integral component of membrane [GO:0016021]		KGDVLYK	0.95495	18216	0	0	0	51313	0	0	0	0	0	0	80191	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	76957	0	0	0	0	0	0	70762	45395	59165	88890	63409	46314	64357	67273	59732	81295	0	36487	18997	0	0	0	0	0	18216	51313	0	80191	0	0	0	0	0	0	0	0	0	76957	0	0	70762	88890	67273	81295	18997	0
A0A354WRT1	Glycosyl transferase	A0A354WRT1_9FIRM	DDY92_02470	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."	glycolipid biosynthetic process [GO:0009247]		"transferase activity, transferring hexosyl groups [GO:0016758]"	TQMAEAIR	0.95405	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36603	50416	0	0	0	0	0	0	0	0	0	0	35028	87232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	203460	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50416	0	0	0	87232	0	0	0	0	203460	0
A0A354WT65	Sugar-bind domain-containing protein	A0A354WT65_9FIRM	DDY92_02260	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."			carbohydrate binding [GO:0030246]	DLLGLRLWATEQSIKK	0.95425	0	72201	54866	10239	0	0	0	4239	0	0	0	0	0	0	0	0	106370	132180	0	0	0	0	0	0	0	0	0	25398	0	9431.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	72201	10239	4239	0	0	132180	0	0	0	25398	0	0	0	0	0	0	0	0	0	0	0	0
A0A354WT95	30S ribosomal protein S20	A0A354WT95_9FIRM	rpsT DDY92_02425	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."	translation [GO:0006412]	ribosome [GO:0005840]	 structural constituent of ribosome [GO:0003735];rRNA binding [GO:0019843]	EAEEKAEAAIAANVNANR	0.95	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53888	73609	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41826	0	1783.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73609	0	0	0	0	0	0	0	0	0	41826	0	0	0
A0A354WTE5	Addiction module protein	A0A354WTE5_9FIRM	DDY92_02730	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."			ATP binding [GO:0005524]	NLVTGPMR	0.9505	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52633	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52633	0	0	0
A0A354WU75	ATP-dependent 6-phosphofructokinase (ATP-PFK) (Phosphofructokinase) (EC 2.7.1.11) (Phosphohexokinase)	A0A354WU75_9FIRM	pfkA DDY92_04250	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."	fructose 6-phosphate metabolic process [GO:0006002]	cytoplasm [GO:0005737]	 ATP binding [GO:0005524]; metal ion binding [GO:0046872];6-phosphofructokinase activity [GO:0003872]	CKAFFER	0.9622	0	0	0	0	0	0	0	0	0	0	0	0	0	33188	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11798	0	26688	0	0	0	0	0	0	0	0	0	0	0	0	14214	0	0	0	0	0	0	6363.2	0	0	0	0	0	0	0	0	0	0	33188	0	0	0	0	0	0	0	11798	26688	0	0	0	14214	0	6363.2	0	0
A0A354WUB8	CRISPR-associated helicase/endonuclease Cas3	A0A354WUB8_9FIRM	DDY92_04485	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."			 endonuclease activity [GO:0004519]; nucleic acid binding [GO:0003676];ATP binding [GO:0005524]	GFLHPTNPLNQKR	0.95187	0	0	0	0	0	0	0	0	108360	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	108360	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3B9DWQ2	Glutamine synthetase	A0A3B9DWQ2_9FIRM	DCG08_06550	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."	nitrogen compound metabolic process [GO:0006807]		glutamate-ammonia ligase activity [GO:0004356]	WEAIAAKK	0.95546	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	240270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	240270	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3C2EQ97	Transporter (Fragment)	A0A3C2EQ97_9FIRM	DCQ81_00500	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."		integral component of membrane [GO:0016021]		RRMLLPR	0.95677	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6480.8	0	7556.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11836	8797.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7556.7	0	0	0	0	0	0	11836	0	0	0	0	0	0	0	0	0
A0A3C2ERF0	Amino acid ABC transporter ATP-binding protein (Fragment)	A0A3C2ERF0_9FIRM	DCQ81_02360	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."			 ATP binding [GO:0005524]; ATPase-coupled amino acid transmembrane transporter activity [GO:0015424];ATPase activity [GO:0016887]	QAMKKEMR	0.95728	0	0	0	0	0	0	0	57832	0	0	0	0	54327	0	12922	0	0	82646	0	0	0	0	0	0	0	15373	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9938.6	10212	0	0	0	0	34306	7287.7	9950	29782	43460	0	9011.7	0	0	0	0	0	0	0	0	0	0	0	0	0	57832	0	54327	82646	0	0	15373	0	0	0	0	0	10212	0	34306	43460	9011.7	0	0	0
A0A3C2ES00	Uncharacterized protein	A0A3C2ES00_9FIRM	DCQ81_03875	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."				NRETDEQAAGPLIRDR	0.96454	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	133700	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	133700	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3C2ESB4	Restriction endonuclease (Fragment)	A0A3C2ESB4_9FIRM	DCQ81_02425	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."			endonuclease activity [GO:0004519]	DEYQVLLVADK	0.95156	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15348	0	0	0	0	0	25096	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15348	0	25096	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3D2VJ72	Uncharacterized protein	A0A3D2VJ72_9FIRM	DHW56_04595	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."				AVENCCIYKTFRFSLHGWLEFHTGCLDMEK	0.95611	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	43395	0	34674	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	43395	0	0	0	0	0	0	0
A0A3D5K9S0	Uncharacterized protein	A0A3D5K9S0_9FIRM	DGO70_06125	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."		integral component of membrane [GO:0016021]		SWGMKDVRSDEMDLPDEMER	0.95438	603700	508120	333990	44329	517240	0	0	0	0	0	0	0	0	11212	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18394	9266.7	18580	22408	0	39800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	603700	517240	0	0	11212	0	0	0	0	0	0	0	18580	39800	0	0	0	0	0	0	0	0
A0A3D5PTA5	Phosphatase	A0A3D5PTA5_9FIRM	DGT53_00840	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."			hydrolase activity [GO:0016787]	EHNGMKADFR	0.99194	0	0	0	0	0	0	0	0	0	0	55259	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	55259	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3D5PV96	AAA family ATPase	A0A3D5PV96_9FIRM	DGT53_05805	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."			ATP binding [GO:0005524]	LYPGHIR	0.95568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30290	34298	35072	54227	21161	36550	55174	0	0	0	0	0	0	0	54318	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30290	54227	55174	0	0	54318	0	0
A0A3D5PVH2	Type I restriction-modification system subunit M	A0A3D5PVH2_9FIRM	DGT53_04955	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."	DNA restriction-modification system [GO:0009307]		 N-methyltransferase activity [GO:0008170]; site-specific DNA-methyltransferase (adenine-specific) activity [GO:0009007];DNA binding [GO:0003677]	LSLGTELTNFK	0.95876	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	109980	0	0	2258.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	109980	2258.9	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3D5PVP9	F0F1 ATP synthase subunit beta (EC 3.6.3.14) (Fragment)	A0A3D5PVP9_9FIRM	DGT53_04505	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."	 proton transmembrane transport [GO:1902600];ATP metabolic process [GO:0046034]		hydrolase activity [GO:0016787]	DKAVPTPK	0.95171	0	0	0	0	0	0	0	0	0	0	152820	0	574130	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1755000	0	0	0	0	0	0	0	0	0	0	0	42020	0	0	0	0	25473	16556	33830	0	64241	26294	147890	0	0	0	0	60939	40725	14522	0	0	0	0	0	0	0	0	0	152820	574130	0	0	0	0	1755000	0	0	0	42020	0	25473	64241	147890	0	60939	0	0
A0A3D5PWL9	Uncharacterized protein (Fragment)	A0A3D5PWL9_9FIRM	DGT53_04190	Dialister sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, unclassified Dialister, Dialister sp."				TAQMERGNSDRLCR	0.95628	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	613980	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	868930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	613980	0	0	0	0	0	0	868930	0
R7CLH6	Methionine import ATP-binding protein MetN (EC 7.4.2.11)	R7CLH6_9FIRM	metN BN625_01032	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"	methionine transport [GO:0015821]	plasma membrane [GO:0005886]	 ATP binding [GO:0005524]; ATPase-coupled amino acid transmembrane transporter activity [GO:0015424];ATPase activity [GO:0016887]	AYNNDYK	0.95489	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28636	20208	20020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22322	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7738.8	0	0	0	0	0	0	0	28636	0	0	0	0	0	0	0	0	22322	0	0	0	0	0	7738.8
R7CMF4	Probable transaldolase (EC 2.2.1.2)	R7CMF4_9FIRM	tal BN625_01228	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"	 pentose-phosphate shunt [GO:0006098];carbohydrate metabolic process [GO:0005975]	cytoplasm [GO:0005737]	 sedoheptulose-7-phosphate:D-glyceraldehyde-3-phosphate glyceronetransferase activity [GO:0004801];aldehyde-lyase activity [GO:0016832]	MNAAAWDK	0.9513	0	0	0	0	0	0	0	0	0	0	22016	0	0	0	0	0	21328	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22016	0	21328	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R7CML0	Uncharacterized protein	R7CML0_9FIRM	BN625_01249	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"				WKDRDEFHQMLR	0.9548	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	56369	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	56369	0	0	0
R7CMS7	Uncharacterized protein	R7CMS7_9FIRM	BN625_01095	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"				MKKDELK	0.95323	0	0	0	0	8309.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8309.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R7CP92	DNA-3-methyladenine glycosylase II	R7CP92_9FIRM	BN625_01287	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"	base-excision repair [GO:0006284]		catalytic activity [GO:0003824]	SQTPARK	0.95507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18823	0	0	0	0	0	40585	35144	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18823	0	40585	0	0	0	0	0	0	0	0	0	0	0
R7CQJ4	Methionine synthase vitamin-B12 independent	R7CQJ4_9FIRM	BN625_01587	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"	methionine biosynthetic process [GO:0009086]		 zinc ion binding [GO:0008270];5-methyltetrahydropteroyltriglutamate-homocysteine S-methyltransferase activity [GO:0003871]	LIRDYADK	0.95074	0	462250	0	0	0	0	0	0	0	0	0	0	22168	3402.4	3458	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2184	0	0	0	0	7011.4	0	0	0	462250	0	0	0	22168	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2184	7011.4	0
R7CRX1	HTH arsR-type domain-containing protein	R7CRX1_9FIRM	BN625_00192	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"			DNA-binding transcription factor activity [GO:0003700]	CKDKLYLEPLFDMR	0.9525	0	0	0	0	0	0	0	0	0	0	0	73357	0	0	0	0	18097	82199	0	0	0	0	0	0	0	0	0	0	0	0	0	5129	7663	0	19176	0	9638.6	0	0	0	18100	0	31843	20134	0	0	0	0	0	0	0	18079	7674.3	3646.1	0	0	0	0	35860	0	0	0	0	0	31735	34902	0	0	0	73357	0	82199	0	0	0	0	7663	19176	9638.6	18100	31843	0	0	18079	0	35860	0	34902
R7CRZ9	HTH tetR-type domain-containing protein	R7CRZ9_9FIRM	BN625_01585	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"			DNA binding [GO:0003677]	ERCLYYFIELYK	0.9534	0	0	0	177070	174840	0	0	0	0	0	0	0	0	0	0	0	12070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	177070	0	0	0	12070	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R7CS65	Pseudouridine synthase (EC 5.4.99.-)	R7CS65_9FIRM	BN625_00269	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"	pseudouridine synthesis [GO:0001522]		 RNA binding [GO:0003723];pseudouridine synthase activity [GO:0009982]	MMAAYHYPVFELKR	0.95188	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13156	0	0	0	0	0	0	0	0	5036.5	0	0	0	0	0	0	15235	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13156	0	0	5036.5	0	15235	0	0	0	0	0	0	0	0	0	0	0
R7CSQ8	Bacterial regulatory s luxR family protein	R7CSQ8_9FIRM	BN625_00058	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"	"regulation of transcription, DNA-templated [GO:0006355]"		DNA binding [GO:0003677]	AESWHWQK	1.0357	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R7CTV6	Uncharacterized protein	R7CTV6_9FIRM	BN625_00475	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"				FNTSELSCLDQCITKFQTRR	0.95414	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20837	131980	29079	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	131980	0	0	0	0	0	0	0
R7CU09	Exopolyphosphatase	R7CU09_9FIRM	BN625_00352	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"				NSGPFWQR	0.95347	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	119310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	119310	0	0	0	0	0	0	0	0	0	0
R7CUF8	DNA polymerase III subunit gamma/tau (EC 2.7.7.7)	R7CUF8_9FIRM	dnaX BN625_00491	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"	DNA replication [GO:0006260]	DNA polymerase III complex [GO:0009360]	 DNA binding [GO:0003677]; DNA-directed DNA polymerase activity [GO:0003887];ATP binding [GO:0005524]	ETKKLGSTAK	0.96721	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15564	38589	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38589	0
R7CVI3	Uncharacterized protein	R7CVI3_9FIRM	BN625_00810	Dialister sp. CAG:357	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:357"				EVKNEGGAQISTNDTINR	0.95042	0	0	0	0	0	0	5512.4	12293	13857	133020	126440	0	0	0	229730	36757	20854	94058	0	0	0	0	0	0	9895	57284	12430	58787	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4302.8	0	0	0	0	0	0	0	0	0	0	18860	0	42402	16314	0	0	0	0	0	112740	98586	50179	0	0	0	13857	133020	229730	94058	0	0	57284	58787	0	0	0	0	4302.8	0	0	18860	42402	0	112740	98586
R6A6M6	Peptidase_M50 domain-containing protein	R6A6M6_9FIRM	BN678_00543	Dialister sp. CAG:486	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:486"		integral component of membrane [GO:0016021]	metalloendopeptidase activity [GO:0004222]	PVDIDPRYYK	0.95587	10217	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	100100	0	0	0	18633	55388	0	0	0	0	0	0	0	0	0	14333	55000	0	0	0	0	0	5994.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10217	0	0	0	0	0	0	0	0	100100	55388	0	0	0	55000	0	5994.8	0	0	0	0	0
R6AEB1	HTH tetR-type domain-containing protein	R6AEB1_9FIRM	BN678_00163	Dialister sp. CAG:486	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:486"			DNA binding [GO:0003677]	RELASLILLSLGLK	0.95186	0	0	0	0	0	0	0	0	24372	0	0	0	0	0	0	0	0	26923	36532	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24372	0	0	26923	36532	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R6AF80	Helix-turn-helix domain protein	R6AF80_9FIRM	BN678_00459	Dialister sp. CAG:486	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:486"			DNA binding [GO:0003677]	YNLDANQR	0.95131	0	0	0	25600	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12952	0	0	0	12334	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25600	0	0	0	0	12952	12334	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R6AHX8	Uncharacterized protein	R6AHX8_9FIRM	BN678_00416	Dialister sp. CAG:486	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:486"				DRGGFYAIVR	0.955	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17268	12784	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15760	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17268	0	0	0	0	0	0	0	0	15760	0	0	0	0	0	0
R6AKJ7	Uncharacterized protein	R6AKJ7_9FIRM	BN678_00733	Dialister sp. CAG:486	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:486"			 flavin adenine dinucleotide binding [GO:0050660];acyl-CoA dehydrogenase activity [GO:0003995]	DFTLDAK	0.9538	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33560	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33560	0	0	0	0	0
R6AN49	Integrase family protein	R6AN49_9FIRM	BN678_01873	Dialister sp. CAG:486	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:486"	 DNA recombination [GO:0006310];DNA integration [GO:0015074]		DNA binding [GO:0003677]	DQLGQFAR	0.95112	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	43161	89713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	89713	0	0	0	0	0	0	0	0	0	0
R6B0T6	RNA polymerase sigma factor SigA	R6B0T6_9FIRM	sigA BN678_00729	Dialister sp. CAG:486	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:486"	transcription initiation from bacterial-type RNA polymerase promoter [GO:0001123]	cytoplasm [GO:0005737]	 DNA-binding transcription factor activity [GO:0003700]; sigma factor activity [GO:0016987];DNA binding [GO:0003677]	EAREAAKEEEPLADR	0.95809	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52963	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52963	0	0	0	0	0	0
R6B137	DUF58 domain-containing protein	R6B137_9FIRM	BN678_00779	Dialister sp. CAG:486	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:486"		integral component of membrane [GO:0016021]		DVYVDER	0.95536	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19113	0	0	0	0	0	0	0	0	0	0	0	14650	0	0	7879.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19113	0	0	0	14650	7879.7	0	0	0	0
R7PPD7	DUF2357 domain-containing protein	R7PPD7_9FIRM	BN722_00786	Dialister sp. CAG:588	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:588"				DLIIETGAELNHR	0.95319	0	0	0	0	0	0	0	0	0	0	0	0	0	18625	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33201	53790	31257	0	0	0	0	0	0	0	0	0	0	18625	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53790	0	0
R7PQD7	CRISPR-associated endonuclease Cas9 (EC 3.1.-.-)	R7PQD7_9FIRM	cas9 BN722_01041	Dialister sp. CAG:588	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:588"	 maintenance of CRISPR repeat elements [GO:0043571];defense response to virus [GO:0051607]		 endonuclease activity [GO:0004519]; metal ion binding [GO:0046872]; RNA binding [GO:0003723];DNA binding [GO:0003677]	AIIEEKAR	1.0556	0	0	0	10248	0	0	1858.1	0	0	0	0	0	57244	0	0	0	0	0	0	0	0	0	0	0	0	22309	0	0	0	0	0	0	0	0	0	26446	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	68205	0	0	0	4396.6	9057.7	0	0	0	0	0	0	0	0	0	0	10248	1858.1	0	57244	0	0	0	22309	0	0	26446	0	0	0	0	0	68205	9057.7	0	0	0
R7PQI1	Holliday junction ATP-dependent DNA helicase RuvB (EC 3.6.4.12)	R7PQI1_9FIRM	ruvB BN722_00947	Dialister sp. CAG:588	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:588"	 DNA repair [GO:0006281]; SOS response [GO:0009432];DNA recombination [GO:0006310]		 DNA binding [GO:0003677]; four-way junction helicase activity [GO:0009378];ATP binding [GO:0005524]	DMWQQSLRPKFFR	0.95445	0	0	0	0	0	0	41947	0	42016	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42016	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R7PR59	Exonuclease	R7PR59_9FIRM	BN722_00284	Dialister sp. CAG:588	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:588"			 nucleic acid binding [GO:0003676];exonuclease activity [GO:0004527]	DMMKAVGLTFHPFEIK	0.96538	0	0	0	0	0	0	0	1576000	56536	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1576000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R7PSX4	Putative 3-methyladenine DNA glycosylase (EC 3.2.2.-)	R7PSX4_9FIRM	BN722_00139	Dialister sp. CAG:588	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:588"	base-excision repair [GO:0006284]		 DNA binding [GO:0003677];alkylbase DNA N-glycosylase activity [GO:0003905]	FWPFKHGYTAYEINR	0.96028	0	24543	15539	0	17411	0	0	0	0	0	0	0	0	14247	0	0	0	0	0	4696.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25814	0	0	9073.5	6786.6	0	0	0	40607	0	0	0	24543	17411	0	0	14247	0	4696.8	0	0	0	0	0	0	0	0	0	0	0	25814	9073.5	40607	0
R7PT12	Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC)	R7PT12_9FIRM	prmC BN722_01167	Dialister sp. CAG:588	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, environmental samples, Dialister sp. CAG:588"	peptidyl-glutamine methylation [GO:0018364]		 protein-(glutamine-N5) methyltransferase activity [GO:0102559]; protein-glutamine N-methyltransferase activity [GO:0036009];nucleic acid binding [GO:0003676]	PDTEEWVEK	0.96694	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	81473	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	81473	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
H1CXR2	Mutator mutT protein	H1CXR2_9FIRM	HMPREF9453_00150	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"			hydrolase activity [GO:0016787]	GFEGYRR	0.96299	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23470	17370	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23470	0	0	0
H1CXY7	Uncharacterized protein	H1CXY7_9FIRM	HMPREF9453_00225	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"		integral component of membrane [GO:0016021]	CDP-glycerol glycerophosphotransferase activity [GO:0047355]	DVNHTEWVCIIPLHEREK	0.95044	0	0	0	74247	0	0	120480	123480	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14893	0	22008	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30978	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	74247	123480	0	0	0	0	0	22008	0	0	0	0	0	0	0	30978	0	0	0	0	0
H1CY08	Uncharacterized protein	H1CY08_9FIRM	HMPREF9453_00246	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"				PTQLDAIK	0.95153	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17580	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17580	0	0	0	0
H1CY64	"RNA methyltransferase, TrmH family, group 3"	H1CY64_9FIRM	HMPREF9453_00302	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"	RNA processing [GO:0006396]		 RNA methyltransferase activity [GO:0008173];RNA binding [GO:0003723]	DTSSSLPR	0.95201	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	87981	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29670	247310	281490	0	31229	119160	162050	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	87981	0	0	0	0	0	0	0	0	29670	281490	162050	0	0	0
H1CZB1	Cell shape-determining protein MreC (Cell shape protein MreC)	H1CZB1_9FIRM	HMPREF9453_00704	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"	regulation of cell shape [GO:0008360]			SLSENKR	0.95151	0	0	0	0	0	0	0	0	0	0	0	2314100	0	539270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1518500	0	456810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	281170	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2314100	539270	0	0	0	0	0	1518500	0	0	0	0	0	0	281170	0	0	0	0
H1CZG9	Deacetylase sirtuin-type domain-containing protein	H1CZG9_9FIRM	HMPREF9453_00762	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"			NAD+ binding [GO:0070403]	EMIESHHK	0.95141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46514	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46514	0	0
H1CZM9	PRK domain-containing protein	H1CZM9_9FIRM	HMPREF9453_00817	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"			 kinase activity [GO:0016301];ATP binding [GO:0005524]	ISTSDSRLLR	0.984	0	0	0	0	0	0	0	0	0	0	0	10570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
H1D170	Polyphenol oxidase	H1D170_9FIRM	HMPREF9453_01358	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"				VEDVLENR	0.95089	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50932	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50932	0	0	0	0	0	0	0	0	0	0	0
H1D1C5	Uncharacterized protein	H1D1C5_9FIRM	HMPREF9453_01413	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"		integral component of membrane [GO:0016021]		QVSHDGR	0.95757	0	0	0	0	0	0	0	0	0	0	0	0	0	14568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14568	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
H1D263	Uncharacterized protein	H1D263_9FIRM	HMPREF9453_01701	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"	" regulation of transcription, DNA-templated [GO:0006355]"";""phosphorelay signal transduction system [GO:0000160]"		DNA binding [GO:0003677]	TELCDMFR	0.95527	0	0	0	0	0	0	0	0	14332	0	0	4110.3	0	0	0	0	0	0	32023	0	0	0	0	0	8965	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27270	0	0	0	0	0	0	0	0	11133	0	0	8867.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14332	4110.3	0	0	32023	0	8965	0	0	0	0	27270	0	0	11133	8867.9	0	0	0	0
H1D397	Uncharacterized protein	H1D397_9FIRM	HMPREF9453_02085	Dialister succinatiphilus YIT 11850	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Dialister, Dialister succinatiphilus, Dialister succinatiphilus YIT 11850"				TQAADWR	0.95908	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	63502	0	0	4062.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61330	0	0	0	0	0	0	0	0	0	0	0	0	0	0	63502	4062.1	0	0	0	0	0	0	0	61330	0
A0A498QY96	SLH domain-containing protein	A0A498QY96_9FIRM	LUCI_0363	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"				LTSISAANR	0.95338	0	0	0	0	0	171390	0	0	0	0	0	0	0	0	0	29018	0	0	0	0	0	0	0	0	0	0	0	0	0	16788	0	24379	24763	0	0	76763	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	171390	0	0	0	29018	0	0	0	16788	24763	76763	0	0	0	0	0	0	0	0	0	0
A0A498R091	DUF4405 domain-containing protein	A0A498R091_9FIRM	LUCI_0120	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"		integral component of membrane [GO:0016021]		GFFVEYRR	0.95984	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48848	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48848	0	0	0
A0A498R0I5	Uncharacterized protein	A0A498R0I5_9FIRM	LUCI_1227	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			penicillin binding [GO:0008658]	KVSSLKLPGVIVVGER	0.96443	0	10715	0	0	0	0	0	0	0	0	0	88862	0	47813	43774	0	0	0	0	0	0	0	0	0	0	0	0	148280	0	0	0	0	130070	106380	0	71078	0	0	0	0	31509	31231	44765	0	0	0	0	0	0	33503	0	0	0	0	62265	0	0	0	0	0	0	0	0	0	0	0	10715	0	0	88862	47813	0	0	0	0	148280	130070	106380	0	31509	44765	0	33503	0	62265	0	0	0
A0A498R1D5	Radical sam alpha/beta horseshoe	A0A498R1D5_9FIRM	LUCI_0451	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"				EKDLHDFAFIYDRGR	0.95059	0	0	0	0	0	0	0	29092	10829	65418	61084	0	125320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15330	6635.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29092	65418	125320	0	0	0	0	0	0	0	0	0	0	15330	6635.5	0	0	0	0	0
A0A498R1R7	Aminotransferase class i/classii	A0A498R1R7_9FIRM	LUCI_0613	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"	biosynthetic process [GO:0009058]		 transaminase activity [GO:0008483];pyridoxal phosphate binding [GO:0030170]	TVAENPLR	0.95349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	150660	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41617	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	150660	0	0	0	0	0	0	41617	0	0	0	0	0	0	0	0	0
A0A498R2B2	Dna topoisomerase type ia	A0A498R2B2_9FIRM	LUCI_2002	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"	DNA topological change [GO:0006265]	chromosome [GO:0005694]	" DNA topoisomerase type I (single strand cut, ATP-independent) activity [GO:0003917]"";""DNA binding [GO:0003677]"	YSCGWFTR	0.95123	0	69155	77541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4481.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	77541	0	0	0	0	0	0	0	0	0	0	4481.7	0	0	0	0	0	0	0	0	0	0
A0A498R2U1	Nucleotide-diphospho-sugar transferases	A0A498R2U1_9FIRM	LUCI_0685	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			transferase activity [GO:0016740]	ILAEFRRFNQILCIK	0.95055	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48375	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48375	0	0	0	0	0	0	0	0	0	0
A0A498R2X5	Fad dependent oxidoreductase	A0A498R2X5_9FIRM	LUCI_2230	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			oxidoreductase activity [GO:0016491]	SVLYNQK	0.9593	0	0	0	0	0	0	0	39805	0	0	0	0	0	9552.2	0	25226	0	0	0	0	0	0	0	0	0	0	0	0	23091	0	0	0	0	0	15655	26074	0	0	0	0	8754.6	0	0	0	0	17253	5987.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9311.8	0	0	0	39805	0	9552.2	25226	0	0	0	23091	0	26074	0	8754.6	0	17253	0	0	0	0	0	9311.8
A0A498R4P1	Pyridine nucleotide-disulphide oxidoreductase class-ii	A0A498R4P1_9FIRM	LUCI_0998	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			 oxidoreductase activity [GO:0016491];FMN binding [GO:0010181]	GADIVKCLRCFTCMAER	0.95347	0	530760	68820	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	530760	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A498R6J3	MFS domain-containing protein	A0A498R6J3_9FIRM	LUCI_1004	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"		integral component of membrane [GO:0016021]	transmembrane transporter activity [GO:0022857]	MAKFKQLR	0.95481	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	102910	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	102910	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A498R6Y5	Uncharacterized protein	A0A498R6Y5_9FIRM	LUCI_0094	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"				QYLMEYTR	0.95468	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	159360	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	159360	0	0	0
A0A498R7E4	Threonine synthase n terminus	A0A498R7E4_9FIRM	LUCI_3954	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"				FLYHMTR	0.95407	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47339	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14075	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47339	0	0	0	0	0	0	0	0	0	0	0	14075	0	0
A0A498R7L7	GRAM domain-containing protein	A0A498R7L7_9FIRM	LUCI_4037	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"				DEWLQDITRQMDRIQ	0.95769	0	0	0	0	19856	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32520	0	0	0	0	0	0	0	0	28614	0	24598	26975	0	19157	0	0	0	0	0	0	0	0	0	0	0	0	0	19856	0	0	0	0	0	0	0	0	0	0	0	32520	0	0	28614	26975	0	0	0	0
A0A498R7P8	Sulphite reductase subunit c	A0A498R7P8_9FIRM	LUCI_2239	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			" heme binding [GO:0020037]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]"";""4 iron, 4 sulfur cluster binding [GO:0051539]"	MQHDINVKQLKK	0.95414	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	221050	0	0	0	0	0	0	0	0	34611	37781	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	221050	0	0	37781	0	0
A0A498R7T9	Nadph-dependent fmn reductase	A0A498R7T9_9FIRM	LUCI_2221	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			oxidoreductase activity [GO:0016491]	YFSSRWKMFFDR	0.95332	0	0	0	0	0	0	48603	0	0	0	0	100460	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5895.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48603	100460	0	0	0	0	0	5895.9	0	0	0	0	0	0	0	0	0	0	0	0
A0A498R8N5	Uncharacterized protein	A0A498R8N5_9FIRM	LUCI_3016	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			 kinase activity [GO:0016301];ATP binding [GO:0005524]	CWASLFTDRAVTYR	0.95747	0	0	0	0	0	0	0	0	0	0	0	125330	0	15084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50207	0	0	0	0	0	0	0	0	0	0	0	0	0	125330	15084	0	0	0	0	0	0	0	0	0	0	0	0	0	50207	0	0	0
A0A498RAG4	Uncharacterized protein	A0A498RAG4_9FIRM	LUCI_4994	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			" metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]"";""2 iron, 2 sulfur cluster binding [GO:0051537]"	ERICVCK	0.95315	0	0	0	0	0	0	0	16519	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32241	0	0	0	0	0	0	0	0	0	3090.1	0	0	0	0	0	0	0	0	16519	0	0	0	0	0	0	0	0	0	0	0	0	0	32241	0	0	3090.1	0	0
A0A498RC46	AAA_15 domain-containing protein	A0A498RC46_9FIRM	LUCI_3843	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"				ESFDRICQWK	0.96553	0	0	90868	4230.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9470.9	0	0	0	0	0	0	0	0	0	0	0	0	19064	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	90868	4230.2	0	0	0	0	9470.9	0	0	0	0	19064	0	0	0	0	0	0	0	0	0	0
A0A498RCH0	UPF0210 protein LUCI_3993	A0A498RCH0_9FIRM	LUCI_3993	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"				TIVEGMREVCDMNIGK	0.96493	111270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17050	0	0	5441.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	111270	0	0	0	0	0	0	0	17050	5441.7	0	0	0	0	0	0	0	0	0	0	0	0
A0A498RDF6	TRANSKETOLASE_1 domain-containing protein	A0A498RDF6_9FIRM	LUCI_2472	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"				ELRFNPQNPNWEDRDR	0.96495	0	0	0	0	0	0	0	0	0	0	0	0	0	0	110470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	110470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A498RDM4	Spore germination gerac	A0A498RDM4_9FIRM	LUCI_2552	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"	spore germination [GO:0009847]	membrane [GO:0016020]		WKDVKTWK	0.95572	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14368	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14368	0	0	0	0	0	0	0	0	0
A0A498REA6	Amidinotransferase	A0A498REA6_9FIRM	LUCI_5119	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			transferase activity [GO:0016740]	ELCARQNK	0.95548	0	0	0	0	0	0	9075.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16174	0	0	0	0	0	0	0	0	0	0	21408	12154	0	0	0	0	0	0	0	0	0	0	0	0	0	127820	0	0	0	0	74272	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9075.4	0	0	0	0	16174	0	0	0	21408	0	0	0	0	127820	74272	0	0	0	0
A0A498RHT9	Glycine radical	A0A498RHT9_9FIRM	LUCI_4971	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			catalytic activity [GO:0003824]	GEGVILEDENICLKANEMIK	0.9544	0	0	0	0	0	187650	0	0	0	0	19349	0	0	0	0	0	0	131150	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	187650	0	19349	0	131150	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A498RIK6	3-oxoacid coa-transferase subunit a	A0A498RIK6_9FIRM	LUCI_5180	Lucifera butyrica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Lucifera, Lucifera butyrica"			CoA-transferase activity [GO:0008410]	SKINGKFSM	0.96258	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4190.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17494	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4190.5	0	0	0	0	0	0	0	0	17494	0
A0A0J6WS83	dGTPase	A0A0J6WS83_9FIRM	AB840_13895	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"				PNQYAPYTWEGCVVK	0.95264	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42775	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42775	0	0	0
A0A0J6WSI6	NADPH-dependent FMN reductase	A0A0J6WSI6_9FIRM	AB840_07960	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"			oxidoreductase activity [GO:0016491]	HESFIGAYHLGSRHCRR	0.9519	0	0	0	0	0	0	247750	434250	222530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	434250	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A0J6WSU5	PucR family transcriptional regulator	A0A0J6WSU5_9FIRM	AB840_12950	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"				YLCRFIIDDEKR	0.95408	0	97688	0	0	0	148710	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	97688	148710	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A0J6WTK0	LysR family transcriptional regulator	A0A0J6WTK0_9FIRM	AB840_13250	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"			 DNA-binding transcription factor activity [GO:0003700];DNA binding [GO:0003677]	DELVYYAPRLDISGTR	0.96491	0	0	70844	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15875	0	0	0	0	27435	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70844	0	0	0	0	0	0	15875	0	27435	0	0	0	0	0	0	0	0	0	0	0	0
A0A0J6WTZ1	Uncharacterized protein	A0A0J6WTZ1_9FIRM	AB840_14640	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"				DHNLWEK	0.9567	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21349	0	0	131140	13952	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21349	131140
A0A0J6WUP4	Cystathionine gamma-lyase	A0A0J6WUP4_9FIRM	AB840_09140	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"	transsulfuration [GO:0019346]		 pyridoxal phosphate binding [GO:0030170];lyase activity [GO:0016829]	YQNSGGR	0.96129	0	0	0	0	0	0	0	0	0	0	50957	40540	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21556	8619.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38565	0	0	0	50957	0	0	0	0	0	0	0	0	0	21556	0	0	0	0	0	0	0	38565
A0A0J6WV04	Uncharacterized protein	A0A0J6WV04_9FIRM	AB840_03040	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"				LAPIGGR	0.95071	29399	0	41604	177280	47816	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	113130	113090	115440	0	15670	0	0	93169	0	0	86367	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	178890	92550	124930	97719	134900	41604	177280	0	0	0	0	0	0	0	0	115440	15670	93169	86367	0	0	0	0	0	0	178890	134900
A0A0J6WVM2	tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I)	A0A0J6WVM2_9FIRM	truA AB840_11045	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"	tRNA pseudouridine synthesis [GO:0031119]		 tRNA pseudouridine synthase activity [GO:0106029];RNA binding [GO:0003723]	GAPATAGK	0.95437	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	84508	95418	0	0	0	0	42739	0	35346	28910	0	0	0	0	0	0	0	0	0	0	0	0	0	69979	0	7087.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	95418	0	42739	35346	0	0	0	0	69979	0	0	0
A0A0J6WVZ5	Uncharacterized protein	A0A0J6WVZ5_9FIRM	AB840_10585	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"				DIFAYYR	0.95246	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14121	0	24544	0	0	0	0	0	51936	8857.3	0	0	0	0	0	0	0	0	58541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14121	24544	0	51936	0	0	58541	0	0
A0A0J6WWA5	Uncharacterized protein	A0A0J6WWA5_9FIRM	AB840_01040	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"		integral component of membrane [GO:0016021]		DRHYIMMR	0.95127	0	0	0	0	0	0	0	0	0	0	0	0	0	26549	0	0	0	0	25858	0	0	0	0	0	0	3958.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10402	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26549	0	25858	0	3958.6	0	0	0	0	0	0	0	10402	0	0	0	0	0
A0A0J6WWH6	Phosphonates import ATP-binding protein PhnC (EC 7.3.2.2)	A0A0J6WWH6_9FIRM	phnC AB840_05335	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"		plasma membrane [GO:0005886]	 ATP binding [GO:0005524]; ATPase-coupled organic phosphonate transmembrane transporter activity [GO:0015416];ATPase activity [GO:0016887]	QLRMLRHR	0.95548	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41679	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41679	0	0	0	0	0	0
A0A0J6WWW6	Putative competence-damage inducible protein	A0A0J6WWW6_9FIRM	cinA AB840_06780	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"				LQEYMRWMR	0.9587	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37476	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37476	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A0J6WXR7	Nitrogenase protein alpha chain (EC 1.18.6.1)	A0A0J6WXR7_9FIRM	AB840_06885	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"	nitrogen fixation [GO:0009399]		 iron-sulfur cluster binding [GO:0051536]; metal ion binding [GO:0046872]; nitrogenase activity [GO:0016163];carbonyl sulfide nitrogenase activity [GO:0018697]	SLIMFNK	0.97521	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	143310	49168	13639	167900	116730	0	0	17490	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	143310	167900	17490	0	0	0
A0A0J6WYG6	Elongation factor G	A0A0J6WYG6_9FIRM	fusA AB840_00705	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"			 GTP binding [GO:0005525]; translation elongation factor activity [GO:0003746];GTPase activity [GO:0003924]	ILLETTGIHYVASGCMVPCR	0.95383	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28755	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28755	0	0	0	0	0	0	0	0	0	0	0	0
A0A0J6WYS3	NusG_II domain-containing protein	A0A0J6WYS3_9FIRM	AB840_00965	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"				PGEMAVCLPHKVMIEVR	0.95299	0	0	0	0	0	0	0	261660	125140	175870	47777	0	0	0	0	0	0	0	0	0	0	0	0	0	141450	0	49669	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25129	9476.7	0	0	0	0	0	0	0	0	0	0	0	0	261660	175870	0	0	0	0	141450	0	0	0	0	0	0	0	0	0	25129	0	0	0
A0A0J6WZ19	Clp protease ClpX	A0A0J6WZ19_9FIRM	AB840_04295	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"			 peptidase activity [GO:0008233];ATP binding [GO:0005524]	EGNTIHVDSLDKKELVFTTE	0.95464	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32020	0	0	0
A0A0J6WZG6	Peptide transporter	A0A0J6WZG6_9FIRM	AB840_01780	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"	transmembrane transport [GO:0055085]			DMGTKKEAGTNGNAESR	0.95203	0	514740	106190	6294.3	0	0	0	0	0	0	0	0	9086	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	514740	6294.3	0	0	9086	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A0J6ZMT9	Dihydropteroate synthase (DHPS) (EC 2.5.1.15) (Dihydropteroate pyrophosphorylase)	A0A0J6ZMT9_9FIRM	AB840_09250	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"	 tetrahydrofolate biosynthetic process [GO:0046654];folic acid biosynthetic process [GO:0046656]		 metal ion binding [GO:0046872];dihydropteroate synthase activity [GO:0004156]	YHWKDGK	0.95922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29601	33195	0	0	0	50364	0	0	0	151550	159080	76617	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33195	50364	0	159080	0	0
A0A0J6ZP86	Uncharacterized protein	A0A0J6ZP86_9FIRM	AB840_06700	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"				SDIQGELNLMLAEAEMKNLR	0.95412	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37275	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37275	0	0	0
A0A0J6ZQZ4	Uncharacterized protein	A0A0J6ZQZ4_9FIRM	AB840_03020	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"		integral component of membrane [GO:0016021]		QLIEQWR	0.95796	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	232710	44723	17365	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	232710	0	0	0	0	0
A0A0J6ZRP3	Proline reductase	A0A0J6ZRP3_9FIRM	AB840_01580	Megasphaera cerevisiae DSM 20462	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera cerevisiae, Megasphaera cerevisiae DSM 20462"			D-proline reductase (dithiol) activity [GO:0050002]	ETSRHYWR	0.95476	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9500.2	0	0	0	0	0	0	0	0	29311	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19375	75268	0	0	0	0	0	0	0	0	0	0	0	0	9500.2	0	0	29311	0	0	0	0	0	75268
A0A1M6NNB8	Type I restriction enzyme M protein	A0A1M6NNB8_MEGEL	SAMN04488492_104131	Megasphaera elsdenii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera elsdenii"	DNA methylation [GO:0006306]		 N-methyltransferase activity [GO:0008170];DNA binding [GO:0003677]	REERTNDPCYK	1.1176	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30312	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1M6P4H8	"Phage antirepressor protein YoqD, KilAC domain"	A0A1M6P4H8_MEGEL	SAMN04488492_10593	Megasphaera elsdenii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera elsdenii"			DNA binding [GO:0003677]	AASMGYK	0.95987	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11747	0	0	0	2587.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11747	2587.9
A0A1M6SA14	Uncharacterized protein	A0A1M6SA14_MEGEL	SAMN04488492_112106	Megasphaera elsdenii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera elsdenii"				ISIAFDK	0.96062	0	0	0	0	0	0	0	0	0	0	55075	0	0	22687	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57643	17772	0	0	0	0	0	0	0	0	0	0	35876	0	0	0	0	0	0	0	0	0	0	0	55075	22687	0	0	0	0	0	0	0	0	0	0	57643	0	0	0	35876	0	0
A0A269TFG1	MFS transporter	A0A269TFG1_MEGEL	CJO36_04160	Megasphaera elsdenii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera elsdenii"	transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]		LLEEEREK	0.9521	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11922	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9406.6	9693.2	52179	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11922	0	0	0	0	0	0	52179	0	0	0	0	0	0	0
A0A2S0M524	Phosphohydrolase	A0A2S0M524_MEGEL	C6Y28_02370	Megasphaera elsdenii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera elsdenii"	biosynthetic process [GO:0009058]		hydrolase activity [GO:0016787]	GDRNSKSR	1.0417	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22259	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	203460	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22259	0	0	0	0	0	0	0	0	203460	0
Q6RZ34	Tetracycline resistance protein	Q6RZ34_MEGEL	tetW	Megasphaera elsdenii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera elsdenii"			 GTP binding [GO:0005525];GTPase activity [GO:0003924]	VDRLSNRR	0.95489	0	0	0	0	0	102790	0	12066	0	37677	35161	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	102790	12066	37677	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R7MV06	Uncharacterized protein	R7MV06_9FIRM	BN715_00545	Megasphaera elsdenii CAG:570	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, Megasphaera elsdenii CAG:570"				RDDRDDVHDHPFR	0.95368	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31444	0	0	0	0	0	0	0	0	0	0	0	0	30280	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29509	0	0	0	0	0	0	0	0	0	0	0	31444	0	0	0	0	30280	0	0	0	0	0	0	29509
R7MV53	Putative acyl-CoA dehydrogenase	R7MV53_9FIRM	BN715_01348	Megasphaera elsdenii CAG:570	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, Megasphaera elsdenii CAG:570"			 flavin adenine dinucleotide binding [GO:0050660];acyl-CoA dehydrogenase activity [GO:0003995]	ACWMKDQGMDFSR	0.95709	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4310.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4310.8	0	0	0
R7MWE7	Putative phosphate transport regulator	R7MWE7_9FIRM	BN715_00506	Megasphaera elsdenii CAG:570	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, Megasphaera elsdenii CAG:570"				LNRMESEVDHIYRQEISR	0.95002	0	0	0	0	0	0	0	0	61234	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61234	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R7MWF0	Phosphate propanoyltransferase (EC 2.3.1.222)	R7MWF0_9FIRM	BN715_01776	Megasphaera elsdenii CAG:570	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, Megasphaera elsdenii CAG:570"	propanediol catabolic process [GO:0051144]		"transferase activity, transferring acyl groups other than amino-acyl groups [GO:0016747]"	VPCIMVYR	0.95047	0	0	0	29987	0	0	0	0	0	0	0	0	0	0	0	56160	0	15297	0	0	0	0	0	0	0	10558	0	117910	21818	0	57017	5557.5	0	0	0	0	0	12082	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29987	0	0	0	56160	0	0	10558	117910	57017	0	12082	0	0	0	0	0	0	0	0	0
R7MXQ3	Transcriptional regulator	R7MXQ3_9FIRM	BN715_00256	Megasphaera elsdenii CAG:570	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, Megasphaera elsdenii CAG:570"				ISAPCCR	0.95912	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36090	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36090	0	0
R7MY46	Ser/Thr phosphatase family protein	R7MY46_9FIRM	BN715_01071	Megasphaera elsdenii CAG:570	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, Megasphaera elsdenii CAG:570"			hydrolase activity [GO:0016787]	LEDTLRAGYTGRLEFER	0.95282	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	75522	319500	0	65383	87132	0	0	0	0	0	23555	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	165820	20681	27629	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	319500	87132	0	23555	0	0	0	0	0	165820	0	0	0
R7MZE7	ADP-ribosylglycohydrolase	R7MZE7_9FIRM	BN715_01456	Megasphaera elsdenii CAG:570	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, Megasphaera elsdenii CAG:570"			hydrolase activity [GO:0016787]	IIHPEQEK	0.95139	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28464	0	0	0	0	0	0	0	0	0	0	836610	62626	0	44064	0	13619	0	0	0	13589	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8442.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28464	0	0	0	836610	44064	0	13589	0	0	0	0	0	8442.3	0	0	0
R7N156	Malate/lactate dehydrogenase	R7N156_9FIRM	BN715_00187	Megasphaera elsdenii CAG:570	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, Megasphaera elsdenii CAG:570"			oxidoreductase activity [GO:0016491]	ACYYARK	0.95462	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R7N177	Cytidylyltransferase	R7N177_9FIRM	BN715_00186	Megasphaera elsdenii CAG:570	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, Megasphaera elsdenii CAG:570"	biosynthetic process [GO:0009058]		nucleotidyltransferase activity [GO:0016779]	CAPSQCSR	0.9535	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7002.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32648	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7002.5	0	0	0	0	32648	0	0
G0VPG0	Uncharacterized protein	G0VPG0_MEGEL	MELS_1116	Megasphaera elsdenii DSM 20460	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera elsdenii, Megasphaera elsdenii DSM 20460"				LERKYISMR	1.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	390860	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	390860	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
G0VPM6	Phenylalanine--tRNA ligase alpha subunit (EC 6.1.1.20) (Phenylalanyl-tRNA synthetase alpha subunit) (PheRS)	G0VPM6_MEGEL	pheS MELS_1182	Megasphaera elsdenii DSM 20460	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera elsdenii, Megasphaera elsdenii DSM 20460"	phenylalanyl-tRNA aminoacylation [GO:0006432]	cytoplasm [GO:0005737]	 magnesium ion binding [GO:0000287]; phenylalanine-tRNA ligase activity [GO:0004826]; tRNA binding [GO:0000049];ATP binding [GO:0005524]	FKVTQAGFIR	0.975	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64159	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64159
G0VSA5	Uncharacterized protein	G0VSA5_MEGEL	MELS_1927	Megasphaera elsdenii DSM 20460	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera elsdenii, Megasphaera elsdenii DSM 20460"				ESRTAEYK	0.9535	0	0	0	0	0	0	0	0	0	0	1207800	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25587	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1207800	0	0	0	0	0	0	0	0	0	0	0	0	0	25587	0	0	0	0
D3LTR9	N-acetyltransferase domain-containing protein	D3LTR9_9FIRM	HMPREF0889_1368	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"			N-acetyltransferase activity [GO:0008080]	PLTEKNMRYK	0.98387	0	0	3685.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8686	0	2888	0	0	0	0	0	0	0	0	0	0	0	0	0	64066	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25315	0	28236	0	0	3685.7	0	0	0	0	8686	2888	0	0	0	0	64066	0	0	0	0	0	0	0	0	25315	28236
D3LUP3	"ABC transporter, ATP-binding protein"	D3LUP3_9FIRM	HMPREF0889_1589	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"			 ATP binding [GO:0005524];ATPase activity [GO:0016887]	LDFSRELFEMDMKNYSDGQK	0.95491	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	179810	0	35138	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	179810	0	0	0	0	0	0	0	0	0	0	0	0	0
D3LUS9	Primosomal protein N' (EC 3.6.4.-) (ATP-dependent helicase PriA)	D3LUS9_9FIRM	priA HMPREF0889_1626	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"	" DNA unwinding involved in DNA replication [GO:0006268]"";""DNA replication, synthesis of RNA primer [GO:0006269]"	primosome complex [GO:1990077]	 DNA binding [GO:0003677]; DNA helicase activity [GO:0003678]; zinc ion binding [GO:0008270];ATP binding [GO:0005524]	EAECYHRCLLEQK	1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26447	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26447	0	0	0
D3LUT6	Small ribosomal subunit biogenesis GTPase RsgA (EC 3.6.1.-)	D3LUT6_9FIRM	rsgA HMPREF0889_1633	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"	ribosomal small subunit biogenesis [GO:0042274]	cytoplasm [GO:0005737]	 GTP binding [GO:0005525]; metal ion binding [GO:0046872]; rRNA binding [GO:0019843];GTPase activity [GO:0003924]	DEHIFRAR	0.95425	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	282240	0	83683	22514	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	282240	83683	0	0	0
D3LV44	Outer membrane protein	D3LV44_9FIRM	HMPREF0889_0377	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"			unfolded protein binding [GO:0051082]	LSSQSAQ	0.95451	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15329	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26740	0	0	23204	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15329	0	0	0	0	0	0	26740	23204	0	0	0	0
D3LVF3	Uncharacterized protein	D3LVF3_9FIRM	HMPREF0889_0277	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"				ALGHATFGDNGELYK	0.95506	0	0	0	7258.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7258.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
D3LVP7	"Peptidase, S41 family (EC 3.4.21.-)"	D3LVP7_9FIRM	HMPREF0889_1054	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"		integral component of membrane [GO:0016021]	serine-type peptidase activity [GO:0008236]	IRGPLGSK	0.95107	0	0	0	0	0	16882	0	0	0	0	0	54424	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35716	0	0	0	0	43871	0	0	18456	0	20256	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44471	0	0	23721	31758	0	45391	0	0	0	0	0	0	16882	0	54424	0	0	0	0	0	35716	43871	18456	20256	0	0	0	0	0	44471	31758	45391	0
D3LVR5	Aspartate--tRNA(Asp/Asn) ligase (EC 6.1.1.23) (Aspartyl-tRNA synthetase) (AspRS) (Non-discriminating aspartyl-tRNA synthetase) (ND-AspRS)	D3LVR5_9FIRM	aspS HMPREF0889_1072	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"	aspartyl-tRNA aminoacylation [GO:0006422]	cytoplasm [GO:0005737]	 aspartate-tRNA ligase activity [GO:0004815]; ATP binding [GO:0005524]; nucleic acid binding [GO:0003676];aspartate-tRNA(Asn) ligase activity [GO:0050560]	YLDLRRPEMQHNLIMR	0.9635	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54138	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13725	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54138	0	0	0	0	0	13725	0	0	0	0
D3LVU0	TrpR family protein YerC/YecD	D3LVU0_9FIRM	HMPREF0889_1097	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"			 sequence-specific DNA binding [GO:0043565];DNA-binding transcription factor activity [GO:0003700]	VDEDKHCR	0.95217	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73840	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73840	0	0	0
D3LVU1	Uncharacterized protein	D3LVU1_9FIRM	HMPREF0889_1098	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"				GWYEERAR	0.95202	0	0	0	0	0	0	0	0	0	0	0	0	0	0	65942	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	364060	61432	0	0	0	12746	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	65942	0	0	0	0	0	0	0	0	0	0	0	364060	12746	0	0	0	0
D3LX56	"Iron chelate uptake ABC transporter, FeCT family, permease protein"	D3LX56_9FIRM	HMPREF0889_0112	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"		 plasma membrane [GO:0005886];integral component of membrane [GO:0016021]	transmembrane transporter activity [GO:0022857]	TLGVHAAR	0.95492	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	96684	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	96684	0
D3LX58	TonB-dependent receptor plug domain protein (Fragment)	D3LX58_9FIRM	tonB HMPREF0889_0114	Megasphaera genomosp. type_1 str. 28L	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_1, Megasphaera genomosp. type_1 str. 28L"				WSSAVDVR	0.95563	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	93064	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	93064	0
A0A2J8B8T9	UPF0597 protein CAL30_06250	A0A2J8B8T9_9FIRM	CAL30_06250	Megasphaera genomosp. type_2	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera genomosp. type_2"		integral component of membrane [GO:0016021]		IEWDKNM	0.9575	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25298	0	0	0	0	0	0	0	0	0	0	0	0	0	18208	0	0	14854	0	17277	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25298	0	0	0	0	18208	17277
A0A344MGW0	Transglycosylas domain-containing protein	A0A344MGW0_9FIRM	ACT01_02245	Megasphaera hexanoica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera hexanoica"				SLYNWYK	0.95396	30316	31052	0	0	15697	32429	0	0	0	0	0	22406	0	0	23634	0	0	0	0	0	0	0	0	0	0	12546	0	0	0	0	0	0	0	23592	0	0	0	0	0	47142	16411	0	0	0	0	0	0	0	0	0	0	0	0	0	35710	15587	0	0	0	0	0	4161.5	0	0	0	30855	31052	32429	0	22406	23634	0	0	0	12546	0	0	23592	0	47142	0	0	0	0	35710	0	4161.5	30855
A0A344MIN1	Uncharacterized protein	A0A344MIN1_9FIRM	ACT01_05735	Megasphaera hexanoica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera hexanoica"				YYLKYMISGMYFKAEK	0.96502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21642	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21642	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A344MJY2	HNH domain-containing protein	A0A344MJY2_9FIRM	ACT01_08225	Megasphaera hexanoica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera hexanoica"			 nucleic acid binding [GO:0003676];endonuclease activity [GO:0004519]	LQEVREILFCDADFK	0.95744	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22752	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22752	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A344ML02	Uncharacterized protein	A0A344ML02_9FIRM	ACT01_10310	Megasphaera hexanoica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera hexanoica"				DGGRNWHEVATINADAHK	1.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3849.7	0	0	0	0	0	0	0	0	5574.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3849.7	0	0	5574.1	0	0	0	0
E2Z9D0	Uncharacterized protein	E2Z9D0_9FIRM	HMPREF9429_00028	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"				ADPSREYR	0.95131	0	0	0	0	2477.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10239	0	0	0	0	0	0	0	0	0	0	0	0	25375	10401	6360.8	0	0	0	4668.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1685.3	0	0	0	0	0	0	0	0	7105.5	9455.7	0	2477.8	0	0	0	0	10239	0	0	0	0	25375	0	4668.7	0	0	0	0	1685.3	0	0	9455.7
E2Z9V9	3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase)	E2Z9V9_9FIRM	waaA HMPREF9429_00215	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"	lipopolysaccharide core region biosynthetic process [GO:0009244]	 plasma membrane [GO:0005886];integral component of membrane [GO:0016021]	transferase activity [GO:0016740]	SEMVSGCK	0.95071	0	0	0	0	0	0	0	0	0	21007	0	0	0	0	0	0	0	0	58413	15701	0	0	36083	0	9331.3	0	15223	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24849	12496	11338	0	0	0	0	0	0	0	0	12635	0	0	0	0	0	0	0	0	0	0	0	0	21007	0	0	58413	36083	15223	0	0	0	0	0	0	24849	0	0	12635	0	0	0
E2ZAT6	DNA-binding helix-turn-helix protein	E2ZAT6_9FIRM	HMPREF9429_00554	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"			DNA binding [GO:0003677]	ISAAYDMPIDYIFFGPK	0.96156	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27344	0	0	0	0	0	0	0	0	0	0	36411	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38704	0	0	0	0	28421	0	29496	0	18462	0	0	0	0	27344	0	0	0	36411	0	0	0	0	0	0	0	0	0	38704	0	28421	29496
E2ZAT7	DNA-binding helix-turn-helix protein	E2ZAT7_9FIRM	HMPREF9429_00555	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"			DNA binding [GO:0003677]	FIFNYAEQMQRETLR	0.95122	0	0	0	0	12649	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46805	23527	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13726	0	0	0	0	0	0	0	0	0	0	0	0	12649	0	0	0	0	0	0	0	0	0	0	46805	0	0	0	0	0	13726	0	0	0
E2ZBK3	Uncharacterized protein	E2ZBK3_9FIRM	HMPREF9429_00833	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"				GGTDINGVR	0.95415	0	0	0	0	0	0	0	11591	14754	18002	0	0	0	0	0	1410500	14711	0	0	0	0	4677.3	0	0	0	0	0	119190	147860	91051	0	0	98008	0	0	0	0	0	14944	0	0	0	0	0	0	0	0	0	218660	0	49112	79301	141040	76755	11786	0	0	0	0	0	0	0	0	0	0	0	0	0	14754	18002	0	1410500	0	4677.3	0	147860	98008	0	14944	0	0	0	218660	141040	11786	0	0	0
E2ZC04	"Precorrin-6Y C5,15-methyltransferase (Decarboxylating), CbiT subunit (EC 2.1.1.132)"	E2ZC04_9FIRM	cbiT HMPREF9429_01174	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"	cobalamin biosynthetic process [GO:0009236]		" protein methyltransferase activity [GO:0008276]"";""precorrin-6Y C5,15-methyltransferase (decarboxylating) activity [GO:0046025]"	NCLEECLR	0.95116	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42487	7317	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42487
E2ZC72	"Dinuclear metal center protein, YbgI family"	E2ZC72_9FIRM	HMPREF9429_01243	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"				GESETQLR	0.95312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	617940	826320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	826320	0	0
E2ZCL4	"Glycosyltransferase, group 1 family protein (EC 2.4.-.-)"	E2ZCL4_9FIRM	HMPREF9429_00966	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"			"transferase activity, transferring glycosyl groups [GO:0016757]"	ARGVNDEFTK	0.9507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25423	90191	0	0	0	0	25699	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	90191	0	25699	0	0	0	0	0	0	0	0	0
E2ZCW0	"Transcriptional regulator, LysR family"	E2ZCW0_9FIRM	HMPREF9429_01064	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"			 DNA-binding transcription factor activity [GO:0003700];DNA binding [GO:0003677]	RWLAHQRLCEYITNTTGR	0.95032	0	0	3763.9	3824.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11575	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11126	0	0	0	0	0	25020	0	0	0	0	0	0	0	0	0	98451	129600	72511	3763.9	3824.6	0	0	0	0	0	0	0	11575	0	0	0	0	0	11126	0	25020	0	0	0	129600
E2ZDJ5	UDP-N-acetylglucosamine 2-epimerase (EC 5.1.3.14)	E2ZDJ5_9FIRM	HMPREF9429_01498	Megasphaera micronuciformis F0359	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera micronuciformis, Megasphaera micronuciformis F0359"			UDP-N-acetylglucosamine 2-epimerase activity [GO:0008761]	QIDFEQHR	0.95494	0	0	0	0	0	0	0	0	0	0	0	316570	0	0	0	0	0	0	37764	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47162	0	0	0	0	0	0	0	0	0	0	0	130120	73239	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	316570	0	0	37764	0	0	0	0	0	47162	0	0	0	130120	73239	0	0	0	0
A0A1G9Q3X1	Transcription termination/antitermination protein NusA	A0A1G9Q3X1_9FIRM	nusA SAMN05660299_00103	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"	" transcription antitermination [GO:0031564]"";""DNA-templated transcription, termination [GO:0006353]"	cytoplasm [GO:0005737]	 RNA binding [GO:0003723];DNA-binding transcription factor activity [GO:0003700]	NKESLYEIASLLKENM	0.964	0	0	0	0	0	434040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	434040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1G9Q8N1	Methyltrn_RNA_4 domain-containing protein	A0A1G9Q8N1_9FIRM	SAMN05660299_00149	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				LAGEAWWNQ	0.9578	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21777	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21777	0	0
A0A1G9Q8N7	tRNA (guanine-N(1)-)-methyltransferase (EC 2.1.1.228) (M1G-methyltransferase) (tRNA [GM37] methyltransferase)	A0A1G9Q8N7_9FIRM	trmD SAMN05660299_00150	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"		cytoplasm [GO:0005737]	tRNA (guanine(37)-N(1))-methyltransferase activity [GO:0052906]	INAWRHRQSVQR	0.95704	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14317	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17958	16053	23804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14317	0	0	0	0	0	23804	0	0	0
A0A1G9QBI5	Uncharacterized protein	A0A1G9QBI5_9FIRM	SAMN05660299_00179	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				SIALFHR	0.95466	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57040	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	57040	0	0	0	0	0	0	0	0	0
A0A1G9QCY2	Uncharacterized protein	A0A1G9QCY2_9FIRM	SAMN05660299_00194	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				AHLANEVR	0.95479	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52293	0	0	0	0	0	0	0	0	0	0	0	0	0	31210	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	52293	0	0	0	0	31210	0	0	0	0	0	0	0
A0A1G9QEH6	Uncharacterized protein	A0A1G9QEH6_9FIRM	SAMN05660299_00211	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				LGVATEPR	0.95009	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33830	0	0	0	0	29471	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33830	29471	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1G9R5H6	HD domain-containing protein	A0A1G9R5H6_9FIRM	SAMN05660299_00378	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				LDLTREER	0.95134	66838	0	35555	0	0	40657	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17158	0	0	9693.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	66838	40657	0	0	0	0	0	0	0	17158	9693.2	0	0	0	0	0	0	0	0	0	0	0
A0A1G9RW52	Uncharacterized protein	A0A1G9RW52_9FIRM	SAMN05660299_00549	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				HMYFGLFK	0.95287	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32913	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32913	0	0	0	0	0	54020	0	0	0
A0A1G9SGR8	Butyryl-CoA dehydrogenase	A0A1G9SGR8_9FIRM	SAMN05660299_00716	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"			" oxidoreductase activity, acting on the CH-CH group of donors [GO:0016627]"";""flavin adenine dinucleotide binding [GO:0050660]"	QQQETGFR	0.95272	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17233	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11895	0	0	0	0	0	17233	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11895
A0A1G9T5W0	Release factor glutamine methyltransferase (RF MTase) (EC 2.1.1.297) (N5-glutamine methyltransferase PrmC) (Protein-(glutamine-N5) MTase PrmC) (Protein-glutamine N-methyltransferase PrmC)	A0A1G9T5W0_9FIRM	prmC SAMN05660299_00883	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"	peptidyl-glutamine methylation [GO:0018364]		 protein-(glutamine-N5) methyltransferase activity [GO:0102559]; protein-glutamine N-methyltransferase activity [GO:0036009];nucleic acid binding [GO:0003676]	DYGDIER	0.95598	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15970	0	0	0	0	0	0	0	0	0	0	0	12140	0	0	22358	0	0	0	0	0	0	0	11232	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15970	0	0	0	12140	22358	0	11232	0	0	0	0	0	0	0	0	0
A0A1G9TXR7	Threonine synthase	A0A1G9TXR7_9FIRM	SAMN05660299_01049	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				EEFSGGWIDDDETR	0.9599	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51074	0	0	0	0	0	39441	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51074	0	39441	0	0	0
A0A1G9UWZ9	CRISPR-associated protein Csd1	A0A1G9UWZ9_9FIRM	SAMN05660299_01289	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				VCDIIEDK	0.9534	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	119570	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	119570	0
A0A1G9V8A9	PpGpp synthetase catalytic domain-containing protein (RelA/SpoT-type nucleotidyltranferase)	A0A1G9V8A9_9FIRM	SAMN05660299_01365	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"	guanosine tetraphosphate metabolic process [GO:0015969]			VVQEKDYIKHVK	0.95556	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	124130	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	146900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	124130	0	0	0	0	0	0	0	146900	0	0	0
A0A1G9W4L9	SWIM zinc finger	A0A1G9W4L9_9FIRM	SAMN05660299_01549	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"			zinc ion binding [GO:0008270]	ICQRWWGIAWCR	0.95552	510940	84500	0	0	0	0	0	0	0	0	0	0	0	0	4135.9	0	0	0	0	0	0	0	0	0	0	0	0	19924	0	0	0	0	0	0	9698.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4631.4	0	0	0	0	0	0	0	0	510940	0	0	0	4135.9	0	0	0	0	19924	0	9698.3	0	0	0	0	0	0	0	4631.4	0	0
A0A1G9WAU4	Phosphonate transport system substrate-binding protein	A0A1G9WAU4_9FIRM	SAMN05660299_01577	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				THTAPLGK	0.95346	0	0	0	0	0	0	0	0	0	0	567860	0	178550	16936	0	0	0	863210	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	77595	35388	0	0	0	0	0	0	0	0	0	0	51071	5548	0	0	0	0	0	0	0	0	0	0	567860	178550	863210	0	0	0	0	0	0	0	0	0	77595	0	0	0	51071	0	0
A0A1G9WY47	Site-specific recombinase XerD	A0A1G9WY47_9FIRM	SAMN05660299_01700	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"	 DNA recombination [GO:0006310];DNA integration [GO:0015074]		DNA binding [GO:0003677]	NINDFEK	0.95548	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23201	0	29081	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29081
A0A1G9XJ19	Periplasmic chaperone for outer membrane proteins Skp	A0A1G9XJ19_9FIRM	SAMN05660299_01835	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"			unfolded protein binding [GO:0051082]	GQATDKDK	0.95376	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	212460	0	0	0	0	0	0	250290	0	0	0	54564	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	212460	0	250290	54564	0
A0A1G9Y521	Uncharacterized protein	A0A1G9Y521_9FIRM	SAMN05660299_01990	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				LFYFDHR	0.95455	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16732	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16732	0
A0A1G9YFU6	Xylulokinase	A0A1G9YFU6_9FIRM	SAMN05660299_02062	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"	carbohydrate metabolic process [GO:0005975]		" phosphotransferase activity, alcohol group as acceptor [GO:0016773]"";""kinase activity [GO:0016301]"	LEYYTDEERHCISKDFR	0.95295	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22502	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22502	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1G9YJV5	Uncharacterized protein	A0A1G9YJV5_9FIRM	SAMN05660299_02100	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				EWREHEGDRHWR	0.95	0	0	0	0	0	0	0	0	20141	0	0	9136.8	69569	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48286	16414	34132	0	0	20141	9136.8	69569	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48286
A0A1H0A9F9	"Uncharacterized conserved protein, DUF362 family"	A0A1H0A9F9_9FIRM	SAMN05660299_02485	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				EKRHFHTLGLHR	0.9553	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34550	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34550	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1H0ATJ2	"Uncharacterized protein, YigZ family"	A0A1H0ATJ2_9FIRM	SAMN05660299_02589	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"				SEQPIER	0.954	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30820	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30820	0	0
A0A1H0AWC4	Butyryl-CoA:acetate CoA-transferase	A0A1H0AWC4_9FIRM	SAMN05660299_02610	Megasphaera paucivorans	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera paucivorans"	" propionate metabolic process, methylcitrate cycle [GO:0019679]"";""acetate metabolic process [GO:0006083]"		 acetyl-CoA hydrolase activity [GO:0003986];acetate CoA-transferase activity [GO:0008775]	ETFTVSNWHMSGYDRKK	0.95195	0	0	0	0	0	0	0	0	0	0	0	0	0	0	110470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	110470	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3C1CNE9	Pseudouridine synthase (EC 5.4.99.-)	A0A3C1CNE9_9FIRM	DCP59_02015	Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp."	pseudouridine synthesis [GO:0001522]		 RNA binding [GO:0003723];pseudouridine synthase activity [GO:0009982]	KKLYYLFNK	0.96509	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18939	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18939	0	0	0	0
A0A3C1CNS4	23S rRNA (Uracil(1939)-C(5))-methyltransferase RlmD	A0A3C1CNS4_9FIRM	DCP59_02630	Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp."	RNA processing [GO:0006396]		RNA methyltransferase activity [GO:0008173]	AVTEGPLR	0.95409	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	285670	0	0	0	0	0	29471	0	122170	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	285670	0	29471	122170	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3C1CNW1	Autotransporter domain-containing protein (Fragment)	A0A3C1CNW1_9FIRM	DCP59_02830	Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp."		outer membrane [GO:0019867]		YGHYNYRWNFYQLGYDR	0.95144	639650	0	0	0	28273	0	0	0	0	0	0	13611	0	0	0	8222.9	0	0	0	0	0	0	0	0	0	14067	7242.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	639650	28273	0	13611	0	8222.9	0	0	14067	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A3C1CQY7	Uncharacterized protein	A0A3C1CQY7_9FIRM	DCP59_05445	Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp."				ASYTYWWK	0.95056	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	485920	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23082	0	0	0	4343.9	136260	131860	0	11238	13359	0	0	0	0	0	0	0	0	0	0	485920	0	0	0	0	0	0	0	0	0	23082	0	136260	13359	0
A0A3C1CQZ1	Hydrophobe/amphiphile efflux-1 family RND transporter	A0A3C1CQZ1_9FIRM	DCP59_05100	Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp."	xenobiotic transport [GO:0042908]	integral component of membrane [GO:0016021]	efflux transmembrane transporter activity [GO:0015562]	EPKGANK	0.95713	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50301	176910	451470	34459	0	329510	0	0	0	0	0	0	0	0	9007.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	451470	329510	0	0	9007.6	0	0	0
A0A413QP97	Uncharacterized protein (Fragment)	A0A413QP97_9FIRM	DW949_13285	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"	pathogenesis [GO:0009405]	outer membrane [GO:0019867]		PEDMLISIDGNEAR	0.95134	0	0	0	0	21567	0	0	0	0	0	0	0	0	0	22925	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	143700	0	182030	0	0	0	0	0	15640	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32747	32902	48742	0	21567	0	0	22925	0	0	0	0	0	0	182030	0	15640	0	0	0	0	0	0	0	48742
A0A413QPB0	Bacterio-opsin activator	A0A413QPB0_9FIRM	DW949_13270	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"				IDQNKENTM	0.95695	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17825	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17825	0	0
A0A413QPE2	M48 family peptidase	A0A413QPE2_9FIRM	DW949_13245	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"			DNA binding [GO:0003677]	LIELGYPK	0.9537	67333	0	0	0	0	10532	0	0	0	0	0	0	4360.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10491	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67333	10532	0	0	4360.4	0	0	0	0	0	0	10491	0	0	0	0	0	0	0	0	0	0
A0A413QR00	2-dehydropantoate 2-reductase (EC 1.1.1.169) (Ketopantoate reductase)	A0A413QR00_9FIRM	DW949_11590	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"	pantothenate biosynthetic process [GO:0015940]		2-dehydropantoate 2-reductase activity [GO:0008677]	MAFAGSR	0.95326	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24285	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24285	0	0	0	0	0	0	0	0	0	0	0
A0A413QTA0	YadA_anchor domain-containing protein	A0A413QTA0_9FIRM	DW949_09950	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"				DKEGNYTGDYKVSDDNK	0.95238	0	0	0	0	0	181520	0	0	0	0	0	0	0	5703.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	181520	0	0	5703.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A413QUV3	MarR family transcriptional regulator	A0A413QUV3_9FIRM	DW949_07690	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"			DNA-binding transcription factor activity [GO:0003700]	EILAEENR	0.95192	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	116830	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	116830	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A413QVE8	Uncharacterized protein	A0A413QVE8_9FIRM	DW949_07355	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"				LLEEYPCR	0.95315	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	170320	0	21904	0	0	0	30511	13924	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23848	5250.1	0	0	0	0	4845.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	170320	0	30511	0	0	0	0	0	23848	0	4845.9	0	0	0
A0A413QVN4	DUF3298 domain-containing protein	A0A413QVN4_9FIRM	DW949_07430	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"				DAHPTHWK	0.95425	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16618	0	0	0	0	0	0	0	0	0	0	0	0	0	0	119310	63337	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16618	0	0	0	0	119310	0	0	0	0	0	0	0	0	0	0
A0A413QWH8	D-alanyl-D-alanine carboxypeptidase	A0A413QWH8_9FIRM	DW949_07110	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"			serine-type D-Ala-D-Ala carboxypeptidase activity [GO:0009002]	ASAAVAK	0.95594	0	0	0	0	14114	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20580	0	18944	0	0	0	0	0	0	0	0	0	0	0	0	33682	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14114	0	0	0	0	0	0	0	0	0	20580	0	0	0	0	33682	0	0	0	0	0
A0A413QYN8	Uncharacterized protein	A0A413QYN8_9FIRM	DW949_04860	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"				DYEKCIKHEPDEQCCNIINGDK	0.95047	90333	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	90333	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A413R0P9	Uncharacterized protein	A0A413R0P9_9FIRM	DW949_02635	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"				VINVADPK	0.95053	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	198430	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	198430	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A413R0R1	Transglycosylas domain-containing protein	A0A413R0R1_9FIRM	DW949_02630	Megasphaera sp. AM44-1BH	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. AM44-1BH"				AEVPTDNR	0.9567	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	187790	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	187790	0	0
A0A1Y4CIK2	Proline reductase cluster protein PrdD	A0A1Y4CIK2_9FIRM	B5F80_07345	Megasphaera sp. An286	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. An286"				DAVETYVYKEESHPGK	0.95627	111270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	111270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1Y4CP06	Colicin receptor	A0A1Y4CP06_9FIRM	B5F80_01810	Megasphaera sp. An286	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. An286"		 integral component of membrane [GO:0016021];cell outer membrane [GO:0009279]		DSKEWYNYKR	0.95479	0	55702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	55702	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2A2IMP4	NADH-dependent phenylglyoxylate	A0A2A2IMP4_9FIRM	CJ260_08925	Megasphaera sp. ASD88	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. ASD88"			 thiamine pyrophosphate binding [GO:0030976];catalytic activity [GO:0003824]	NGAVQMR	0.95583	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	74362	0	28004	34255	0	0	0	0	15145	0	0	0	0	0	0	0	0	0	0	0	31879	4905.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	74362	34255	0	15145	0	0	0	31879	0	0	0	0	0
A0A2A2INK4	Glutamate 5-kinase (EC 2.7.2.11) (Gamma-glutamyl kinase) (GK)	A0A2A2INK4_9FIRM	proB CJ260_06985	Megasphaera sp. ASD88	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. ASD88"	L-proline biosynthetic process [GO:0055129]	cytoplasm [GO:0005737]	 glutamate 5-kinase activity [GO:0004349]; RNA binding [GO:0003723];ATP binding [GO:0005524]	DATFWTGVEEGQCRR	0.95701	0	0	0	0	0	0	0	46960	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44699	0	0	0	26776	28745	0	28557	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	46960	0	0	0	0	0	0	0	0	0	0	0	44699	0	28745	28557	0	0	0	0
A0A2A2IRP2	Phage_integrase domain-containing protein	A0A2A2IRP2_9FIRM	CJ260_00810	Megasphaera sp. ASD88	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. ASD88"	 DNA recombination [GO:0006310];DNA integration [GO:0015074]		DNA binding [GO:0003677]	EVLPRWR	0.95142	0	0	0	0	0	0	85644	0	0	0	0	0	0	0	0	0	224870	59081	0	0	0	0	0	0	0	0	0	0	0	189240	0	0	0	0	0	0	0	0	0	0	0	0	36304	0	27068	0	0	0	0	23986	0	0	0	0	0	0	0	0	0	0	0	0	0	23649	0	0	0	0	85644	0	0	224870	0	0	0	189240	0	0	0	0	36304	0	23986	0	0	0	0	23649
U7UB24	Putative transcriptional repressor CcpN	U7UB24_9FIRM	HMPREF1250_1532	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"				VSLLKDK	0.95154	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12301	28452	0	68288	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	56403	0	0	0	0	0	0	0	0	0	0	0	12301	68288	0	0	0	0	0	0	0	0	0	0	0	0	56403	0
U7UDG7	RelA/SpoT domain protein	U7UDG7_9FIRM	HMPREF1250_1505	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"	guanosine tetraphosphate metabolic process [GO:0015969]			DEGKAEG	0.95311	0	0	0	0	349380	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	349380	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
U7UFZ1	"Peptidase, U32 family (EC 3.4.-.-)"	U7UFZ1_9FIRM	HMPREF1250_0045	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"			peptidase activity [GO:0008233]	AELREHDLNHAK	0.95455	0	0	0	0	0	11537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9669.1	0	0	13174	15296	28058	35498	0	0	0	0	0	0	0	0	0	0	0	0	0	41460	0	0	0	0	0	28288	0	0	232160	13489	15903	0	7736	0	0	0	11537	0	0	0	0	0	0	0	0	9669.1	28058	35498	0	0	0	41460	0	28288	232160	15903	7736
U7ULI2	Phosphodiesterase family protein (EC 3.1.-.-)	U7ULI2_9FIRM	HMPREF1250_0973	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"			hydrolase activity [GO:0016787]	ELCRLFR	0.95673	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19873	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19873	0
U7UQ55	PF04286 family protein	U7UQ55_9FIRM	HMPREF1250_0586	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"		integral component of membrane [GO:0016021]		IHWDDNFQIQEKKTWLR	0.9534	0	0	22034	0	0	0	0	0	0	0	0	0	0	0	0	124430	0	0	0	0	0	0	0	0	0	0	0	67759	0	70477	0	0	0	29459	0	22360	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39405	0	0	0	0	26995	0	43358	0	22034	0	0	0	0	124430	0	0	0	70477	0	29459	0	0	0	0	0	0	0	39405	26995	43358
U7UR21	"CRISPR-associated endonuclease Cas1, subtype I-F/YPEST"	U7UR21_9FIRM	cas1f HMPREF1250_2271	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"	 maintenance of CRISPR repeat elements [GO:0043571];defense response to virus [GO:0051607]		 metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676];endodeoxyribonuclease activity [GO:0004520]	CAYLQHVWEKDR	0.96491	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15124	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23624	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15124	0	0	0	0	0	0	0	0	23624	0	0	0	0	0	0	0
U7URD2	Uncharacterized protein	U7URD2_9FIRM	HMPREF1250_1951	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"		integral component of membrane [GO:0016021]		LGLMAAR	0.96211	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14120	19947	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19947	0	0
U7URU9	SLH domain protein	U7URU9_9FIRM	HMPREF1250_2050	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"				STGLNDDNSWDYRIR	0.95759	0	14135	7849.4	20922	20518	37313	31276	45123	94744	0	114890	63518	497390	202320	304390	0	72978	0	0	0	0	0	0	0	48138	46323	0	626270	6592.1	190120	33744	14121	28091	109510	0	0	0	0	19421	14335	11478	136700	79940	0	111600	0	12376	0	25719	27580	0	57198	0	54508	350090	7693.6	16610	0	10050	0	0	0	0	0	0	0	14135	37313	94744	114890	497390	72978	0	0	48138	626270	33744	109510	19421	136700	111600	12376	27580	57198	350090	10050	0	0
U7USJ9	DegT/DnrJ/EryC1/StrS aminotransferase family protein	U7USJ9_9FIRM	HMPREF1250_0557	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"			transaminase activity [GO:0008483]	NRMDDAWPR	0.9569	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	82344	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	82344	0	0	0
U7UTH6	HipA-like C-terminal domain protein	U7UTH6_9FIRM	HMPREF1250_2206	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"				AMLCDAFR	0.95022	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64469	0	0	0	0	0	0	0	0	0	0	0	0	9991	0	16331	10326	0	0	0	0	0	0	0	0	0	0	0	0	66894	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64469	0	0	0	9991	16331	0	0	0	0	66894	0	0	0
U7UTX5	Uncharacterized protein	U7UTX5_9FIRM	HMPREF1250_2077	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"				KVLHFILK	0.95069	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22804	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19529	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22804	0	0	0	0	0	0	19529	0	0	0	0
U7UU04	"Putative phage terminase, large subunit"	U7UU04_9FIRM	HMPREF1250_0247	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"				WGGLMPR	0.96376	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6540.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6540.7	0	0	0	0	0	0	0	0	0	0
U7UV75	"Portal protein, HK97 family"	U7UV75_9FIRM	HMPREF1250_0249	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"				EAKQAMR	0.95504	0	0	0	0	0	0	0	0	84481	180040	183400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	84481	183400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
U7UVK1	"Peptidase, M48 family (EC 3.4.24.-)"	U7UVK1_9FIRM	HMPREF1250_1299	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"			metalloendopeptidase activity [GO:0004222]	AEDTSVGK	0.95022	0	0	0	0	0	0	0	122630	528140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	528140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
U7UVL4	CobW/P47K family protein	U7UVL4_9FIRM	HMPREF1250_1243	Megasphaera sp. BV3C16-1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. BV3C16-1"				EWDDVRPR	0.95195	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38130	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38130	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1B8WSZ9	Uncharacterized protein	A0A1B8WSZ9_9FIRM	A0U42_02245	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"			aminopeptidase activity [GO:0004177]	KTCTVTSKNGTNFTCSIADR	0.95569	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25998	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25998	0	0	0	0	0	0	0	0	0
A0A1B8WT20	Transcriptional regulator	A0A1B8WT20_9FIRM	A0U42_02645	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"	"regulation of transcription, DNA-templated [GO:0006355]"		 DNA binding [GO:0003677]; transcription factor binding [GO:0008134];ATP binding [GO:0005524]	HQDEYKRK	0.95113	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	66789	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	66789	0	0	0	0
A0A1B8WTK5	Flagellar motor protein MotB	A0A1B8WTK5_9FIRM	A0U42_10895	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"		membrane [GO:0016020]		VDADVSK	0.95753	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30373	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30373	0	0	0	0	0	0	0	0
A0A1B8WVN6	Uncharacterized protein	A0A1B8WVN6_9FIRM	A0U42_08400	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"				ALSYTINM	0.9541	0	0	0	0	0	0	0	0	0	0	117530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	117530	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1B8WW26	HAD family hydrolase	A0A1B8WW26_9FIRM	A0U42_07130	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"			hydrolase activity [GO:0016787]	GRMAYTPCEETTLDFIR	0.95112	0	60654	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60654	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1B8WW48	Polysacc_synt_C domain-containing protein	A0A1B8WW48_9FIRM	A0U42_07420	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"		integral component of membrane [GO:0016021]		FYRSMMNR	0.95543	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	115450	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	115450	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1B8WWG7	DNA replication and repair protein RecF	A0A1B8WWG7_9FIRM	recF A0U42_06615	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"	 DNA replication [GO:0006260]; SOS response [GO:0009432];DNA repair [GO:0006281]	cytoplasm [GO:0005737]	 single-stranded DNA binding [GO:0003697];ATP binding [GO:0005524]	IQNEYRNR	0.95554	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	121780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4498.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	121780	0	0	0	0	0	0	0	0	0	0	4498.1	0	0
A0A1B8WWL5	Radical SAM protein	A0A1B8WWL5_9FIRM	A0U42_05820	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"			 iron-sulfur cluster binding [GO:0051536];catalytic activity [GO:0003824]	IPVLAADR	0.95431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	135210	86018	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	75306	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	135210	0	0	0	0	0	0	75306	0
A0A1B8WWM5	Acyl-CoA dehydrogenase	A0A1B8WWM5_9FIRM	A0U42_06100	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"			 flavin adenine dinucleotide binding [GO:0050660];acyl-CoA dehydrogenase activity [GO:0003995]	DEVVGPLR	0.9568	0	0	0	0	0	0	0	0	0	0	0	0	42123	0	0	0	0	0	0	0	0	0	0	0	6803.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42123	0	0	0	6803.1	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1B8WWP1	Hydrolase	A0A1B8WWP1_9FIRM	A0U42_05785	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"			hydrolase activity [GO:0016787]	QKAQLTEVTHDSVSGDR	0.95249	0	0	73604	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73604	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1B8WWP3	Methyltransferase type 12	A0A1B8WWP3_9FIRM	A0U42_06025	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"	" regulation of transcription, DNA-templated [GO:0006355]"";""methylation [GO:0032259]"		 metal ion binding [GO:0046872]; methyltransferase activity [GO:0008168];DNA binding [GO:0003677]	LLFESLIRTNKR	0.95559	0	0	0	0	0	0	0	0	0	107420	0	96814	0	0	0	0	0	0	0	0	0	0	0	0	0	0	58310	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	107420	0	0	0	0	58310	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A1B8WXF6	Uncharacterized protein	A0A1B8WXF6_9FIRM	A0U42_05215	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"				EDPKEEVK	0.95857	0	0	0	0	0	0	0	0	0	21324	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28656	0	0	0	3031.3	0	0	16644	0	0	0	0	0	0	0	0	0	0	21324	0	0	0	0	0	0	0	0	0	0	0	0	0	28656	3031.3	16644	0	0
A0A1B8WXQ0	Toxin	A0A1B8WXQ0_9FIRM	A0U42_04200	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"				EDLPYYR	0.95422	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14284	14996	0	0	0	0	0	0	0	0	0	20889	0	0	0	0	12487	0	8714.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23262	25308	0	0	0	0	0	0	0	0	0	0	14996	0	0	0	20889	12487	8714.1	0	0	0	0	0	0	0	25308	0
A0A1B8WXZ8	Uncharacterized protein	A0A1B8WXZ8_9FIRM	A0U42_03975	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"				SQIQGGAGIQFASCNR	0.95143	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38083	0	0	0	0	0	88306	0	7111.9	0	22206	0	0	0	9738.3	0	0	0	0	33888	0	0	0	0	0	0	0	10904	0	0	0	0	0	0	55566	0	0	0	0	0	0	0	0	0	0	0	38083	0	88306	7111.9	22206	9738.3	0	33888	0	10904	0	0	55566
A0A1B8WYH2	Fe-S cluster assembly protein SufD	A0A1B8WYH2_9FIRM	A0U42_03525	Megasphaera sp. DISK 18	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. DISK 18"	iron-sulfur cluster assembly [GO:0016226]			VNYLELDR	0.95066	0	0	0	0	0	0	0	0	0	0	0	513920	0	0	3388.8	0	60248	0	0	0	0	0	0	0	0	23211	0	0	0	0	0	0	0	0	0	0	0	0	14163	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5761.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	513920	3388.8	60248	0	0	23211	0	0	0	14163	0	0	0	0	5761.8	0	0	0	0
A0A133SC49	CRISPR-associated endonuclease Cas1	A0A133SC49_9FIRM	HMPREF3201_02074	Megasphaera sp. MJR8396C	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. MJR8396C"	 maintenance of CRISPR repeat elements [GO:0043571];defense response to virus [GO:0051607]		 metal ion binding [GO:0046872]; nucleic acid binding [GO:0003676];endonuclease activity [GO:0004519]	DDFFFTERNR	0.95271	0	0	0	2719.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2719.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A133SDF1	Uncharacterized protein	A0A133SDF1_9FIRM	HMPREF3201_01904	Megasphaera sp. MJR8396C	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. MJR8396C"				FTFYYFDGWPACKRK	0.95617	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70407	358070	0	19966	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70407	358070	0	0	0	0	0	0	0	0	0	0
A0A133SGS1	CRISPR-associated protein	A0A133SGS1_9FIRM	HMPREF3201_01619	Megasphaera sp. MJR8396C	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. MJR8396C"				HDTFDERR	0.95024	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42751	0	0	0	0	10787	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42751	0	10787
A0A133SH60	4-alpha-glucanotransferase (EC 2.4.1.25) (Amylomaltase) (Disproportionating enzyme)	A0A133SH60_9FIRM	HMPREF3201_01485	Megasphaera sp. MJR8396C	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. MJR8396C"			" beta-maltose 4-alpha-glucanotransferase activity [GO:0102500]; hydrolase activity, hydrolyzing O-glycosyl compounds [GO:0004553]"";""4-alpha-glucanotransferase activity [GO:0004134]"	ELYPKLEQIK	2	0	0	0	0	0	0	0	0	0	75365	251370	0	0	0	0	11244	0	0	0	18450	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	145840	12877	5307.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	251370	0	11244	18450	0	0	0	0	0	0	0	0	0	145840	0	0	0	0	0
A0A133SI93	"Alcohol dehydrogenase, iron-dependent"	A0A133SI93_9FIRM	HMPREF3201_01075	Megasphaera sp. MJR8396C	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. MJR8396C"			 oxidoreductase activity [GO:0016491];metal ion binding [GO:0046872]	TVSQNDPK	0.95053	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	92790	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	92790	0	0	0
A0A133SIW5	"TRAP transporter, DctQ-like membrane protein"	A0A133SIW5_9FIRM	HMPREF3201_00778	Megasphaera sp. MJR8396C	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. MJR8396C"		integral component of membrane [GO:0016021]		SIQSWVMR	0.95296	0	0	0	0	0	0	0	0	0	0	0	179400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	179400	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A133SJ77	"Lipid kinase, YegS/Rv2252/BmrU family"	A0A133SJ77_9FIRM	HMPREF3201_00735	Megasphaera sp. MJR8396C	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. MJR8396C"			NAD+ kinase activity [GO:0003951]	AETRELEVDDFMNELR	0.965	0	169900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	169900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A133SKM1	NifU-like protein	A0A133SKM1_9FIRM	HMPREF3201_00285	Megasphaera sp. MJR8396C	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. MJR8396C"	iron-sulfur cluster assembly [GO:0016226]		 iron-sulfur cluster binding [GO:0051536];iron ion binding [GO:0005506]	TDVSNDIR	0.95071	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	826320	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	826320	0	0
A0A133SKN1	CBS domain protein	A0A133SKN1_9FIRM	HMPREF3201_00220	Megasphaera sp. MJR8396C	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. MJR8396C"				LPLHKPSR	0.95207	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	110510	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19336	0	0	9595.7	0	0	0	0	0	0	0	0	110510	0	0	0	0	0	0	0	0	0	0	0	0	19336	9595.7
S7HFC0	Transcriptional regulator	S7HFC0_9FIRM	NM10_12500	Megasphaera sp. NM10	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. NM10"			 DNA-binding transcription factor activity [GO:0003700];DNA binding [GO:0003677]	ENLELFEK	0.95408	0	0	0	0	0	0	0	0	18752	0	0	0	51401	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11644	12079	0	0	16529	11366	0	0	0	0	17331	7499.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18752	0	51401	0	0	0	0	0	0	0	0	0	12079	16529	0	17331	0	0	0	0
S7HH64	Demethylmenaquinone methyltransferase (EC 2.1.1.163)	S7HH64_9FIRM	menG NM10_10270	Megasphaera sp. NM10	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. NM10"	 methylation [GO:0032259];menaquinone biosynthetic process [GO:0009234]		S-adenosylmethionine:2-demethylmenaquinol-7 methyltransferase activity [GO:0102955]	QEYTWLWQSTQDFLRKK	0.95155	0	0	0	0	0	0	0	0	2319.1	0	0	0	0	0	0	16767	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64951	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2319.1	0	0	16767	0	0	0	0	64951	0	0	0	0	0	0	0	0	0	0	0
S7HLT0	Anaerobic sulfite reductase subunit B	S7HLT0_9FIRM	NM10_07664	Megasphaera sp. NM10	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. NM10"	pyrimidine nucleotide biosynthetic process [GO:0006221]		" flavin adenine dinucleotide binding [GO:0050660]; metal ion binding [GO:0046872]; oxidoreductase activity [GO:0016491]"";""2 iron, 2 sulfur cluster binding [GO:0051537]"	LILEQISK	0.95	0	0	0	0	0	0	4956.4	3659.7	3880.8	0	32105	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4956.4	32105	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
S7HS85	Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18)	S7HS85_9FIRM	mutM fpg NM10_02744	Megasphaera sp. NM10	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. NM10"	 nucleotide-excision repair [GO:0006289];base-excision repair [GO:0006284]		 damaged DNA binding [GO:0003684]; oxidized purine nucleobase lesion DNA N-glycosylase activity [GO:0008534]; zinc ion binding [GO:0008270];class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]	GRVEDLFR	0.9506	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	126060	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	126060	0	0	0	0	0	0	0	0	0	0	0
S7HT05	Na+/solute symporter	S7HT05_9FIRM	NM10_02095	Megasphaera sp. NM10	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. NM10"		integral component of membrane [GO:0016021]	transmembrane transporter activity [GO:0022857]	ITVTMKKYDSMNPDIFK	0.95386	0	18299	0	0	0	0	0	0	0	0	0	0	0	0	54330	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42015	0	0	18299	0	0	0	54330	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42015
S7J3K9	LysM domain-containing protein	S7J3K9_9FIRM	NM10_03271	Megasphaera sp. NM10	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. NM10"				GEVTYYTK	0.95262	0	0	0	0	0	0	0	58431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	134680	71085	51602	27860	0	0	0	0	0	0	0	0	0	0	0	58431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	134680	71085	0	0	0
S7J3L8	Phage integrase	S7J3L8_9FIRM	NM10_03321	Megasphaera sp. NM10	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. NM10"	 DNA recombination [GO:0006310];DNA integration [GO:0015074]		DNA binding [GO:0003677]	LMGTYYALVCPMHIRPGAPK	0.95472	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28270	76859	0	24458	0	0	0	0	0	0	0	28256	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	76859	24458	0	28256	0	0	0	0	0	0	0	0	0
F9MM69	Formamidopyrimidine-DNA glycosylase (Fapy-DNA glycosylase) (EC 3.2.2.23) (DNA-(apurinic or apyrimidinic site) lyase MutM) (AP lyase MutM) (EC 4.2.99.18)	F9MM69_9FIRM	mutM fpg HMPREF1040_0751	Megasphaera sp. UPII 135-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. UPII 135-E"	 nucleotide-excision repair [GO:0006289];base-excision repair [GO:0006284]		 damaged DNA binding [GO:0003684]; oxidized purine nucleobase lesion DNA N-glycosylase activity [GO:0008534]; zinc ion binding [GO:0008270];class I DNA-(apurinic or apyrimidinic site) endonuclease activity [GO:0140078]	CPCPSGK	0.95163	0	138000	0	0	0	0	24919	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8595.7	0	4054	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3700.8	0	0	0	0	0	0	0	0	0	0	0	0	138000	0	24919	0	0	0	0	0	0	0	0	8595.7	4054	0	0	0	0	3700.8	0	0	0	0
F9MMH1	Putative lipoprotein	F9MMH1_9FIRM	HMPREF1040_0173	Megasphaera sp. UPII 135-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. UPII 135-E"				NEQRQNQR	0.95281	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49152	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49152	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F9MMP9	Uncharacterized protein	F9MMP9_9FIRM	HMPREF1040_0255	Megasphaera sp. UPII 135-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. UPII 135-E"		integral component of membrane [GO:0016021]		LSEESTTFTESHIMR	0.96141	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7201.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7201.1	0	0	0	0	0	0	0
F9MMS1	Uncharacterized protein	F9MMS1_9FIRM	HMPREF1040_0277	Megasphaera sp. UPII 135-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. UPII 135-E"		integral component of membrane [GO:0016021]		NETVEIR	0.95589	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13442	27383	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27383	0
F9MN93	ATP-dependent DNA helicase RecQ (EC 3.6.4.12)	F9MN93_9FIRM	recQ HMPREF1040_1327	Megasphaera sp. UPII 135-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. UPII 135-E"	 DNA repair [GO:0006281]; DNA replication [GO:0006260]; SOS response [GO:0009432];DNA recombination [GO:0006310]		 ATP binding [GO:0005524]; nucleic acid binding [GO:0003676];3'-5' DNA helicase activity [GO:0043138]	ASLSLTPRYGVK	1.08	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39662	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39662	0	0	0	0	0	0	0	0	0	0	0	0
F9MPG4	UPF0365 protein HMPREF1040_1528	F9MPG4_9FIRM	HMPREF1040_1528	Megasphaera sp. UPII 135-E	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, unclassified Megasphaera, Megasphaera sp. UPII 135-E"		 plasma membrane [GO:0005886];integral component of membrane [GO:0016021]		GKSPVGK	0.96226	0	0	0	0	0	0	0	0	86632	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42647	21202	8202.3	13451	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	86632	0	0	0	0	0	0	42647	13451	0	0	0	0	0	0	0	0	0	0	0
A0A346AWE8	Aldo/keto reductase	A0A346AWE8_9FIRM	DKB62_00625	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"				VHQFYLDIYDTQRR	0.95229	0	0	0	3551.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3551.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A346AXQ5	Anaerobic ribonucleoside-triphosphate reductase	A0A346AXQ5_9FIRM	DKB62_03135	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"	DNA replication [GO:0006260]		 ribonucleoside-triphosphate reductase activity [GO:0008998];ATP binding [GO:0005524]	AYNEYRAATAPNNYQIRLYYVQDEIAYITMK	0.95362	0	0	0	0	0	0	0	12374	6380.8	45411	0	0	0	0	0	11699	10115	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4474.6	0	0	0	0	0	0	0	0	0	0	0	0	168880	112670	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12374	45411	0	11699	0	0	0	0	0	0	4474.6	0	0	0	168880	0	0	0	0	0
A0A346AXZ0	Hsp70 family protein	A0A346AXZ0_9FIRM	DKB62_03650	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"			ATP binding [GO:0005524]	NNGLEAR	0.95466	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31371	0	18799	0	0	0	0	0	10069	0	0	0	0	0	21884	0	0	0	0	0	18413	3653.3	0	0	0	0	0	0	0	22370	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31371	18799	0	10069	0	21884	0	18413	0	0	22370	0	0
A0A346AYC6	AsmA_2 domain-containing protein	A0A346AYC6_9FIRM	DKB62_04420	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"	protein secretion [GO:0009306]	integral component of plasma membrane [GO:0005887]		SPMRMSIDKK	0.96667	220830	114540	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10240	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7217.5	0	0	0	0	0	0	0	0	0	0	0	220830	0	0	0	0	0	0	0	0	10240	0	0	0	0	0	0	0	0	7217.5	0	0	0
A0A346AZS9	Aminotransferase class V-fold PLP-dependent enzyme	A0A346AZS9_9FIRM	DKB62_07255	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"			transaminase activity [GO:0008483]	GLFGDALRR	0.95487	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20975	9628.8	4236	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20975	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A346B029	PAS domain-containing protein	A0A346B029_9FIRM	DKB62_07790	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"	"regulation of transcription, DNA-templated [GO:0006355]"		 sequence-specific DNA binding [GO:0043565]; transcription factor binding [GO:0008134];ATP binding [GO:0005524]	FREDLYFRLNTFTIVIPPLR	0.95595	0	0	0	0	0	0	0	0	130350	0	0	0	0	0	0	0	0	0	36586	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	76173	0	0	0	0	112420	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	130350	0	0	0	36586	0	0	0	0	0	0	76173	0	112420	0	0	0	0	0	0
A0A346B0B8	Efflux RND transporter periplasmic adaptor subunit	A0A346B0B8_9FIRM	DKB62_08275	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"		membrane [GO:0016020]	transmembrane transporter activity [GO:0022857]	VTNTLREYNR	0.95449	0	0	0	0	0	159780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	159780	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A346B1B7	DNA repair protein RecN (Recombination protein N)	A0A346B1B7_9FIRM	recN DKB62_10230	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"	 DNA repair [GO:0006281];DNA recombination [GO:0006310]		ATP binding [GO:0005524]	SLCQQAR	0.95491	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	205940	86359	0	0	8883.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	205940	8883.6	0
A0A346B1K3	Fe-ADH domain-containing protein	A0A346B1K3_9FIRM	DKB62_10745	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"			 oxidoreductase activity [GO:0016491];metal ion binding [GO:0046872]	LTHEYFR	0.95392	0	0	0	0	0	0	0	0	0	0	0	25873	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25873	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A346B213	Peptidase M23	A0A346B213_9FIRM	DKB62_11605	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"				VIQENLDAAEAEYK	0.95553	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70595	31453	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70595	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A346B245	Rpn family recombination-promoting nuclease/putative transposase	A0A346B245_9FIRM	DKB62_11795	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"				DLKAREQTYR	0.95539	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11162	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11162	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A346B270	Restriction endonuclease subunit S	A0A346B270_9FIRM	DKB62_11930	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"	DNA modification [GO:0006304]		 endonuclease activity [GO:0004519];DNA binding [GO:0003677]	MQLLKKSK	0.95198	0	0	0	0	0	61577	0	0	0	0	0	0	0	0	0	0	0	0	0	8730.9	0	0	0	0	0	0	0	27300	0	0	11942	0	0	0	0	0	0	0	0	101110	63372	0	0	0	0	0	0	0	0	111740	46231	0	0	74555	72214	73946	0	0	0	18685	0	0	0	0	0	0	0	61577	0	0	0	0	8730.9	0	0	27300	11942	0	0	101110	0	0	111740	74555	73946	18685	0	0
A0A346B280	Uncharacterized protein	A0A346B280_9FIRM	DKB62_11980	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"				VDIHIDGR	0.9585	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	84953	0	0	0	35247	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	84953	35247	0	0	0	0
A0A346B294	Uncharacterized protein	A0A346B294_9FIRM	DKB62_12060	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"				RYCYSSCKYQTR	0.95631	0	0	0	0	0	49592	0	0	32195	38602	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49592	32195	38602	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A346B2A8	Semialdehyde dehydrogenase	A0A346B2A8_9FIRM	DKB62_12150	Megasphaera stantonii	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, Megasphaera stantonii"				FFYLRLKGEIER	0.95458	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32568	0	0	15587	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32568	15587	0	0	0
W1TWX9	Phospho-N-acetylmuramoyl-pentapeptide-transferase (EC 2.7.8.13) (UDP-MurNAc-pentapeptide phosphotransferase)	W1TWX9_9FIRM	mraY Q612_NSC00338G0080	Negativicoccus succinicivorans DORA_17_25	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Negativicoccus, Negativicoccus succinicivorans, Negativicoccus succinicivorans DORA_17_25"	 cell division [GO:0051301]; cell wall organization [GO:0071555]; peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360];cell cycle [GO:0007049]	 plasma membrane [GO:0005886];integral component of membrane [GO:0016021]	" UDP-N-acetylmuramoyl-L-alanyl-D-glutamyl-meso-2,6-diaminopimelyl-D-alanyl-D-alanine:undecaprenyl-phosphate transferase activity [GO:0051992]"";""phospho-N-acetylmuramoyl-pentapeptide-transferase activity [GO:0008963]"	EVERQANRR	0.96398	0	0	0	0	0	0	0	104030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	104030	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
W1TZ46	Ribonuclease R (RNase R) (EC 3.1.13.1)	W1TZ46_9FIRM	rnr Q612_NSC00283G0006	Negativicoccus succinicivorans DORA_17_25	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Negativicoccus, Negativicoccus succinicivorans, Negativicoccus succinicivorans DORA_17_25"		cytoplasm [GO:0005737]	 RNA binding [GO:0003723];exoribonuclease II activity [GO:0008859]	ENGNDLR	0.95878	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18856	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20320	16158	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10735	0	0	0	0	0	0	0	0	0	0	0	18856	0	0	0	0	20320	0	0	0	0	0	0	0	0	10735	0
W1U072	AAA_27 domain-containing protein (Fragment)	W1U072_9FIRM	Q612_NSC00242G0001	Negativicoccus succinicivorans DORA_17_25	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Negativicoccus, Negativicoccus succinicivorans, Negativicoccus succinicivorans DORA_17_25"		integral component of membrane [GO:0016021]		TTLLQFVR	0.95178	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9212.1	7142	0	0	219740	5117.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9690.3	12521	7110	13018	0	0	2516.5	0	0	0	0	0	0	0	0	0	0	0	6190	0	0	0	0	0	0	0	0	0	0	0	0	9212.1	219740	0	0	0	0	0	9690.3	13018	2516.5	0	0	0	6190	0	0
W1U3E6	DNA repair protein RadA	W1U3E6_9FIRM	radA Q612_NSC00329G0060	Negativicoccus succinicivorans DORA_17_25	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Negativicoccus, Negativicoccus succinicivorans, Negativicoccus succinicivorans DORA_17_25"	recombinational repair [GO:0000725]		 damaged DNA binding [GO:0003684]; DNA-dependent ATPase activity [GO:0008094]; metal ion binding [GO:0046872];ATP binding [GO:0005524]	VLRAAKNR	0.95487	0	0	74367	0	0	0	0	0	0	0	0	62158	27522	41429	66792	0	0	0	0	0	0	0	18043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8768.5	19759	0	0	0	74367	0	0	62158	66792	0	0	18043	0	0	0	0	0	0	0	0	0	0	0	0	19759	0
W1U443	UPF0122 protein Q612_NSC00306G0008	W1U443_9FIRM	Q612_NSC00306G0008	Negativicoccus succinicivorans DORA_17_25	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Negativicoccus, Negativicoccus succinicivorans, Negativicoccus succinicivorans DORA_17_25"				KEQDEVK	0.95059	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	149410	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	149410	0	0	0
W1U4U0	Polyamine aminopropyltransferase (Putrescine aminopropyltransferase) (PAPT) (Spermidine synthase) (SPDS) (SPDSY) (EC 2.5.1.16)	W1U4U0_9FIRM	speE Q612_NSC00193G0002	Negativicoccus succinicivorans DORA_17_25	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Negativicoccus, Negativicoccus succinicivorans, Negativicoccus succinicivorans DORA_17_25"	spermidine biosynthetic process [GO:0008295]	cytoplasm [GO:0005737]	spermidine synthase activity [GO:0004766]	DPLASEWR	0.95202	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26395	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26395	0	0	0	0	0	0	0	0
W1U8N8	Uncharacterized protein	W1U8N8_9FIRM	Q612_NSC00096G0001	Negativicoccus succinicivorans DORA_17_25	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Negativicoccus, Negativicoccus succinicivorans, Negativicoccus succinicivorans DORA_17_25"				NILHRGI	0.95617	0	0	0	10447	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26724	28329	38312	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10447	0	0	0	0	0	0	0	0	0	0	0	0	38312	0	0	0	0	0	0	0
W1UAZ4	Cytosine-specific methyltransferase (EC 2.1.1.37)	W1UAZ4_9FIRM	Q612_NSC00028G0004	Negativicoccus succinicivorans DORA_17_25	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Negativicoccus, Negativicoccus succinicivorans, Negativicoccus succinicivorans DORA_17_25"			DNA (cytosine-5-)-methyltransferase activity [GO:0003886]	ASQDNYVTDAINRSK	0.95021	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	199040	0	0	0	37113	0	49183	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	199040	0	49183	0	0
W1UB24	DOT1 domain-containing protein (Fragment)	W1UB24_9FIRM	Q612_NSC00041G0001	Negativicoccus succinicivorans DORA_17_25	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Negativicoccus, Negativicoccus succinicivorans, Negativicoccus succinicivorans DORA_17_25"			histone-lysine N-methyltransferase activity [GO:0018024]	ENYYEKLLNINTAGNENWNK	0.95416	0	0	0	0	0	0	0	96617	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	67125	30779	32879	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	96617	0	0	0	0	0	0	0	0	0	0	0	67125	0	0	0	0	0	0	0
A0A1C5PDX8	Uncharacterized protein	A0A1C5PDX8_9FIRM	SAMEA3545320_00803	uncultured Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, uncultured Megasphaera sp."				GQPVKEEEPFFDIR	0.9542	0	0	0	0	3715.7	0	0	0	0	9960.7	4367.3	0	0	0	0	0	15372	8197.4	0	3356	3874.5	60875	0	4005.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27928	15575	14001	0	0	20318	0	0	0	10542	0	0	0	0	0	0	0	24718	0	0	0	0	0	0	0	3715.7	0	9960.7	0	15372	3874.5	60875	0	0	0	0	0	0	27928	20318	0	10542	0	24718	0	0
A0A1C5PXC8	Uncharacterized conserved protein	A0A1C5PXC8_9FIRM	SAMEA3545320_00910	uncultured Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, uncultured Megasphaera sp."			hydrolase activity [GO:0016787]	VESPNEYR	0.95406	0	0	0	0	0	0	0	0	0	0	0	0	0	4948.8	0	0	0	0	30160	0	57618	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5944	0	0	0	0	5816.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4948.8	0	57618	0	0	0	0	0	0	5944	0	5816.5	0	0	0	0	0	0
A0A1C5RFX4	Uncharacterized protein	A0A1C5RFX4_9FIRM	SAMEA3545320_01275	uncultured Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, uncultured Megasphaera sp."				CFNYGNIKRNLSK	0.95853	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18940	0	0	0	0	0	0	0	0	0	0	0	0	2615.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3749.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18940	0	0	0	2615.3	0	0	0	0	0	3749.2	0	0	0	0
A0A1C5VUR6	Transposase and inactivated derivatives	A0A1C5VUR6_9FIRM	SAMEA3545320_02343	uncultured Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, uncultured Megasphaera sp."				VQRTDEQQLHANFK	0.95425	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27214	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13064	7827.9	0	0	0	5000.9	0	14152	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16237	0	0	2743.9	0	30498	0	0	0	0	0	27214	0	0	0	0	13064	5000.9	14152	0	0	0	0	0	0	0	16237	30498
A0A1C5VYP8	Uncharacterized protein	A0A1C5VYP8_9FIRM	SAMEA3545320_02374	uncultured Megasphaera sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Megasphaera, environmental samples, uncultured Megasphaera sp."				AELEAGR	0.98374	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11074	0	0
A0A133S7G0	DUF2179 domain-containing protein	A0A133S7G0_9FIRM	HMPREF3233_00084	Veillonella atypica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella atypica"		integral component of membrane [GO:0016021]		DKYSWMYAR	2.5	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19393	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19393	0	0	0	0	0	0	0	0
A0A133S7I3	Uncharacterized protein	A0A133S7I3_9FIRM	HMPREF3233_00107	Veillonella atypica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella atypica"				TEDVHAEYVDVGDHTR	0.95094	104930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	104930	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A380N584	Uncharacterized protein	A0A380N584_9FIRM	NCTC11830_01055	Veillonella atypica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella atypica"				ALSKNSYQVKQTIEYR	0.9585	3664.1	8128.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6854.4	0	0	0	0	0	0	0	0	0	3509.3	0	0	0	0	0	12752	0	11842	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13087	0	0	0	0	0	8128.2	0	0	0	0	6854.4	0	0	0	3509.3	0	12752	0	0	0	0	0	0	0	0	13087	0
A0A380N6G2	Type I restriction-modification system methyltransferase subunit	A0A380N6G2_9FIRM	NCTC11830_01755	Veillonella atypica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella atypica"	methylation [GO:0032259]		methyltransferase activity [GO:0008168]	AFAGRLEMR	0.96094	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	272830	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	272830	0	0	0	0	0	0	0
A0A3A6WG12	Uncharacterized protein	A0A3A6WG12_9FIRM	D2965_01645	Veillonella atypica	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella atypica"				DLRVFAFPK	0.96429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18244	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33478	17165	9035.5	0	0	0	0	0	12074	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18244	0	0	0	0	0	0	33478	0	12074	0	0	0	0	0	0
E1L7N6	Relaxase/mobilization nuclease domain protein	E1L7N6_9FIRM	HMPREF9321_1716	Veillonella atypica ACS-049-V-Sch6	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella atypica, Veillonella atypica ACS-049-V-Sch6"				HEFEVKYMSGLAK	0.95687	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	104300	95880	43448	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	104300	0	0	0	0	0	0	0	0	0	0	0	0	0
E1LCK3	Thioesterase family protein	E1LCK3_9FIRM	HMPREF9684_1790	Veillonella atypica ACS-134-V-Col7a	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella atypica, Veillonella atypica ACS-134-V-Col7a"				GSHERFVINSEKFMSK	0.96446	0	36189	7612.3	0	6448.6	11218	10690	111410	0	0	2750	0	0	0	0	0	0	1839	0	0	0	0	0	0	0	0	0	10781	10506	0	7018.1	3626.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36189	11218	111410	2750	0	1839	0	0	0	10781	7018.1	0	0	0	0	0	0	0	0	0	0	0
A0A380NH94	Chaperone protein DnaK (HSP70) (Heat shock 70 kDa protein) (Heat shock protein 70)	A0A380NH94_9FIRM	dnaK NCTC12020_00473	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"	protein folding [GO:0006457]		 unfolded protein binding [GO:0051082];ATP binding [GO:0005524]	ADAATLEQVK	0.95284	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1356300	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	97367	0	0	0	0	0	13549	0	0	0	0	0	0	22162	0	57448	0	0	0	0	0	0	0	0	0	0	1356300	0	0	0	0	0	97367	0	13549	0	0	57448
A0A380NJJ9	H-34	A0A380NJJ9_9FIRM	NCTC12020_00758	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"	sporulation resulting in formation of a cellular spore [GO:0030435]			PMQQADR	0.9507	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15983	0	0	0	0	26337	22781	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15983	0	26337	0	0	0	0	0	0
A0A380NL60	DNA helicase (EC 3.6.4.12)	A0A380NL60_9FIRM	pcrA_2 NCTC12020_01333	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"			 DNA binding [GO:0003677]; DNA helicase activity [GO:0003678];ATP binding [GO:0005524]	AAVSGAMTLRIKDMR	0.95394	0	0	107900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	107900	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A380NMG5	Glutathione import ATP-binding protein GsiA (EC 3.6.3.-)	A0A380NMG5_9FIRM	gsiA_6 NCTC12020_01152	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"	peptide transport [GO:0015833]		 ATP binding [GO:0005524];ATPase activity [GO:0016887]	NYKIKNDGAEVFTGLYMVGR	0.95417	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	45943	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	45943
A0A380NML8	ATP-dependent DNA helicase recQ (EC 3.6.4.12)	A0A380NML8_9FIRM	recQ NCTC12020_01862	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"	 DNA repair [GO:0006281]; DNA replication [GO:0006260]; SOS response [GO:0009432];DNA recombination [GO:0006310]		 ATP binding [GO:0005524]; nucleic acid binding [GO:0003676];3'-5' DNA helicase activity [GO:0043138]	ALRANRVK	0.95673	0	191510	0	0	0	0	0	0	0	0	0	0	219310	246200	337330	0	0	0	0	41366	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42307	0	0	0	231630	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	80946	225150	0	0	0	143260	0	0	0	191510	0	0	0	337330	0	41366	0	0	0	0	42307	0	231630	0	0	0	0	0	225150	143260	0
A0A380NMT7	Uncharacterized protein	A0A380NMT7_9FIRM	NCTC12020_01769	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"				KVNQYFDDHK	0.95947	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24031	0	6906	0	0	0	0	0	0	0	11890	0	0	0	0	0	0	0	0	0	0	0	0	3743.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24031	6906	0	11890	0	0	0	0	3743.1	0	0	0	0	0
A0A380NN75	Uncharacterized protein	A0A380NN75_9FIRM	NCTC12020_01826	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"				LSLFFTK	0.95928	0	0	0	405930	0	0	0	0	0	0	0	0	0	18427	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1542100	0	0	0	1019800	0	155890	0	0	607520	368830	165380	136700	4188.3	0	0	0	0	0	0	0	0	617750	0	561110	351390	1835800	11910	286330	131500	89650	0	0	35992	153640	0	23700	68310	0	405930	0	0	18427	0	0	0	0	1542100	1019800	155890	607520	165380	0	0	617750	561110	1835800	131500	153640	68310
A0A380NNF7	Lipid A core - O-antigen ligase and related enzymes	A0A380NNF7_9FIRM	NCTC12020_01925	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"		integral component of membrane [GO:0016021]	ligase activity [GO:0016874]	HFPLLKRR	0.95522	0	0	0	0	0	0	0	0	0	0	0	10058	0	0	0	0	0	0	0	0	0	0	30569	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10058	0	0	0	30569	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A380NNU1	Outer membrane protein alpha	A0A380NNU1_9FIRM	omp-alpha_3 NCTC12020_01635	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"	pathogenesis [GO:0009405]	outer membrane [GO:0019867]		ANTAPDYK	0.95413	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11752	89211	36979	0	0	14355	0	0	0	0	0	0	0	0	0	0	0	0	0	39853	0	0	0	0	0	19269	26211	25948	0	0	0	0	0	0	0	0	0	0	0	0	11752	89211	14355	0	0	0	0	39853	0	26211
A0A380NPE4	DNA polymerase III subunit alpha (EC 2.7.7.7)	A0A380NPE4_9FIRM	dnaE NCTC12020_01849	Veillonella criceti	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella criceti"	DNA replication [GO:0006260]	cytoplasm [GO:0005737]	 DNA-directed DNA polymerase activity [GO:0003887];3'-5' exonuclease activity [GO:0008408]	FGLGGVKSVGDNAIEQLLLER	0.95469	0	0	0	0	0	0	502940	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	502940	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2S7Z7X5	GTP cyclohydrolase 1 type 2 homolog	A0A2S7Z7X5_9FIRM	VEHSUH05_08330	Veillonella denticariosi JCM 15641	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella denticariosi, Veillonella denticariosi JCM 15641"			metal ion binding [GO:0046872]	TNGVMLGVNDWSEAYR	0.95596	8657.3	0	59934	109320	7494	0	62553	0	0	0	33976	0	0	6245.5	24687	0	0	0	0	0	0	0	0	0	55205	0	0	0	256650	208110	0	142350	630730	16607	11040	0	0	0	0	0	0	13963	0	0	76870	0	39495	31051	26817	21029	20301	0	6029.8	0	0	10643	14042	0	0	0	0	0	0	31868	0	0	59934	109320	62553	33976	24687	0	0	0	55205	256650	630730	16607	0	13963	76870	39495	26817	6029.8	14042	0	0	31868
A0A2S7ZAJ0	Serine/threonine protein phosphatase	A0A2S7ZAJ0_9FIRM	VEHSUH05_03950	Veillonella denticariosi JCM 15641	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella denticariosi, Veillonella denticariosi JCM 15641"		integral component of membrane [GO:0016021]	hydrolase activity [GO:0016787]	INCPREITVITFFDGLA	0.95197	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	123540	0	0	0	0	0	0	0	0	29264	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	123540	0	0	29264	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A134BYW7	M48 family peptidase	A0A134BYW7_9FIRM	EAI97_09210 HMPREF1867_01205	Veillonella dispar	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella dispar"				LMQSYWR	0.95604	0	0	0	26816	0	0	0	0	0	0	0	0	0	0	16349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30991	0	0	0	0	61229	0	22192	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26816	0	0	16349	0	0	0	0	0	30991	0	61229	0	0	0	0	0	0	0	0	0
A0A134C1W5	Uncharacterized protein	A0A134C1W5_9FIRM	HMPREF1867_00921	Veillonella dispar	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella dispar"				HMMLVKTK	0.95484	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53469	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53469	0	0	0	0	0	0	0	0	0	0	0	0	0	0
C4FQR3	ComEC/Rec2-like protein	C4FQR3_9FIRM	VEIDISOL_01131	Veillonella dispar ATCC 17748	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella dispar, Veillonella dispar ATCC 17748"		integral component of membrane [GO:0016021]		VYVGDYR	0.95488	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15779	24190	0	0	0	0	0	0	0	0	0	0	0	0	0	19450	0	0	0	20511	17849	13735	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24190	0	0	0	0	19450	20511	17849	0	0	0	0	0	0	0	0
W1UVN3	HI0933 family protein	W1UVN3_9FIRM	Q619_VDC00592G0065	Veillonella dispar DORA_11	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella dispar, Veillonella dispar DORA_11"				LAELNPAK	0.95027	0	0	0	0	0	247180	0	0	0	0	730130	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3510000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	269720	400450	0	0	0	0	137560	0	0	0	0	0	0	0	0	0	0	247180	0	730130	0	0	0	0	0	3510000	0	0	0	0	0	0	269720	400450	137560	0	0	0
W1UXV7	Phosphoglucosamine mutase	W1UXV7_9FIRM	Q619_VDC00542G0015	Veillonella dispar DORA_11	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella dispar, Veillonella dispar DORA_11"	carbohydrate metabolic process [GO:0005975]		"intramolecular transferase activity, phosphotransferases [GO:0016868]"	VILPETGSRTVLR	0.95519	5712.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	11351	11949	0	0	0	0	0	5332.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9280.9	32765	19822	18456	0	0	0	0	0	0	0	0	0	5712.2	0	0	0	0	0	0	0	11351	11949	0	5332.4	0	0	0	0	0	9280.9	32765	0	0	0
A0A096AI91	"7,8-dihydroneopterin aldolase (EC 4.1.2.25)"	A0A096AI91_9FIRM	HMPREF0872_07065	Veillonella montpellierensis DNF00314	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella montpellierensis, Veillonella montpellierensis DNF00314"	 tetrahydrofolate biosynthetic process [GO:0046654];folic acid biosynthetic process [GO:0046656]		 hydrolase activity [GO:0016787];dihydroneopterin aldolase activity [GO:0004150]	PSVPIAGLLDYVEVVTTR	0.95321	0	0	0	0	0	0	0	0	0	40815	0	51976	0	0	0	0	47950	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51976	0	47950	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A096AIN1	Uncharacterized protein	A0A096AIN1_9FIRM	HMPREF0872_06375	Veillonella montpellierensis DNF00314	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella montpellierensis, Veillonella montpellierensis DNF00314"				VIYRDIYSASCSEITEK	0.95158	0	131270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	131270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A096AJY6	Phosphatase	A0A096AJY6_9FIRM	HMPREF0872_05645	Veillonella montpellierensis DNF00314	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella montpellierensis, Veillonella montpellierensis DNF00314"		integral component of membrane [GO:0016021]	transferase activity [GO:0016740]	ICFLIQAIAKRR	0.95609	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4286.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4286.3	0	0	0	0	0	0	0	0	0	0	0	0
A0A096AK54	Arylsulfatase	A0A096AK54_9FIRM	HMPREF0872_04790	Veillonella montpellierensis DNF00314	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella montpellierensis, Veillonella montpellierensis DNF00314"		integral component of membrane [GO:0016021]	" transferase activity, transferring phosphorus-containing groups [GO:0016772]"";""sulfuric ester hydrolase activity [GO:0008484]"	WSFESPR	0.95605	0	0	0	0	0	0	0	0	0	0	0	7011.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2775.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7011.9	0	0	0	0	0	0	2775.7	0	0	0	0	0	0	0	0	0	0	0
A0A096AKL6	Serine--tRNA ligase (EC 6.1.1.11) (Seryl-tRNA synthetase) (SerRS) (Seryl-tRNA(Ser/Sec) synthetase)	A0A096AKL6_9FIRM	serS HMPREF0872_05730	Veillonella montpellierensis DNF00314	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella montpellierensis, Veillonella montpellierensis DNF00314"	 selenocysteinyl-tRNA(Sec) biosynthetic process [GO:0097056]; seryl-tRNA aminoacylation [GO:0006434];selenocysteine biosynthetic process [GO:0016260]	cytoplasm [GO:0005737]	 serine-tRNA ligase activity [GO:0004828];ATP binding [GO:0005524]	AFCATHATFKYPLDTK	0.96543	0	0	73604	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73604	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A096ANS7	M18 family aminopeptidase (EC 3.4.11.-)	A0A096ANS7_9FIRM	HMPREF0872_01670	Veillonella montpellierensis DNF00314	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella montpellierensis, Veillonella montpellierensis DNF00314"			 metallopeptidase activity [GO:0008237]; zinc ion binding [GO:0008270];aminopeptidase activity [GO:0004177]	EVTIDSNR	0.95493	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	41816	0	60301	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29526	0	0	0	0	0	0	0	60301	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29526
A0A096BZR7	Pribosyltran domain-containing protein	A0A096BZR7_9FIRM	HMPREF0872_01225	Veillonella montpellierensis DNF00314	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella montpellierensis, Veillonella montpellierensis DNF00314"	nucleoside metabolic process [GO:0009116]			SGTDKITLCDCWQWYR	0.9645	0	0	0	0	0	60746	0	0	0	0	0	95367	0	0	0	40992	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60746	0	95367	0	40992	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A096CNI5	Uncharacterized protein	A0A096CNI5_9FIRM	HMPREF0872_06915	Veillonella montpellierensis DNF00314	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella montpellierensis, Veillonella montpellierensis DNF00314"				PPEEGYR	0.95533	0	0	59378	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29882	0	0	57337	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	59378	0	0	0	0	0	29882	57337	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A134C2H3	Helicase protein	A0A134C2H3_9FIRM	HMPREF1865_00610	Veillonella parvula	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula"	DNA modification [GO:0006304]		 DNA binding [GO:0003677]; endonuclease activity [GO:0004519]; helicase activity [GO:0004386];ATP binding [GO:0005524]	EEPCRLTR	0.95607	0	0	0	0	0	0	0	0	0	0	44923	0	0	0	0	0	0	0	27850	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	3243.2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44923	0	0	27850	0	0	0	0	0	0	0	0	0	3243.2	0	0	0	0	0
A0A134C5A9	Uncharacterized protein	A0A134C5A9_9FIRM	HMPREF1865_00283	Veillonella parvula	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula"				IIFKPFISFYLK	0.95772	0	0	0	0	0	0	0	0	0	6503.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12542	0	0	0	5357.2	0	0	0	0	0	0	13389	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6503.8	0	0	0	0	0	12542	5357.2	0	13389	0	0	0	0	0	0	0	0	0
A0A2I1TJA4	Uncharacterized protein	A0A2I1TJA4_9FIRM	CYK26_02735	Veillonella parvula	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula"		integral component of membrane [GO:0016021]		SLTDDYK	0.96293	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14553	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14553	0	0	0	0	0	0	0	0	0	0
A0A413EAR3	Shikimate kinase (SK) (EC 2.7.1.71)	A0A413EAR3_9FIRM	aroK DWV36_04505	Veillonella parvula	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula"	 chorismate biosynthetic process [GO:0009423];aromatic amino acid family biosynthetic process [GO:0009073]	cytoplasm [GO:0005737]	 magnesium ion binding [GO:0000287]; shikimate kinase activity [GO:0004765];ATP binding [GO:0005524]	SHRHENWR	0.95356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21582	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21582
A0A413EDC8	Uncharacterized protein	A0A413EDC8_9FIRM	DWV36_00635	Veillonella parvula	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula"				ADENPTVEEQATAEEKPK	0.95029	28413	67082	0	0	0	17634	17692	93234	0	0	12923	31654	0	0	0	24357	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12856	12395	9553	0	0	0	0	0	0	0	0	0	67082	17634	93234	31654	0	24357	0	0	0	0	0	0	0	0	0	0	0	0	12856	0	0	0
A0A418PGM4	Reverse transcriptase domain-containing protein	A0A418PGM4_9FIRM	D3219_08255	Veillonella parvula	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula"				ANAFDINNR	0.9577	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19304	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	36029	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19304	0	0	0	0	0	0	0	0	0	0	0	36029	0	0	0	0
A0A418PGY2	Single-stranded-DNA-specific exonuclease RecJ	A0A418PGY2_9FIRM	recJ D3219_08570	Veillonella parvula	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula"	 DNA repair [GO:0006281];DNA recombination [GO:0006310]		 nucleic acid binding [GO:0003676];5'-3' exonuclease activity [GO:0008409]	TQSVYNVEQDILRR	0.95183	0	0	0	0	0	0	0	0	0	0	13731	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16753	0	0	0	0	0	0	0	0	0	0	0	8758.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13731	0	0	0	0	0	0	0	0	16753	0	0	0	8758.8	0	0	0	0	0
A0A418PII0	Uncharacterized protein	A0A418PII0_9FIRM	D3219_04810	Veillonella parvula	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula"				MMVSNINR	0.95434	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42345	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	42345	0	0	0	0	0	0	0	0
F5L027	Methyltransferase domain protein	F5L027_9FIRM	HMPREF9323_1218	Veillonella parvula ACS-068-V-Sch12	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula, Veillonella parvula ACS-068-V-Sch12"	methylation [GO:0032259]		methyltransferase activity [GO:0008168]	VHDFSLMRKSNDYDFGR	0.95342	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16898	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8521.5	0	0	29245	47396	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16898	0	0	0	0	0	0	0	8521.5	29245	47396	0	0
T0U822	Acetolactate synthase (EC 2.2.1.6)	T0U822_9FIRM	HSIVP1_748	Veillonella parvula HSIVP1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula, Veillonella parvula HSIVP1"	 valine biosynthetic process [GO:0009099];isoleucine biosynthetic process [GO:0009097]		 flavin adenine dinucleotide binding [GO:0050660]; magnesium ion binding [GO:0000287]; thiamine pyrophosphate binding [GO:0030976];acetolactate synthase activity [GO:0003984]	TENTSGYRRGK	0.95117	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28569	0	0	0	0	0	0	0	0	0	0	0	0	23635	0	0	0	0	0	0	0	0	0	0	0	0	71036	0	0	89118	216840	0	0	0	0	80914	95323	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	28569	0	0	0	0	23635	0	0	0	71036	216840	0	95323	0	0	0
T0UFM8	Dihydropyrimidinase (EC 3.5.2.2)	T0UFM8_9FIRM	HSIVP1_702	Veillonella parvula HSIVP1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella parvula, Veillonella parvula HSIVP1"		cytoplasm [GO:0005737]	dihydropyrimidinase activity [GO:0004157]	IDTLVLEGQQIIIM	0.95385	0	0	0	88693	34650	298130	63701	28937	35837	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	236180	13640	201350	84305	120870	0	0	0	112750	125970	2166.9	0	21395	41905	0	0	4925.6	0	9089.6	0	0	0	0	53909	89891	0	21169	21115	0	0	0	0	0	0	0	10823	0	0	0	0	0	0	298130	63701	0	0	0	0	0	236180	201350	0	125970	41905	4925.6	9089.6	0	89891	21169	0	0	10823	0
A0A239Y529	Hep_Hag	A0A239Y529_9FIRM	SAMEA44547418_00053	Veillonella rodentium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella rodentium"	pathogenesis [GO:0009405]	outer membrane [GO:0019867]		LGEKVSVK	0.9522	0	4518.2	9521.1	0	0	0	11827	12574	0	0	0	31908	0	10194	0	0	0	0	0	0	0	0	0	0	0	11423	0	0	0	0	0	0	14849	45308	0	0	0	0	0	0	0	0	0	0	0	0	6939.9	0	0	0	0	0	0	0	0	0	0	0	18664	0	0	0	0	0	0	0	9521.1	0	12574	31908	10194	0	0	0	11423	0	14849	45308	0	0	0	6939.9	0	0	0	18664	0	0
A0A239ZZ22	H(+)/Cl(-) exchange transporter ClcA	A0A239ZZ22_9FIRM	clcA_2 SAMEA44547418_01868	Veillonella rodentium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella rodentium"	potassium ion transport [GO:0006813]	integral component of membrane [GO:0016021]	 voltage-gated chloride channel activity [GO:0005247];cation transmembrane transporter activity [GO:0008324]	FFDWLECSRFLK	0.95336	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31453	10846	0	0	0	0	0	0	0	0	17336	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31453	0	0	17336	0	0	0	0	0	0	0	0
K9CZS2	Leucine--tRNA ligase (EC 6.1.1.4) (Leucyl-tRNA synthetase) (LeuRS)	K9CZS2_9FIRM	leuS HMPREF9282_01771	Veillonella seminalis ACS-216-V-Col6b	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella seminalis, Veillonella seminalis ACS-216-V-Col6b"	leucyl-tRNA aminoacylation [GO:0006429]	cytoplasm [GO:0005737]	 ATP binding [GO:0005524]; leucine-tRNA ligase activity [GO:0004823];aminoacyl-tRNA editing activity [GO:0002161]	TALEQYADVR	0.95315	0	0	0	0	0	0	85855	0	79037	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	85855	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9D1X3	Uncharacterized protein	K9D1X3_9FIRM	HMPREF9282_01199	Veillonella seminalis ACS-216-V-Col6b	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella seminalis, Veillonella seminalis ACS-216-V-Col6b"				IVTYRMGNDFIWDMEKFICK	0.95517	0	0	80356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	80356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9DEU3	RadC domain-containing protein	K9DEU3_9FIRM	HMPREF9282_02094	Veillonella seminalis ACS-216-V-Col6b	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella seminalis, Veillonella seminalis ACS-216-V-Col6b"				DLFYSTR	0.95222	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15154	3180.5	0	0	0	0	0	0	0	0	0	6128.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33943	0	0	0	0	0	0	0	0	0	0	0	0	0	0	15154	0	0	6128.1	0	0	0	0	0	0	0	0	0	33943	0	0	0
K9DGJ5	3-deoxy-D-manno-octulosonic acid transferase (Kdo transferase) (EC 2.4.99.12) (Lipid IV(A) 3-deoxy-D-manno-octulosonic acid transferase)	K9DGJ5_9FIRM	HMPREF9282_01530	Veillonella seminalis ACS-216-V-Col6b	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella seminalis, Veillonella seminalis ACS-216-V-Col6b"	lipopolysaccharide core region biosynthetic process [GO:0009244]	 plasma membrane [GO:0005886];integral component of membrane [GO:0016021]	transferase activity [GO:0016740]	DLKEKNCLMLMTDTLK	0.96588	0	0	0	0	95496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	95496	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
K9DJ18	MobA_MobL domain-containing protein	K9DJ18_9FIRM	HMPREF9282_02107	Veillonella seminalis ACS-216-V-Col6b	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella seminalis, Veillonella seminalis ACS-216-V-Col6b"				ETLLHDIDR	1.0833	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16584	0	0	4168.1	10216	0	12153	29483	0	0	0	41284	0	0	0	0	0	0	0	0	230040	649960	41857	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16584	10216	29483	0	41284	0	0	649960	0	0	0	0	0
K9DJ35	DNA topoisomerase III	K9DJ35_9FIRM	HMPREF9282_02052	Veillonella seminalis ACS-216-V-Col6b	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella seminalis, Veillonella seminalis ACS-216-V-Col6b"	DNA topological change [GO:0006265]	chromosome [GO:0005694]	" DNA topoisomerase type I (single strand cut, ATP-independent) activity [GO:0003917]"";""DNA binding [GO:0003677]"	CPKCYQLTRGK	0.95226	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13746	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9062.4	0	0	81831	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13746	0	0	0	0	0	0	0	9062.4	81831	0	0	0	0	0	0
K9DJC6	Uncharacterized protein	K9DJC6_9FIRM	HMPREF9282_00699	Veillonella seminalis ACS-216-V-Col6b	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella seminalis, Veillonella seminalis ACS-216-V-Col6b"				MANFIVSVSER	0.95046	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	71462	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	71462	0
K9DKQ2	Uncharacterized protein	K9DKQ2_9FIRM	HMPREF9282_00170	Veillonella seminalis ACS-216-V-Col6b	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella seminalis, Veillonella seminalis ACS-216-V-Col6b"		 integral component of membrane [GO:0016021];cell outer membrane [GO:0009279]		VNNYYTK	1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20224	0	0	0	0	0	0	0	0	0	0	0	0	24668	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31081	0	0	0	0	0	0	0	0	0	0	0	20224	0	0	0	24668	0	0	0	0	0	0	0	0	31081	0
K9DMH4	Histidinol-phosphatase (HolPase) (EC 3.1.3.15)	K9DMH4_9FIRM	HMPREF9282_00402	Veillonella seminalis ACS-216-V-Col6b	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella seminalis, Veillonella seminalis ACS-216-V-Col6b"	histidine biosynthetic process [GO:0000105]		histidinol-phosphatase activity [GO:0004401]	YSFGSPLPAHETICK	0.95498	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6834	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6834	0	0	0	0	0	0	0	0	0	0	0
A0A496P950	Queuine tRNA-ribosyltransferase (EC 2.4.2.29) (Fragment)	A0A496P950_9FIRM	tgt D8B58_11470	Veillonella sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp."	 tRNA-guanine transglycosylation [GO:0101030];queuosine biosynthetic process [GO:0008616]		 queuine tRNA-ribosyltransferase activity [GO:0008479];metal ion binding [GO:0046872]	NFNDWFQR	0.95086	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51678	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9542.4	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	51678	0	0	0	0	9542.4	0	0	0	0	0	0	0	0
A0A496PBS1	DUF4037 domain-containing protein	A0A496PBS1_9FIRM	D8B58_06255	Veillonella sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp."				CQLFLPDDIYKSSK	0.95756	0	0	0	0	0	0	28066000	89781	29947000	6184600	6797800	0	0	31438	0	0	0	3425000	0	0	0	0	0	0	4264800	0	0	3407800	3528900	916120	0	0	0	0	0	0	0	0	0	0	0	0	0	78830	0	75886	356280	41689	939640	272700	67044	767580	174670	0	0	117120	0	0	0	0	0	0	0	0	0	0	0	0	29947000	6797800	31438	3425000	0	0	4264800	3528900	0	0	0	0	78830	356280	939640	767580	117120	0	0	0
A0A496PCH8	ParB/RepB/Spo0J family partition protein (Fragment)	A0A496PCH8_9FIRM	D8B58_06135	Veillonella sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp."			DNA binding [GO:0003677]	APQTSTR	0.95833	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31482	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31482	0	0	0
A0A496PE30	N-acetyltransferase	A0A496PE30_9FIRM	D8B58_02105	Veillonella sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp."			N-acetyltransferase activity [GO:0008080]	FEFGRKYYFHQK	0.95079	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4008.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4008.3	0
A0A496PE96	Uncharacterized protein	A0A496PE96_9FIRM	D8B58_02910	Veillonella sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp."				HVNSYEER	0.95478	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	58902	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	58902	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A496PEN4	Uncharacterized protein (Fragment)	A0A496PEN4_9FIRM	D8B58_01070	Veillonella sp.	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp."		integral component of membrane [GO:0016021]		RYSLRQYHLYWK	0.95837	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2199.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	2199.7	0	0	0
D6KPX6	Putative period circadian protein	D6KPX6_9FIRM	HMPREF0874_01013	Veillonella sp. 6_1_27	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. 6_1_27"	transmembrane transport [GO:0055085]	integral component of membrane [GO:0016021]		AHELQHSK	0.95431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32905	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32905	0	0	0	0	0	0	0	0	0	0	0
J4JG69	Transposase	J4JG69_9FIRM	HMPREF1151_0909	Veillonella sp. ACP1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ACP1"				EVQEVAWDVRLCVHR	0.95796	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	96877	0	0	26280	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	96877	26280	0	0	0	0	0	0	0	0	0	0	0
J4QEY0	PF03235 family protein	J4QEY0_9FIRM	HMPREF1151_1325	Veillonella sp. ACP1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ACP1"				ETQPTDFDLEKIEEYKR	0.9513	0	0	0	0	0	0	0	0	0	0	134450	0	47881	33897	0	0	16481	0	0	0	0	0	0	0	0	0	4274.4	0	0	0	0	3021.5	0	0	0	0	0	0	3294.3	0	0	4822.3	25153	0	0	25164	0	0	30834	3948.5	0	12153	0	0	0	0	7263	0	0	0	0	0	0	0	0	0	0	0	0	134450	47881	16481	0	0	4274.4	0	3021.5	0	3294.3	4822.3	25153	25164	30834	12153	7263	0	0	0
J4RP58	Transglycosylase	J4RP58_9FIRM	HMPREF1151_1175	Veillonella sp. ACP1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ACP1"	 peptidoglycan biosynthetic process [GO:0009252]; regulation of cell shape [GO:0008360];cell wall organization [GO:0071555]	integral component of membrane [GO:0016021]	transferase activity [GO:0016740]	SVKWKDPR	0.9555	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61818	14106	28290	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61818	0	0	0	0	0	0	0	0	0	0	0	0	0
J5AJ40	Uncharacterized protein	J5AJ40_9FIRM	HMPREF1151_0908	Veillonella sp. ACP1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ACP1"				AFKEESKAK	0.96875	0	0	0	40536	40181	0	0	0	0	0	0	0	55677	0	0	0	0	0	0	0	4198.5	0	0	0	0	0	0	0	0	0	0	0	0	0	11447	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38941	37941	0	0	0	0	0	0	0	19942	0	0	0	0	0	40536	0	0	55677	0	4198.5	0	0	0	0	11447	0	0	0	0	0	38941	0	0	19942	0
J5ARM3	YcfA-like protein	J5ARM3_9FIRM	HMPREF1151_0481	Veillonella sp. ACP1	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ACP1"			mRNA binding [GO:0003729]	DGWYIDR	0.96217	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	169340	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	169340	0	0	0	0	0	0
A0A415H6L9	DNA helicase RecQ (EC 3.6.4.12)	A0A415H6L9_9FIRM	recQ DW053_05860	Veillonella sp. AF42-16	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. AF42-16"	 DNA repair [GO:0006281]; DNA replication [GO:0006260]; SOS response [GO:0009432];DNA recombination [GO:0006310]		 ATP binding [GO:0005524]; nucleic acid binding [GO:0003676];3'-5' DNA helicase activity [GO:0043138]	GVGEAKLK	0.95066	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1827100	0	0	1673100	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1827100	1673100	0	0	0	0	0	0	0	0	0	0	0	0	0	0
W3Y042	Nitroreductase family protein	W3Y042_9FIRM	HMPREF1521_1237	Veillonella sp. AS16	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. AS16"			oxidoreductase activity [GO:0016491]	ISPDKKFCAR	0.961	0	0	0	0	0	0	0	0	0	0	0	10505	0	10928	0	0	0	16541	0	0	0	0	0	0	0	0	0	32399	0	0	176320	45897	0	140560	104620	218390	180120	190740	209090	0	0	0	0	0	0	0	15307	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5789.6	8880.1	7303.5	0	0	0	10505	10928	16541	0	0	0	32399	176320	218390	209090	0	0	15307	0	0	0	0	0	8880.1
W3Y0Y6	"Oligopeptide ABC transporter, oligopeptide-binding protein"	W3Y0Y6_9FIRM	HMPREF1521_1779	Veillonella sp. AS16	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. AS16"				FAGISSLSTYEQYSMEAEK	0.95993	0	0	0	0	0	0	56449	68484	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5188.3	0	2695.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	68484	0	0	0	0	0	0	0	0	0	0	0	0	5188.3	2695.9	0	0	0	0	0
W3Y1R0	Uncharacterized protein	W3Y1R0_9FIRM	HMPREF1521_1060	Veillonella sp. AS16	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. AS16"		integral component of membrane [GO:0016021]		GGNMKAAFAAEPSMDVDDMKAHYEEDR	0.95349	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23860	59964	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	59964	0	0
W3Y237	Ndr family protein	W3Y237_9FIRM	HMPREF1521_0879	Veillonella sp. AS16	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. AS16"				PDTQWLNNTWYYISGK	0.95132	846850	80921	728750	86219	290530	0	0	0	0	0	4030.9	0	0	80561	0	91604	0	0	0	0	0	0	0	0	0	0	133010	0	0	0	0	0	0	63519	56411	96333	0	0	0	0	22021	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12935	846850	290530	0	4030.9	80561	91604	0	0	133010	0	0	96333	0	22021	0	0	0	0	0	0	0	12935
W3Y390	"Cytochrome d ubiquinol oxidase, subunit I (EC 1.10.3.-)"	W3Y390_9FIRM	cydA HMPREF1521_1504	Veillonella sp. AS16	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. AS16"	aerobic electron transport chain [GO:0019646]	 integral component of membrane [GO:0016021]; plasma membrane [GO:0005886];cytochrome complex [GO:0070069]	 metal ion binding [GO:0046872];electron transfer activity [GO:0009055]	AIFWTFR	0.95067	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	34260	60245	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	204320	53065	33254	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60245	0	0	0	0	0	204320	0	0	0	0	0
W3Y5A5	PF11398 family protein	W3Y5A5_9FIRM	HMPREF1521_0543	Veillonella sp. AS16	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. AS16"				LIYLSGDGR	0.95327	0	0	0	0	0	0	0	0	0	0	0	84433	0	0	0	37383	0	0	0	0	0	0	0	0	14517	63143	68232	0	0	13295	0	15806	29610	0	0	0	27886	28034	0	0	0	8547.1	0	0	24692	0	0	0	7466.8	0	0	22934	18332	0	10351	0	0	0	0	0	0	0	0	0	0	0	0	0	0	84433	0	37383	0	0	68232	13295	29610	0	28034	8547.1	24692	0	7466.8	22934	10351	0	0	0
W3Y7U3	Uncharacterized protein	W3Y7U3_9FIRM	HMPREF1521_1382	Veillonella sp. AS16	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. AS16"				TTYDFSVS	0.95299	0	0	0	0	0	0	0	0	0	0	54928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4600.8	0	0	0	0	0	54928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	4600.8
R5BD68	ABC transporter ATP-binding protein	R5BD68_9FIRM	BN814_00879	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"			 ATP binding [GO:0005524];ATPase activity [GO:0016887]	DAFSDLFELDK	0.95199	0	0	0	0	0	0	0	0	0	0	0	262820	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	262820	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R5BDM3	Putative selenium metabolism hydrolase	R5BDM3_9FIRM	BN814_01276	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"			hydrolase activity [GO:0016787]	ALNENDAAAETKIK	0.95261	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61534	58920	0	0	0	0	0	0	0	0	0	0	0	0	0	90960	69757	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	61534	0	0	0	0	90960	0	0	0	0	0	0	0	0	0	0	0
R5BFZ0	Uncharacterized protein	R5BFZ0_9FIRM	BN814_01825	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"		integral component of membrane [GO:0016021]		VHEVDVKTETNSDVAER	0.95236	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12281	14090	14144	0	12727	0	13610	0	0	0	0	0	12256	0	0	0	0	0	0	0	0	0	0	0	0	4783	0	0	0	0	9969.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12281	14144	13610	0	12256	0	0	0	0	4783	9969.6	0	0	0
R5BG52	S-adenosylmethionine synthase (AdoMet synthase) (EC 2.5.1.6) (MAT) (Methionine adenosyltransferase)	R5BG52_9FIRM	metK BN814_01847	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"	 S-adenosylmethionine biosynthetic process [GO:0006556];one-carbon metabolic process [GO:0006730]	cytoplasm [GO:0005737]	 magnesium ion binding [GO:0000287]; methionine adenosyltransferase activity [GO:0004478];ATP binding [GO:0005524]	ELDAEIQR	0.9515	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73157	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	73157	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R5BIJ2	tRNA pseudouridine synthase A (EC 5.4.99.12) (tRNA pseudouridine(38-40) synthase) (tRNA pseudouridylate synthase I) (tRNA-uridine isomerase I)	R5BIJ2_9FIRM	truA BN814_02247	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"	tRNA pseudouridine synthesis [GO:0031119]		 tRNA pseudouridine synthase activity [GO:0106029];RNA binding [GO:0003723]	RAIVIFPPLHAILR	0.95232	0	0	0	0	0	14021	0	0	0	0	0	0	0	0	0	0	0	0	0	11377	0	0	0	0	0	0	0	0	34112	0	25218	32574	0	0	0	0	0	16248	0	0	11016	0	0	0	0	0	0	0	0	0	0	0	0	12240	13957	0	0	0	0	0	0	0	0	0	0	0	0	14021	0	0	0	0	11377	0	0	34112	32574	0	16248	11016	0	0	0	12240	13957	0	0	0
R5BMM0	Dynamin family protein	R5BMM0_9FIRM	BN814_00092	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"				YVNISKENCFSDLENR	0.96503	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31915	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31915	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R5BMT8	TPM_phosphatase domain-containing protein	R5BMT8_9FIRM	BN814_01561	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"		integral component of membrane [GO:0016021]		GGGGGGGR	0.95561	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23653	28891	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35641	29513	0	0	0	0	0	0	0	0	28891	0	0	0	0	0	0	0	0	0	0	0	0	0	35641	29513
R5BNL3	Uncharacterized protein	R5BNL3_9FIRM	BN814_00566	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"			"oxidoreductase activity, acting on X-H and Y-H to form an X-Y bond, with a disulfide as acceptor [GO:0050485]"	EVEPQFDK	0.95347	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	94537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	94537	0
R5BNN5	DUF4373 domain-containing protein	R5BNN5_9FIRM	BN814_00588	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"				TVYSEYWLLKPEECK	0.9505	0	0	0	0	0	0	0	0	0	0	0	0	0	20757	0	0	0	0	0	0	0	0	4853.8	0	39729	0	0	0	0	0	13124	0	0	0	0	0	0	0	13367	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20757	0	0	4853.8	39729	0	13124	0	13367	0	0	0	0	0	0	0	0	0
R5BPC9	Uncharacterized protein	R5BPC9_9FIRM	BN814_00774	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"				CKDWDVGK	0.95359	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22669	32595	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32595	0	0	0	0	0	0	0	0	0	0
R5BPM7	Uncharacterized protein	R5BPM7_9FIRM	BN814_00767	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"				ETYLEGHNGYAFLFSKGKSK	0.95442	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35344	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	35344	0	0	0
R5BT93	Putative vitamin B12 transporter BtuB	R5BT93_9FIRM	BN814_02571	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"		 integral component of membrane [GO:0016021];cell outer membrane [GO:0009279]		STYWITNVSANYR	0.9596	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33490	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	33490	0
R5BWU1	Ribonuclease R (RNase R) (EC 3.1.13.1)	R5BWU1_9FIRM	rnr BN814_02542	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"		cytoplasm [GO:0005737]	 RNA binding [GO:0003723];exoribonuclease II activity [GO:0008859]	FGRIGEQR	0.95847	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19730	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19730	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
R5BYX6	Cytosine-specific methyltransferase (EC 2.1.1.37)	R5BYX6_9FIRM	BN814_00281	Veillonella sp. CAG:933	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, environmental samples, Veillonella sp. CAG:933"			DNA (cytosine-5-)-methyltransferase activity [GO:0003886]	DRSDNDLSNILELGADAK	0.9523	0	0	0	0	0	0	23504	0	0	249760	0	0	0	0	0	0	37244	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	66285	31780	0	0	0	16212	19575	11855	49180	10606	21004	0	25817	29423	0	16287	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	23504	249760	0	37244	0	0	0	0	0	0	66285	0	19575	49180	29423	16287	0	0	0	0
A0A134C4G5	DNA repair protein RecN (Recombination protein N)	A0A134C4G5_9FIRM	HMPREF3032_01124	Veillonella sp. DNF00869	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DNF00869"	 DNA repair [GO:0006281];DNA recombination [GO:0006310]		ATP binding [GO:0005524]	EHHARYKITR	0.98361	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	38170	0	53140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	53140	0	0	0	0	0	0	0	0	0	0	0	0
A0A134CBH0	Uncharacterized protein	A0A134CBH0_9FIRM	HMPREF3032_00251	Veillonella sp. DNF00869	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DNF00869"				EIKFDDLTFLLYTHELVPRHYGYVVK	0.95484	0	0	5875	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29491	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50948	23498	15839	0	3191.8	1679.5	5875	0	0	0	0	0	0	0	0	0	0	29491	0	0	0	0	0	0	0	0	50948	3191.8
W1W148	DNA topoisomerase	W1W148_9FIRM	Q620_VSAPLC00001G0010	Veillonella sp. DORA_A_3_16_22	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DORA_A_3_16_22"	DNA topological change [GO:0006265]	chromosome [GO:0005694]	" DNA topoisomerase type I (single strand cut, ATP-independent) activity [GO:0003917]"";""DNA binding [GO:0003677]"	CSQLSTNAHSSFDNPLTSR	0.95303	0	0	0	0	0	0	0	0	0	0	0	0	29840	22933	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	29840	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
W1W6Y1	Uncharacterized protein	W1W6Y1_9FIRM	Q620_VSAC01202G0018	Veillonella sp. DORA_A_3_16_22	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DORA_A_3_16_22"				VQDEKPVYDNVGTDNIDLIK	0.95441	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32020	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32020	0	0	0
W1W9D9	Nitrite and sulphite reductase 4Fe-4S region (Fragment)	W1W9D9_9FIRM	Q620_VSAC01279G0005	Veillonella sp. DORA_A_3_16_22	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DORA_A_3_16_22"			 iron-sulfur cluster binding [GO:0051536]; oxidoreductase activity [GO:0016491];heme binding [GO:0020037]	QRKACFTTGPCI	0.95411	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27739	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27739	0	0	0	0
W1WEQ6	Aldehyde dehydrogenase (NAD) family protein	W1WEQ6_9FIRM	Q620_VSAC00983G0004	Veillonella sp. DORA_A_3_16_22	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DORA_A_3_16_22"			"oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor [GO:0016620]"	EFEIEQAR	0.95529	0	0	0	0	0	0	0	0	0	0	0	0	0	135410	0	0	47978	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	135410	47978	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
W1WHJ5	Hemagluttinin protein (Fragment)	W1WHJ5_9FIRM	Q620_VSAC00779G0001	Veillonella sp. DORA_A_3_16_22	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DORA_A_3_16_22"	pathogenesis [GO:0009405]	outer membrane [GO:0019867]		TTYSTSGK	0.95275	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	921870	0	0	0	72744	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	921870	0	72744	0	0	0	0	0	0	0	0
W1WKY0	Methyltransferase protein	W1WKY0_9FIRM	Q620_VSAC00510G0002	Veillonella sp. DORA_A_3_16_22	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DORA_A_3_16_22"	methylation [GO:0032259]		methyltransferase activity [GO:0008168]	AKEQYYDFVYDTQFR	0.95118	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	103270	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9503	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	103270	0	0	0	0	0	0	0	0	0	9503	0	0	0
W1WSZ6	Uncharacterized protein	W1WSZ6_9FIRM	Q620_VSAC00430G0010	Veillonella sp. DORA_A_3_16_22	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DORA_A_3_16_22"				AHGESYR	0.95066	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16469	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16469	0	0	0	0	0	0	0	0	0	0	0
W1UIE0	Uncharacterized protein (Fragment)	W1UIE0_9FIRM	Q621_VSBC00400G0001	Veillonella sp. DORA_B_18_19_23	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. DORA_B_18_19_23"				LDSSLSK	0.95146	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	31241	66706	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	66706	0	0	0	0	0	0
X8H3S5	UvrABC system protein C (Protein UvrC) (Excinuclease ABC subunit C)	X8H3S5_9FIRM	uvrC HMPREF1504_0993	Veillonella sp. ICM51a	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ICM51a"	 SOS response [GO:0009432];nucleotide-excision repair [GO:0006289]	 excinuclease repair complex [GO:0009380];cytoplasm [GO:0005737]	 excinuclease ABC activity [GO:0009381];DNA binding [GO:0003677]	MFFNYLTEAKTYNMSDK	0.95345	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9812.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9812.7	0	0	0	0	0	0	0
X8H3U5	Signal peptidase I (EC 3.4.21.89)	X8H3U5_9FIRM	lepB HMPREF1504_1421	Veillonella sp. ICM51a	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ICM51a"		integral component of membrane [GO:0016021]	serine-type peptidase activity [GO:0008236]	DPTMNYSR	0.9508	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25835	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25835	0	0	0	0	0
X8H6H7	Lipoprotein	X8H6H7_9FIRM	HMPREF1504_0192	Veillonella sp. ICM51a	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ICM51a"				GFTENIFK	0.95537	0	0	0	0	0	0	0	148130	158790	0	0	0	0	0	0	0	0	49608	0	0	0	0	0	0	0	98945	0	16820	0	10908	0	0	0	0	0	0	7954.6	0	0	0	0	0	0	0	0	0	0	0	0	2201.7	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	158790	0	0	49608	0	0	98945	16820	0	0	7954.6	0	0	0	2201.7	0	0	0	0	0
X8H6S4	"Transcriptional regulator, LysR family"	X8H6S4_9FIRM	HMPREF1504_1844	Veillonella sp. ICM51a	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ICM51a"			 DNA-binding transcription factor activity [GO:0003700];DNA binding [GO:0003677]	NRVTMLKQGR	0.95527	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32108	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32108	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
X8HBT7	Histidine kinase sensor domain protein	X8HBT7_9FIRM	HMPREF1504_0246	Veillonella sp. ICM51a	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ICM51a"			 kinase activity [GO:0016301]; sequence-specific DNA binding [GO:0043565];DNA-binding transcription factor activity [GO:0003700]	KCAYTSRR	0.96557	0	0	97043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	48381	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7016.2	0	0	0	97043	0	0	0	0	0	0	0	0	0	0	0	0	0	48381	0	0	0	0	0	7016.2	0
X8HCF2	Cytidylate kinase (CK) (EC 2.7.4.25) (Cytidine monophosphate kinase) (CMP kinase)	X8HCF2_9FIRM	cmk HMPREF1504_1191	Veillonella sp. ICM51a	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ICM51a"	pyrimidine nucleotide metabolic process [GO:0006220]	cytoplasm [GO:0005737]	 cytidylate kinase activity [GO:0004127];ATP binding [GO:0005524]	EKNDMDR	0.95918	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27410	0	0	0	0	0	14462	7204.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16674	25543	0	0	0	0	0	0	27410	0	14462	0	0	0	0	0	0	0	0	0	0	0	0	25543
X8HHM5	YadA-like C-terminal domain protein (Fragment)	X8HHM5_9FIRM	HMPREF1504_0862	Veillonella sp. ICM51a	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. ICM51a"				VVNTENR	0.96043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	20541	0	0	0	0	0
E4LCD5	Uncharacterized protein	E4LCD5_9FIRM	HMPREF9199_0993	Veillonella sp. oral taxon 158 str. F0412	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. oral taxon 158, Veillonella sp. oral taxon 158 str. F0412"		integral component of membrane [GO:0016021]		SYNFFTGR	0.95253	0	0	0	0	0	9307.7	0	0	0	0	0	0	0	0	0	91167	25463	0	0	0	0	0	0	0	0	0	0	0	0	80064	121450	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	9307.7	0	0	0	91167	0	0	0	80064	121450	0	0	0	0	0	0	0	0	0	0	0
E4LGB9	Uncharacterized protein	E4LGB9_9FIRM	HMPREF9199_0508	Veillonella sp. oral taxon 158 str. F0412	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. oral taxon 158, Veillonella sp. oral taxon 158 str. F0412"	protein secretion [GO:0009306]	integral component of plasma membrane [GO:0005887]		DRDDHLVGTAREVAVGVK	1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	99583	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	99583	0	0	0	0	0	0	0	0	0	0	0
F9N3E9	Methylmalonyl-CoA epimerase (EC 5.1.99.1)	F9N3E9_9FIRM	mce HMPREF9200_1402	Veillonella sp. oral taxon 780 str. F0422	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. oral taxon 780, Veillonella sp. oral taxon 780 str. F0422"			 metal ion binding [GO:0046872]; methylmalonyl-CoA epimerase activity [GO:0004493];lactoylglutathione lyase activity [GO:0004462]	AKGVQLIDEEPR	0.95483	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27516	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27516	0	0	0	0	0	0	0	0	0	0
F9N3I3	Tartrate dehydratase subunit alpha (EC 4.2.1.32)	F9N3I3_9FIRM	HMPREF9200_1438	Veillonella sp. oral taxon 780 str. F0422	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. oral taxon 780, Veillonella sp. oral taxon 780 str. F0422"			L(+)-tartrate dehydratase activity [GO:0008730]	DDFVMHRR	0.95622	0	0	0	0	0	0	0	0	0	0	0	0	0	186110	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	112250	0	0	0	43316	21513	0	0	0	0	0	0	0	0	0	0	20482	0	8414.8	0	2147.6	0	0	65697	34975	0	0	0	41450	0	0	0	0	0	0	186110	0	0	0	0	0	0	112250	0	43316	0	0	0	20482	2147.6	65697	0	41450
F9N3M8	Histidine--tRNA ligase (EC 6.1.1.21) (Histidyl-tRNA synthetase) (HisRS)	F9N3M8_9FIRM	hisS HMPREF9200_1484	Veillonella sp. oral taxon 780 str. F0422	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. oral taxon 780, Veillonella sp. oral taxon 780 str. F0422"	histidyl-tRNA aminoacylation [GO:0006427]	cytoplasm [GO:0005737]	 histidine-tRNA ligase activity [GO:0004821];ATP binding [GO:0005524]	ILDCKEEK	0.95777	0	0	0	0	0	0	0	0	19419	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6942.2	0	0	0	0	0	0	0	0	0	0	0	0	0	24329	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19419	0	0	0	0	0	6942.2	0	0	0	0	24329	0	0	0	0	0	0	0	0
F9N4E7	Uncharacterized protein	F9N4E7_9FIRM	HMPREF9200_0914	Veillonella sp. oral taxon 780 str. F0422	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. oral taxon 780, Veillonella sp. oral taxon 780 str. F0422"				PVYEGTPK	0.95019	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1104200	283140	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1104200	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F9N5G6	Putative enoyl-[acyl-carrier-protein] reductase II (EC 1.3.-.-)	F9N5G6_9FIRM	HMPREF9200_0754	Veillonella sp. oral taxon 780 str. F0422	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. oral taxon 780, Veillonella sp. oral taxon 780 str. F0422"			nitronate monooxygenase activity [GO:0018580]	IIENLLAR	0.95238	0	0	0	0	0	34515	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	184860	0	114980	69541	0	0	0	0	0	0	0	0	0	0	0	0	0	34515	0	0	0	0	0	0	0	0	0	0	0	0	0	0	184860	114980	0	0	0	0
F9N5K6	Pyruvate formate-lyase-activating enzyme (EC 1.97.1.4)	F9N5K6_9FIRM	pflA HMPREF9200_0374	Veillonella sp. oral taxon 780 str. F0422	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. oral taxon 780, Veillonella sp. oral taxon 780 str. F0422"		cytoplasm [GO:0005737]	" 4 iron, 4 sulfur cluster binding [GO:0051539]; lyase activity [GO:0016829]; metal ion binding [GO:0046872]"";""[formate-C-acetyltransferase]-activating enzyme activity [GO:0043365]"	ASLPPIGDR	0.95495	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12103	0	0	0	26377	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12103	26377	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
F9N6Q8	"ABC transporter, ATP-binding protein"	F9N6Q8_9FIRM	HMPREF9200_0437	Veillonella sp. oral taxon 780 str. F0422	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. oral taxon 780, Veillonella sp. oral taxon 780 str. F0422"			 ATP binding [GO:0005524]; ATPase-coupled amino acid transmembrane transporter activity [GO:0015424];ATPase activity [GO:0016887]	SEAESIAR	0.95057	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	87981	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	281490	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	87981	0	0	0	0	0	0	0	0	0	281490	0	0	0	0
A0A2S7YYQ2	ATP-dependent endonuclease	A0A2S7YYQ2_9FIRM	VEHSUH06_09650	Veillonella sp. S13053-19	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. S13053-19"			endonuclease activity [GO:0004519]	ALAHMLK	0.9918	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	5958.6	7583.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19650	0	0	0	0	0	0	0	0	0	0	0	0	0	7583.9	0	0	0	0	0	0	0	0	0	19650
A0A2S7Z1B5	Uncharacterized protein	A0A2S7Z1B5_9FIRM	VEHSUH06_07265	Veillonella sp. S13053-19	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. S13053-19"	unidirectional conjugation [GO:0009291]	integral component of membrane [GO:0016021]		QHNKSYNGFFFWNHMTESSIKR	0.9568	0	0	0	27464	0	18385	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	7937.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27464	0	0	0	0	0	0	0	0	0	7937.6	0	0	0	0	0	0	0	0	0	0
A0A2S7YSP6	Sigma-70 family RNA polymerase sigma factor	A0A2S7YSP6_9FIRM	VRHSUH10_06970	Veillonella sp. T11011-6	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. T11011-6"	"DNA-templated transcription, initiation [GO:0006352]"		DNA-binding transcription factor activity [GO:0003700]	PLILHYTNK	0.95283	0	0	0	0	0	0	0	0	0	49235	10860	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	16138	22791	0	0	0	7245.4	24096	52577	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	49235	0	0	0	0	0	0	0	0	0	0	22791	7245.4	52577	0	0	0	0	0
A0A2S7YVV7	Nitrous oxide-stimulated promoter family protein	A0A2S7YVV7_9FIRM	VRHSUH10_03750	Veillonella sp. T11011-6	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. T11011-6"				IDACPHMETKTFCSVCK	0.95153	0	0	0	0	0	0	0	0	0	305810	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	14705	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	305810	0	0	0	0	14705	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A2S7ZBF1	Peptidase S8	A0A2S7ZBF1_9FIRM	VCHSUH04_09960	Veillonella sp. T14073-2	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. T14073-2"			serine-type endopeptidase activity [GO:0004252]	SDVDYKEK	0.95009	0	0	0	0	0	0	123460	0	139800	0	484440	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37983	47015	79965	38227	39135	29160	0	0	0	0	42467	26928	0	0	0	0	0	0	0	0	0	0	0	0	0	0	139800	484440	0	0	0	0	0	0	0	0	0	0	79965	39135	0	42467	0	0	0	0
A0A2S7ZHB1	MBL fold hydrolase	A0A2S7ZHB1_9FIRM	VCHSUH04_07040	Veillonella sp. T14073-2	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. T14073-2"			hydrolase activity [GO:0016787]	GIVTCNK	0.95509	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13908	30288	0	0	14517	0	0	0	0	0	0	0	0	0	40623	0	0	0	13853	20226	0	0	0	0	0	18449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30288	14517	0	0	0	40623	20226	0	18449	0
A0A2S7ZHQ2	L(+)-tartrate dehydratase subunit beta	A0A2S7ZHQ2_9FIRM	VCHSUH04_07445	Veillonella sp. T14073-2	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. T14073-2"			hydro-lyase activity [GO:0016836]	KEEVLEELYK	0.95839	0	0	0	0	0	0	0	0	0	0	186500	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	206200	121280	148130	0	0	0	16988	0	0	0	0	0	45659	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	186500	0	0	0	0	0	0	206200	0	16988	0	45659	0	0	0	0	0	0	0
A0A2S7Z986	Uncharacterized protein	A0A2S7Z986_9FIRM	VIHSUH07_08490	Veillonella sp. T34266-5	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. T34266-5"				INIVNNNVENIKNDVK	1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21328	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8235.6	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	21328	0	0	0	0	0	0	0	0	8235.6	0	0	0	0	0	0	0
A0A2S7ZF41	Arylsulfatase	A0A2S7ZF41_9FIRM	VIHSUH07_06150	Veillonella sp. T34266-5	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. T34266-5"		integral component of membrane [GO:0016021]	" transferase activity, transferring phosphorus-containing groups [GO:0016772]"";""sulfuric ester hydrolase activity [GO:0008484]"	TRDFSNSAYR	0.95238	0	0	0	0	0	0	0	0	0	0	0	81281	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50528	0	0	0	0	0	0	0	0	0	0	0	0	0	0	30962	0	0	0	53670	0	0	0	0	19551	37256	0	0	0	0	0	0	0	0	0	0	0	0	0	0	81281	0	0	0	0	0	50528	0	0	0	0	30962	0	53670	19551	37256	0	0	0
A0A2S7ZHU7	Carbonic anhydrase	A0A2S7ZHU7_9FIRM	VIHSUH07_04745	Veillonella sp. T34266-5	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. T34266-5"			 zinc ion binding [GO:0008270];carbonate dehydratase activity [GO:0004089]	FLRQHPLFPR	0.95526	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1668	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1668	0	0	0	0	0	0	0	0	0	0	0
A0A2S7ZHU9	Uncharacterized protein	A0A2S7ZHU9_9FIRM	VIHSUH07_04545	Veillonella sp. T34266-5	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, unclassified Veillonella, Veillonella sp. T34266-5"		integral component of membrane [GO:0016021]		AIEINVVGKK	0.95905	0	0	0	0	0	0	13202	0	7743.5	0	0	0	35782	0	0	6829.2	0	0	0	0	0	0	0	0	0	0	0	5279.7	0	0	0	0	0	89580	0	0	0	0	0	0	8057.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	17992	0	0	0	0	0	0	0	0	0	0	13202	0	35782	6829.2	0	0	0	5279.7	0	89580	0	8057.8	0	0	0	0	0	17992	0	0
A0A2S7ZQC7	Uncharacterized protein	A0A2S7ZQC7_9FIRM	VTHSUH11_04755	Veillonella tobetsuensis	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella tobetsuensis"				FDNGMTNYR	0.9619	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	261900	208200	0	0	98899	0	0	0	0	33803	27621	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	261900	98899	0	33803	0	0
A0A480B568	Uncharacterized protein	A0A480B568_9FIRM	PAGU1579_01690	Veillonella tobetsuensis	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella tobetsuensis"				EDISTYR	0.95417	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A480B7B8	Uncharacterized protein	A0A480B7B8_9FIRM	PAGU1579_10150	Veillonella tobetsuensis	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella tobetsuensis"			 metal ion binding [GO:0046872];acid phosphatase activity [GO:0003993]	RSDAGYGR	0.9549	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24471	0	0	3863	0	0	0	0	0	0	0	0	0	0	21248	8290.7	0	89949	35010	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24471	3863	0	0	0	21248	89949	0	0	0	0	0	0
A0A480B8E7	Vitamin B12 transporter BtuB	A0A480B8E7_9FIRM	btuB PAGU1579_14230	Veillonella tobetsuensis	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, Veillonella, Veillonella tobetsuensis"		 integral component of membrane [GO:0016021];cell outer membrane [GO:0009279]		IGWVMTNPAAFSGEYR	1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27505	64449	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	179130	0	12280	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	64449	0	0	0	0	0	179130	12280	0	0	0
A0A316LH54	DUF2179 domain-containing protein	A0A316LH54_9FIRM	DBY44_06140	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"		integral component of membrane [GO:0016021]		VLYLVVNR	0.95293	10043	6862.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	135970	0	0	16226	0	0	8377.3	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	55069	0	0	0	0	0	0	65720	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10043	0	0	0	0	0	135970	16226	8377.3	0	0	0	0	55069	0	0	65720	0	0	0	0	0
A0A316LHN1	Carbohydrate kinase	A0A316LHN1_9FIRM	DBY44_04755 DBY44_05640	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"			" phosphotransferase activity, alcohol group as acceptor [GO:0016773]"";""kinase activity [GO:0016301]"	WDECCFTGYM	0.96098	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26084	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26084	0	0	0	0	0	0	0	0	0	0	0
A0A316LK16	L-lactate dehydrogenase	A0A316LK16_9FIRM	DBY44_06675	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"	 carboxylic acid metabolic process [GO:0019752];carbohydrate metabolic process [GO:0005975]		L-lactate dehydrogenase activity [GO:0004459]	IDDAFVR	0.95537	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26383	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26383	0	0	0	0	0
A0A316LME2	AsmA_2 domain-containing protein	A0A316LME2_9FIRM	DBY44_01915	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"	protein secretion [GO:0009306]	integral component of plasma membrane [GO:0005887]		DTLAAITSIVADK	0.96667	0	0	0	0	0	0	0	0	0	0	0	0	0	6524.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	6524.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A316LN66	LPS export ABC transporter periplasmic protein LptC	A0A316LN66_9FIRM	lptC DBY44_04435	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"		integral component of plasma membrane [GO:0005887]	lipopolysaccharide transmembrane transporter activity [GO:0015221]	IVNAKALYWVVQKGAER	0.95195	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8923.4	0	18315	0	0	0	0	0	0	0	21023	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13286	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	18315	0	0	21023	0	0	0	0	13286	0
A0A316M2Y4	Uncharacterized protein	A0A316M2Y4_9FIRM	DBY44_02665	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"				ELAHIYR	0.95844	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25706	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	25706	0	0	0	0	0	0	0	0	0	0	0
A0A316M404	Prephenate dehydrogenase/arogenate dehydrogenase family protein	A0A316M404_9FIRM	DBY44_01530	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"	tyrosine biosynthetic process [GO:0006571]		 prephenate dehydrogenase (NADP+) activity [GO:0004665];prephenate dehydrogenase (NAD+) activity [GO:0008977]	LLHEPENK	0.95611	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	216940	84960	65922	0	107050	20269	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	68270	0	0	0	0	0	0	29891	24799	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	216940	107050	0	0	0	0	0	68270	0	29891	0	0	0
A0A349MZL8	ATP synthase gamma chain (ATP synthase F1 sector gamma subunit) (F-ATPase gamma subunit)	A0A349MZL8_9FIRM	atpG DCS74_00160	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"	plasma membrane ATP synthesis coupled proton transport [GO:0042777]	" proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]"";""plasma membrane [GO:0005886]"	" proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]"";""ATP binding [GO:0005524]"	GKFLYRNAK	0.95765	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27184	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27184	0	0	0
A0A349MZU9	DNA-directed DNA polymerase (EC 2.7.7.7) (Fragment)	A0A349MZU9_9FIRM	DCS74_00575	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"	DNA replication [GO:0006260]		 DNA-directed DNA polymerase activity [GO:0003887];3'-5' exonuclease activity [GO:0008408]	SDEELVK	0.95915	0	0	0	0	0	0	0	0	0	0	0	0	0	32929	0	0	0	0	0	0	0	0	0	0	0	45644	0	0	0	0	0	0	0	0	0	0	26497	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	70560	18539	0	0	0	0	0	0	0	0	0	0	0	0	0	0	32929	0	0	0	45644	0	0	0	26497	0	0	0	0	0	70560	0	0	0
A0A349N0J5	Nitrate reductase	A0A349N0J5_9FIRM	DCS74_01875	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"				REYEELQSVYRR	0.95628	0	97688	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	97688	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A349N0Y2	30S ribosomal protein S3	A0A349N0Y2_9FIRM	rpsC DCS74_02595	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"	translation [GO:0006412]	ribosome [GO:0005840]	 rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735];mRNA binding [GO:0003729]	SEQRNKFHR	2	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27352	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	27352	0	0	0	0	0	0	0	0	0
A0A349N1C1	Lactate oxidase (Fragment)	A0A349N1C1_9FIRM	DCS74_03295	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"			oxidoreductase activity [GO:0016491]	GIYGFAR	0.97541	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12255	0	0	16712	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	12255	16712	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A349N1N7	Uncharacterized protein (Fragment)	A0A349N1N7_9FIRM	DCS74_03875	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"				NLEDPTPR	0.95083	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60065	0	7852.9	0	0	6342.9	0	15439	20238	0	0	12439	6807.8	0	0	0	0	6349.7	24727	23568	16208	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60065	6342.9	20238	12439	6807.8	6349.7	24727	0	0	0	0	0
A0A349N1T3	Uncharacterized protein	A0A349N1T3_9FIRM	DCS74_04115	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"				SGFVIEMIRYMIYNK	0.95193	0	0	0	0	0	0	0	1576000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1576000	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A349N1V3	Uncharacterized protein	A0A349N1V3_9FIRM	DCS74_04230	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"				SGAPDGR	0.99187	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13171	6335.1	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	13171	0	0	0	0	0
A0A349N218	Uncharacterized protein	A0A349N218_9FIRM	DCS74_04575	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"		integral component of membrane [GO:0016021]		AFSYKIM	0.95591	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10902	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10902	0	0
A0A349N251	IS3 family transposase (Fragment)	A0A349N251_9FIRM	DCS74_04760	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"	DNA integration [GO:0015074]			WMPPVKFRMTSICSA	0.95043	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44829	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39739	0	0	0	0	0	0	0	0	0	0	0	44829	0	0	0	0	0	0	0	0	0	0	0	0	39739	0
A0A349N2B1	Uncharacterized protein	A0A349N2B1_9FIRM	DCS74_05060	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"				LLLRINIRTQSVDSADALEAATR	0.96296	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24792	0	0	0	0	0	0	0	0	0	10733	0	0	0	0	0	16895	0	0	0	25220	19788	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	37028	0	0	0	0	0	0	0	0	0	0	0	0	0	0	24792	0	0	10733	0	16895	0	25220	0	0	0	0	0	37028	0	0
A0A349N2E4	Uncharacterized protein	A0A349N2E4_9FIRM	DCS74_05225	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"				DLDSPNR	0.95329	0	0	0	0	0	0	0	0	103410	0	87123	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	103410	87123	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A349N2G5	Aspartyl/glutamyl-tRNA(Asn/Gln) amidotransferase subunit B (Asp/Glu-ADT subunit B) (EC 6.3.5.-)	A0A349N2G5_9FIRM	gatB DCS74_05330	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"	translation [GO:0006412]		 glutaminyl-tRNA synthase (glutamine-hydrolyzing) activity [GO:0050567]; transferase activity [GO:0016740];ATP binding [GO:0005524]	TGLSLHSK	0.95353	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	43524	214280	26784	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	116130	30924	163500	106310	80354	81217	11788	0	47470	0	40431	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	43524	214280	0	0	0	0	0	116130	163500	81217	47470	0	0
A0A349N2H7	Amino acid permease	A0A349N2H7_9FIRM	DCS74_05390	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"	amino acid transport [GO:0006865]	integral component of membrane [GO:0016021]	transmembrane transporter activity [GO:0022857]	MEEEVMK	0.95429	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10691	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	10691	0	0	0	0	0
A0A349N2S4	Phosphatase	A0A349N2S4_9FIRM	DCS74_05880	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"			hydrolase activity [GO:0016787]	IEYKNPRR	0.95128	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19816	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	19816	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A349N2Y0	Chloride channel protein	A0A349N2Y0_9FIRM	DCS74_06165	Veillonellaceae bacterium	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium"		integral component of membrane [GO:0016021]	voltage-gated chloride channel activity [GO:0005247]	VDNDAKK	0.95418	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	76374	92356	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	92356	0	0
A0A134C9Z4	" 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase (MECDP-synthase) (MECPP-synthase) (MECPS) (EC 4.6.1.12)]"";""Bifunctional enzyme IspD/IspF [Includes: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase (EC 2.7.7.60) (4-diphosphocytidyl-2C-methyl-D-erythritol synthase) (MEP cytidylyltransferase) (MCT)"	A0A134C9Z4_9FIRM	ispDF HMPREF3191_01463	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"	" terpenoid biosynthetic process [GO:0016114]"";""isopentenyl diphosphate biosynthetic process, methylerythritol 4-phosphate pathway [GO:0019288]"		" 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase activity [GO:0050518]; metal ion binding [GO:0046872]"";""2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase activity [GO:0008685]"	SRFMWDK	0.96	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54965	0	0	45890	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	54965	45890
A0A134CAB5	"Peptidase, S41 family"	A0A134CAB5_9FIRM	HMPREF3191_01511	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"		integral component of membrane [GO:0016021]	serine-type peptidase activity [GO:0008236]	LDFESDTK	0.95588	0	0	0	0	0	0	0	47990	8241.7	0	0	0	0	0	0	22966	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1774.5	5275.9	4355.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	47990	0	0	22966	0	0	0	0	0	0	0	0	0	0	0	5275.9	0	0	0	0
A0A134CM09	Bacterial type II secretion system protein F domain protein	A0A134CM09_9FIRM	HMPREF3191_00485	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"		integral component of membrane [GO:0016021]		ESFHMIR	0.96125	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39547	0	0	0	0	44876	107110	0	0	0	0	0	45375	251810	428510	0	0	11523	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	39547	0	107110	0	45375	428510	11523	0	0	0
A0A134CNJ9	"Malonate decarboxylase, alpha subunit"	A0A134CNJ9_9FIRM	HMPREF3191_00218	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"			transferase activity [GO:0016740]	MNSVENGR	0.95607	0	0	0	105680	0	0	0	0	0	66042	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	50808	0	5426.1	0	0	6204.5	0	0	0	0	0	0	0	0	0	0	0	0	0	105680	0	66042	0	0	0	0	0	0	0	0	0	0	0	0	50808	6204.5	0	0	0	0
A0A134CNK7	"Putative ATP synthase F0, A subunit"	A0A134CNK7_9FIRM	HMPREF3191_00146	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"	xenobiotic transport [GO:0042908]	integral component of membrane [GO:0016021]	efflux transmembrane transporter activity [GO:0015562]	STIVGIR	0.95631	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44830	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	44830	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A134CNZ9	Uncharacterized protein	A0A134CNZ9_9FIRM	HMPREF3191_00177	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"				TEMIREEK	0.95289	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	75907	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	75907	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A134CP89	"Transcriptional regulator, DeoR family"	A0A134CP89_9FIRM	HMPREF3191_00076	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"			DNA-binding transcription factor activity [GO:0003700]	REYFSLYIKK	0.95941	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1632.8	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	1632.8	0	0	0	0	0	0	0	0	0	0	0
A0A134CPF9	Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23) (OMP decarboxylase) (OMPDCase) (OMPdecase)	A0A134CPF9_9FIRM	pyrF HMPREF3191_00080	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"	 'de novo' UMP biosynthetic process [GO:0044205];'de novo' pyrimidine nucleobase biosynthetic process [GO:0006207]		orotidine-5'-phosphate decarboxylase activity [GO:0004590]	ETGRSNAIEDDVR	0.95916	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8142	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	8142	0	0	0	0	0	0	0	0	0
A0A134CPH1	Large-conductance mechanosensitive channel	A0A134CPH1_9FIRM	mscL HMPREF3191_00014	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"		integral component of plasma membrane [GO:0005887]	mechanosensitive ion channel activity [GO:0008381]	EELIATCHPRCTAADAIVECCFDCRK	0.95918	0	280470	0	0	0	299180	0	0	0	0	56041	0	65601	24591	53650	0	0	221730	0	0	0	0	0	0	0	104780	0	0	0	0	0	0	0	0	51151	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	60508	59897	0	0	0	0	0	0	0	0	0	0	0	0	0	0	280470	299180	0	56041	65601	221730	0	0	104780	0	0	51151	0	0	0	0	60508	59897	0	0	0	0
A0A134CPI5	"Malonate decarboxylase, alpha subunit"	A0A134CPI5_9FIRM	HMPREF3191_00036	Veillonellaceae bacterium DNF00626	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00626"			transferase activity [GO:0016740]	FEPPEYR	0.95333	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26142	0	0	0	0	0	0	0	11658	13581	0	0	0	0	0	0	0	0	0	0	0	20070	0	0	0	0	7149.9	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	26142	0	0	13581	0	0	0	20070	0	7149.9	0	0	0
A0A134CJK8	Uncharacterized protein (Fragment)	A0A134CJK8_9FIRM	HMPREF3033_00711	Veillonellaceae bacterium DNF00751	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00751"	pathogenesis [GO:0009405]	outer membrane [GO:0019867]		PVNKEDGQPMMGTEHK	0.9654	0	0	0	0	0	0	0	458670	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	458670	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A134CPK4	Phage terminase large subunit (Fragment)	A0A134CPK4_9FIRM	HMPREF3033_00066	Veillonellaceae bacterium DNF00751	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00751"				TDNTKLRQYLEDFIYVEK	0.95086	5932.5	0	0	0	36504	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	65697	20409	17196	8503.3	0	0	0	0	25155	34381	30320	14441	21162	0	13574	0	0	0	0	0	0	0	0	0	0	0	5932.5	36504	0	0	0	0	0	0	0	0	0	0	0	65697	17196	0	34381	21162	13574	0	0	0
A0A134CPL0	Uncharacterized protein (Fragment)	A0A134CPL0_9FIRM	HMPREF3033_00068	Veillonellaceae bacterium DNF00751	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium DNF00751"				LRLCKDDK	0.95018	0	0	0	0	0	0	0	169720	571590	0	177170	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	571590	177170	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0
A0A134CJJ9	Uncharacterized protein	A0A134CJJ9_9FIRM	HMPREF3182_00492	Veillonellaceae bacterium KA00182	"cellular organisms, Bacteria, Terrabacteria group, Firmicutes, Negativicutes, Veillonellales, Veillonellaceae, unclassified Veillonellaceae, Veillonellaceae bacterium KA00182"				VITWFLILFKIK	0.95587	0	0	0	36965	31421	28944	0	0	0	0	0	0	0	0	0	0	0	11179	0	0	0	0	0	0	0	0	0	0	0	0	7172.2	0	46108	80768	23022	28235	0	4656.8	0	0	25434	0	0	0	0	0	0	0	0	0	0	0	0	0	0	0	22640	0	0	0	0	0	0	0	6460.5	10103	0	36965	0	0	0	11179	0	0	0	0	46108	80768	4656.8	25434	0	0	0	0	22640	0	0	10103