Header -------------------------------------------------------- Search title orb_190624_AE-MF-7_#1-2.raw Timestamp 2019-06-28T04:16:06Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/mascotdata/data/20190628/F081292.dat Peak list data path D:\data\oda\190624_AE-MF-7\orb_190624_AE-MF-7_#1-2.raw Peak list format Mascot generic Search type MIS Mascot version 2.6.0 Database SwissProt Fasta file SwissProt_2017_05.fasta Total sequences 554515 Total residues 198509421 Sequences after taxonomy filter 20202 Number of queries 3887 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter . . . . . . . . . . . . . . . . Homo sapiens (human) Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 198 497 1 1 1 365.7084 729.4023 2 729.4021 0.0002 0 24.28 0.038 K GPGITGTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1742.1742.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 245 72 1 1 1 380.209 758.4034 2 758.4035 -0.0001 0 25.19 0.037 K QTQLNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1165.1165.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 248 167 1 1 1 380.2214 758.4283 2 758.4286 -0.0003 0 30.26 0.012 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1272.1272.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 249 343 1 1 1 380.2214 758.4283 2 758.4286 -0.0003 0 30.38 0.012 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1508.1508.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 250 272 1 1 1 380.2215 758.4284 2 758.4286 -0.0002 0 32.63 0.0073 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1402.1402.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 251 55 1 1 1 380.2216 758.4286 2 758.4286 0 0 41.09 0.001 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1144.1144.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 252 490 2 1 1 380.2216 758.4287 2 758.4286 0 0 25.74 0.036 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1730.1730.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 458 972 1 1 1 426.7049 851.3952 2 851.396 -0.0007 0 36.05 0.0011 K CGVQNFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2436.2436.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 459 732 1 1 1 426.705 851.3954 2 851.396 -0.0006 0 27.14 0.0086 K CGVQNFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2095.2095.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 460 658 1 1 1 426.7053 851.396 2 851.396 0.0001 0 29.6 0.0048 K CGVQNFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1989.1989.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 461 876 1 1 1 426.7053 851.3961 2 851.396 0.0001 0 46.97 8.80E-05 K CGVQNFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2303.2303.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 462 810 1 1 1 426.7054 851.3962 2 851.396 0.0002 0 34.82 0.0015 K CGVQNFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2204.2204.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 602 1917 1 1 1 461.2554 920.4963 2 920.4967 -0.0005 0 32.88 0.0029 K TINVEFAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3539.3539.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 603 2140 1 1 1 461.2555 920.4965 2 920.4967 -0.0002 0 32.66 0.0031 K TINVEFAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3801.3801.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 605 2028 1 1 1 461.2556 920.4966 2 920.4967 -0.0001 0 27.37 0.01 K TINVEFAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3670.3670.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 957 2734 1 1 1 545.759 1089.5035 2 1089.5051 -0.0016 0 29.16 0.0041 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4478.4478.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 958 1204 1 1 1 545.7593 1089.504 2 1089.5051 -0.0011 0 31.63 0.0041 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2728.2728.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 959 672 1 1 1 545.7593 1089.5041 2 1089.5051 -0.0009 0 55.77 1.60E-05 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2008.2008.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 960 1316 1 1 1 545.7594 1089.5042 2 1089.5051 -0.0008 0 26.58 0.0053 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2862.2862.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 961 743 1 1 1 545.7596 1089.5047 2 1089.5051 -0.0003 0 43.91 0.00021 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2110.2110.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 962 3112 1 1 1 545.7596 1089.5047 2 1089.5051 -0.0003 0 27.81 0.0087 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4898.4898.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 963 2862 1 1 1 545.7596 1089.5047 2 1089.5051 -0.0003 0 21.99 0.009 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4625.4625.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 964 2991 1 1 1 545.7597 1089.5049 2 1089.5051 -0.0002 0 27.58 0.0062 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4768.4768.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 965 883 1 1 1 545.7598 1089.505 2 1089.5051 -0.0001 0 31.98 0.0033 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2312.2312.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 966 963 1 1 1 545.7598 1089.505 2 1089.5051 -0.0001 0 36.16 0.0013 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2422.2422.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 967 825 1 1 1 545.7598 1089.5051 2 1089.5051 0 0 30.84 0.0013 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2223.2223.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 968 1074 1 1 1 545.7599 1089.5053 2 1089.5051 0.0003 0 31.94 0.0033 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2566.2566.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1061 1313 1 1 1 563.7923 1125.57 2 1125.5706 -0.0006 0 24.18 0.021 K YGIPEPPEPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2858.2858.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1062 1201 1 1 1 563.7924 1125.5702 2 1125.5706 -0.0004 0 26.78 0.012 K YGIPEPPEPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2724.2724.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1063 1099 1 1 1 563.7924 1125.5703 2 1125.5706 -0.0003 0 20.69 0.036 K YGIPEPPEPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2597.2597.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1086 2702 1 1 1 574.8061 1147.5976 2 1147.5986 -0.0009 0 32.05 0.0053 K NSFQPISSLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4442.4442.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1087 2938 1 1 1 574.8062 1147.5979 2 1147.5986 -0.0007 0 33.1 0.0043 K NSFQPISSLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4709.4709.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1088 2811 1 1 1 574.8063 1147.5981 2 1147.5986 -0.0004 0 41.49 0.00063 K NSFQPISSLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4569.4569.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1089 2575 1 1 1 574.8066 1147.5986 2 1147.5986 0 0 23.43 0.044 K NSFQPISSLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4308.4308.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1167 3240 1 1 1 590.8129 1179.6112 2 1179.6109 0.0003 0 33.41 0.0036 R GQLQSHGVQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5071.5071.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1184 2652 1 1 1 596.2762 1190.5378 2 1190.539 -0.0012 0 52.27 2.00E-05 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4389.4389.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1185 2883 1 1 1 596.2762 1190.5378 2 1190.539 -0.0012 0 51.99 2.10E-05 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4649.4649.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1186 2533 1 1 1 596.2762 1190.5379 2 1190.539 -0.0011 0 53.74 1.40E-05 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4260.4260.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1187 2763 1 1 1 596.2767 1190.5388 2 1190.539 -0.0002 0 60.26 3.70E-06 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4513.4513.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1191 1111 1 1 1 599.3316 1196.6487 2 1196.6513 -0.0027 0 48.68 7.30E-05 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2612.2612.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1193 2620 1 1 1 599.3324 1196.6502 2 1196.6513 -0.0011 0 34.39 0.0017 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4356.4356.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1195 2500 1 1 1 599.3325 1196.6504 2 1196.6513 -0.001 0 33.31 0.0021 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4223.4223.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1196 1813 1 1 1 599.3325 1196.6505 2 1196.6513 -0.0009 0 47.46 8.30E-05 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3422.3422.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1197 1215 1 1 1 599.3326 1196.6507 2 1196.6513 -0.0006 0 57.73 9.10E-06 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2742.2742.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1198 1932 1 1 1 599.3326 1196.6507 2 1196.6513 -0.0006 0 46.9 6.50E-05 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3557.3557.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1199 1330 1 1 1 599.3328 1196.651 2 1196.6513 -0.0004 0 54.77 7.30E-06 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2878.2878.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1200 2048 1 1 1 599.3328 1196.651 2 1196.6513 -0.0004 0 35.39 0.00048 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3692.3692.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1201 1568 1 1 1 599.3328 1196.6511 2 1196.6513 -0.0002 0 51.23 4.10E-05 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3152.3152.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1202 3313 1 1 1 599.3328 1196.6511 2 1196.6513 -0.0002 0 31.3 0.0018 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5154.5154.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1203 1692 1 1 1 599.3329 1196.6512 2 1196.6513 -0.0001 0 52.89 1.80E-05 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3287.3287.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1204 2387 1 1 1 599.3331 1196.6516 2 1196.6513 0.0002 0 39.64 0.00059 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4095.4095.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1205 2156 1 1 1 599.3331 1196.6517 2 1196.6513 0.0004 0 51.35 4.00E-05 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3820.3820.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1206 2743 1 1 1 599.3336 1196.6527 2 1196.6513 0.0013 0 34.5 0.0018 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4487.4487.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1523 1675 1 1 1 656.8641 1311.7137 2 1311.7147 -0.0009 0 25.54 0.013 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3268.3268.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1525 1427 1 1 1 656.8642 1311.7138 2 1311.7147 -0.0008 0 29.82 0.0025 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2992.2992.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1527 1312 1 1 1 656.8643 1311.7141 2 1311.7147 -0.0006 0 21.5 0.019 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2857.2857.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1528 2031 1 1 1 656.8643 1311.7141 2 1311.7147 -0.0006 0 24.96 0.016 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3673.3673.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1529 2143 1 1 1 656.8644 1311.7142 2 1311.7147 -0.0005 0 15.45 0.041 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3804.3804.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1530 1547 1 1 1 656.8644 1311.7143 2 1311.7147 -0.0003 0 33.87 0.0011 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3128.3128.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1559 3249 1 1 1 664.8613 1327.7081 2 1327.7095 -0.0014 1 31.83 0.0049 K SEAEQKLPLGTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5081.5081.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1650 1100 1 1 1 688.3282 1374.6419 2 1374.6449 -0.003 0 32.26 0.0035 R MLPQAATEDDIR G Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2598.2598.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1652 1205 1 1 1 688.3285 1374.6424 2 1374.6449 -0.0025 0 28.65 0.0086 R MLPQAATEDDIR G Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2729.2729.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1653 1363 1 1 1 688.3288 1374.643 2 1374.6449 -0.0019 0 32.36 0.0036 R MLPQAATEDDIR G Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2918.2918.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1654 948 1 1 1 688.329 1374.6434 2 1374.6449 -0.0015 0 33.94 0.0026 R MLPQAATEDDIR G Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2401.2401.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1655 872 1 1 1 688.3293 1374.644 2 1374.6449 -0.0009 0 44.35 0.00024 R MLPQAATEDDIR G Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2297.2297.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1812 2773 1 1 1 719.8549 1437.6953 2 1437.6987 -0.0034 0 40.6 0.00036 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4525.4525.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1813 3225 1 1 1 719.8553 1437.696 2 1437.6987 -0.0027 0 46.69 0.00014 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5054.5054.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1814 3665 1 1 1 719.8555 1437.6964 2 1437.6987 -0.0023 0 64.42 9.10E-07 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5733.5733.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1815 2332 1 1 1 719.8557 1437.6969 2 1437.6987 -0.0018 0 80.48 6.70E-08 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4025.4025.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1816 2025 1 1 1 480.2396 1437.697 3 1437.6987 -0.0017 0 21.55 0.0095 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3666.3666.3.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1817 2892 1 1 1 719.8558 1437.6971 2 1437.6987 -0.0016 0 52.1 4.90E-05 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4659.4659.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1818 3059 1 1 1 719.8558 1437.6971 2 1437.6987 -0.0016 0 52.26 4.10E-05 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4840.4840.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1819 2433 1 1 1 719.856 1437.6974 2 1437.6987 -0.0013 0 52.5 1.20E-05 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4148.4148.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1820 2549 1 1 1 719.856 1437.6974 2 1437.6987 -0.0013 0 34.17 0.00062 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4279.4279.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1821 1912 1 1 1 480.2398 1437.6975 3 1437.6987 -0.0012 0 26.77 0.016 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3533.3533.3.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1822 2220 1 1 1 719.8561 1437.6977 2 1437.6987 -0.001 0 103.36 3.60E-10 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3890.3890.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1823 1758 1 1 1 719.8562 1437.6979 2 1437.6987 -0.0008 0 89.1 9.70E-09 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3361.3361.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1824 2103 1 1 1 719.8562 1437.6979 2 1437.6987 -0.0008 0 84.77 2.00E-08 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3759.3759.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1825 1637 1 1 1 719.8563 1437.6981 2 1437.6987 -0.0006 0 72.77 4.10E-07 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3226.3226.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1826 1996 1 1 1 719.8564 1437.6983 2 1437.6987 -0.0004 0 85.76 2.10E-08 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3632.3632.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1827 1883 1 1 1 719.8566 1437.6986 2 1437.6987 -0.0001 0 94.45 2.80E-09 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3501.3501.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1828 2747 1 1 1 719.8567 1437.6988 2 1437.6987 0.0001 0 30.72 0.0032 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4493.4493.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 1829 1780 1 1 1 480.2406 1437.7 3 1437.6987 0.0013 0 26.43 0.01 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3385.3385.3.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2409 1661 1 1 1 864.4132 1726.8119 2 1726.8162 -0.0044 0 67.62 4.60E-07 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3253.3253.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2410 2157 1 1 1 864.4136 1726.8126 2 1726.8162 -0.0036 0 75.3 8.70E-08 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3821.3821.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2411 2638 1 1 1 864.4139 1726.8133 2 1726.8162 -0.0029 0 38.36 0.00025 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4374.4374.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2412 3667 1 1 1 864.414 1726.8135 2 1726.8162 -0.0028 0 59.44 4.90E-06 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5735.5735.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2413 2368 1 1 1 864.4142 1726.8138 2 1726.8162 -0.0024 0 51.15 2.30E-05 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4071.4071.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2414 1931 1 1 1 864.4142 1726.8138 2 1726.8162 -0.0024 0 80.15 3.10E-08 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3556.3556.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2415 1812 1 1 1 864.415 1726.8155 2 1726.8162 -0.0007 0 73.73 1.20E-07 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3421.3421.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2416 1686 1 1 1 864.415 1726.8155 2 1726.8162 -0.0007 0 85.56 9.50E-09 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3280.3280.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2417 2508 1 1 1 864.4153 1726.816 2 1726.8162 -0.0002 0 62.85 1.30E-06 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4231.4231.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2418 2047 1 1 1 864.4154 1726.8163 2 1726.8162 0 0 87.67 6.00E-09 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3691.3691.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2419 2266 1 1 1 864.4156 1726.8166 2 1726.8162 0.0004 0 63.26 2.40E-06 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3946.3946.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 2420 2483 1 1 1 864.4169 1726.8192 2 1726.8162 0.0029 0 55.54 7.30E-06 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4204.4204.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 3501 2077 1 1 1 1267.577 2533.1395 2 2533.1391 0.0004 0 53.36 1.40E-05 K GDPTGAGPEASLEPGADSVSMQAFSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3729.3729.2.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 3508 1346 1 1 1 850.7176 2549.1309 3 2549.134 -0.0031 0 57.05 3.60E-06 K GDPTGAGPEASLEPGADSVSMQAFSR A Oxidation (M) 0.00000000000000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2899.2899.3.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 3509 1235 1 1 1 850.7181 2549.1324 3 2549.134 -0.0016 0 50.88 1.40E-05 K GDPTGAGPEASLEPGADSVSMQAFSR A Oxidation (M) 0.00000000000000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2767.2767.3.dta 1 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2481 103811 99 99 18 18 3862 1507 1 1 1 946.708 3782.8029 4 3782.8057 -0.0028 0 30.48 0.0028 R AQPGAAPGIYQQSAEASSSQGTAANSQSYTIMSPAVLK S Oxidation (M) 0.00000000000000000000000000000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3082.3082.4.dta 1 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 75 92610 8 8 2 2 248 167 1 0 1 380.2214 758.4283 2 758.4286 -0.0003 0 30.26 0.012 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1272.1272.2.dta 1 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 75 92610 8 8 2 2 249 343 1 0 1 380.2214 758.4283 2 758.4286 -0.0003 0 30.38 0.012 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1508.1508.2.dta 1 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 75 92610 8 8 2 2 250 272 1 0 1 380.2215 758.4284 2 758.4286 -0.0002 0 32.63 0.0073 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1402.1402.2.dta 1 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 75 92610 8 8 2 2 251 55 1 0 1 380.2216 758.4286 2 758.4286 0 0 41.09 0.001 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1144.1144.2.dta 1 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 75 92610 8 8 2 2 252 490 2 0 1 380.2216 758.4287 2 758.4286 0 0 25.74 0.036 K TAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1730.1730.2.dta 1 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 75 92610 8 8 2 2 1061 1313 1 0 1 563.7923 1125.57 2 1125.5706 -0.0006 0 24.18 0.021 K YGIPEPPEPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2858.2858.2.dta 1 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 75 92610 8 8 2 2 1062 1201 1 0 1 563.7924 1125.5702 2 1125.5706 -0.0004 0 26.78 0.012 K YGIPEPPEPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2724.2724.2.dta 1 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 75 92610 8 8 2 2 1063 1099 1 0 1 563.7924 1125.5703 2 1125.5706 -0.0003 0 20.69 0.036 K YGIPEPPEPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2597.2597.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 211 2997 1 1 0 374.7154 747.4163 2 747.4167 -0.0004 0 27.18 0.0071 K YLDIPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4774.4774.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 212 2875 1 1 0 374.7156 747.4167 2 747.4167 0 0 21.57 0.031 K YLDIPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4640.4640.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 310 901 1 1 1 406.255 810.4955 2 810.4963 -0.0008 0 39.98 0.00017 K VQQLVPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2336.2336.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 311 674 1 1 1 406.2551 810.4956 2 810.4963 -0.0008 0 30.09 0.0017 K VQQLVPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2010.2010.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 312 835 1 1 1 406.2551 810.4956 2 810.4963 -0.0007 0 34.31 0.00063 K VQQLVPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2240.2240.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 313 745 1 1 1 406.2552 810.4959 2 810.4963 -0.0005 0 29.43 0.0019 K VQQLVPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2112.2112.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1394 1434 1 1 1 628.3055 1254.5965 2 1254.5979 -0.0014 0 47.1 0.00011 R DYETATLSDIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3000.3000.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1796 2411 1 1 0 715.3845 1428.7544 2 1428.7572 -0.0029 0 34.81 0.0018 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4123.4123.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1797 2890 1 1 0 715.3847 1428.7549 2 1428.7572 -0.0024 0 44.18 0.00029 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4657.4657.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1798 2757 1 1 0 715.3849 1428.7553 2 1428.7572 -0.0019 0 60.35 7.10E-06 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4505.4505.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1799 2640 1 1 0 715.3854 1428.7563 2 1428.7572 -0.0009 0 66.28 1.80E-06 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4377.4377.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1800 2522 1 1 0 715.3856 1428.7567 2 1428.7572 -0.0005 0 62.46 4.40E-06 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4249.4249.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1991 2398 1 1 1 757.9053 1513.796 2 1513.7988 -0.0028 0 63.33 1.20E-06 K LVSIGAEEIVDGNAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4108.4108.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1992 2509 1 1 1 757.9063 1513.7981 2 1513.7988 -0.0007 0 82.65 3.80E-08 K LVSIGAEEIVDGNAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4233.4233.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1993 1983 1 1 1 757.9064 1513.7983 2 1513.7988 -0.0005 0 24.36 0.0052 K LVSIGAEEIVDGNAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3615.3615.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 1994 2303 1 1 1 757.9065 1513.7984 2 1513.7988 -0.0003 0 45.73 5.20E-05 K LVSIGAEEIVDGNAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3989.3989.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2034 3668 1 1 0 769.3897 1536.7649 2 1536.7671 -0.0023 0 60.28 7.50E-06 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5736.5736.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2035 2834 1 1 0 769.3898 1536.7651 2 1536.7671 -0.002 0 66.52 1.80E-06 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4593.4593.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2036 2597 1 1 0 769.39 1536.7655 2 1536.7671 -0.0017 0 70.88 2.30E-07 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4331.4331.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2037 2720 1 1 0 769.3901 1536.7657 2 1536.7671 -0.0014 0 74.65 1.00E-07 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4463.4463.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2038 2480 1 1 0 769.3907 1536.7669 2 1536.7671 -0.0002 0 46.99 7.10E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4201.4201.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2039 2962 1 1 0 769.3909 1536.7672 2 1536.7671 0 0 40.53 0.00041 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4736.4736.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2078 1841 1 1 0 781.3671 1560.7196 2 1560.7242 -0.0046 0 24.07 0.017 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3453.3453.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2080 1331 1 1 0 781.3687 1560.7229 2 1560.7242 -0.0013 0 44.2 0.00018 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2879.2879.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2081 1216 1 1 0 781.3689 1560.7232 2 1560.7242 -0.001 0 51.69 3.40E-05 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2743.2743.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2082 1571 1 1 0 781.369 1560.7234 2 1560.7242 -0.0008 0 23.3 0.023 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3155.3155.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2084 1109 1 1 0 781.3693 1560.724 2 1560.7242 -0.0002 0 45.9 0.00011 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2610.2610.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2086 1449 1 1 0 781.3698 1560.7251 2 1560.7242 0.0009 0 33.8 0.0021 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3017.3017.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2191 2833 1 1 0 804.9057 1607.7968 2 1607.7977 -0.0009 0 64.69 2.70E-06 K CQLEINFNTLQTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4592.4592.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2192 2721 1 1 0 804.906 1607.7975 2 1607.7977 -0.0003 0 53.76 9.10E-06 K CQLEINFNTLQTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4464.4464.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2474 2774 1 1 1 871.4091 1740.8037 2 1740.8054 -0.0017 0 83.29 2.00E-08 R ETTDTDTADQVIASFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4526.4526.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2475 2505 1 1 1 581.2753 1740.804 3 1740.8054 -0.0014 0 33.32 0.002 R ETTDTDTADQVIASFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4229.4229.3.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2476 2654 1 1 1 871.4095 1740.8044 2 1740.8054 -0.001 0 95.18 1.30E-09 R ETTDTDTADQVIASFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4391.4391.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2477 2529 1 1 1 871.4097 1740.8048 2 1740.8054 -0.0006 0 93.77 1.90E-09 R ETTDTDTADQVIASFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4257.4257.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2478 2396 1 1 1 871.4099 1740.8052 2 1740.8054 -0.0003 0 80.01 4.30E-08 R ETTDTDTADQVIASFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4106.4106.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2479 2418 1 1 1 871.41 1740.8054 2 1740.8054 0 0 87.27 8.20E-09 R ETTDTDTADQVIASFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4131.4131.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2539 2292 1 1 1 888.4246 1774.8346 2 1774.8373 -0.0028 0 73.95 2.40E-07 K DDPVTNLNNAFEVAEK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3977.3977.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2540 2391 1 1 1 888.4252 1774.8359 2 1774.8373 -0.0014 0 89.76 4.90E-09 K DDPVTNLNNAFEVAEK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4100.4100.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2658 1471 1 1 1 904.929 1807.8435 2 1807.8451 -0.0016 0 66.97 5.80E-07 R MAPYQGPDAVPGALDYK S Oxidation (M) 0.10000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3042.3042.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2659 1788 1 1 1 904.9298 1807.8451 2 1807.8451 0 0 46.14 4.70E-05 R MAPYQGPDAVPGALDYK S Oxidation (M) 0.10000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3394.3394.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2660 1606 1 1 1 904.93 1807.8454 2 1807.8451 0.0004 0 83.11 2.70E-08 R MAPYQGPDAVPGALDYK S Oxidation (M) 0.10000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3192.3192.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2661 1480 1 1 1 904.9304 1807.8462 2 1807.8451 0.0011 0 81.13 3.00E-08 R MAPYQGPDAVPGALDYK S Oxidation (M) 0.10000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3052.3052.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2914 1666 1 1 1 960.5064 1918.9983 2 1919 -0.0017 0 95.41 1.60E-09 K LSGSNPYTTVTPQIINSK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3259.3259.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2915 1709 1 1 1 960.5066 1918.9986 2 1919 -0.0014 0 81.97 3.60E-08 K LSGSNPYTTVTPQIINSK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3306.3306.2.dta 2 1 ACTN4_HUMAN Alpha-actinin-4 OS=Homo sapiens GN=ACTN4 PE=1 SV=2 1742 105245 45 45 12 12 2916 1583 1 1 1 960.5085 1919.0024 2 1919 0.0024 0 54.77 1.80E-05 K LSGSNPYTTVTPQIINSK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3166.3166.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 211 2997 1 0 0 374.7154 747.4163 2 747.4167 -0.0004 0 27.18 0.0071 K YLDIPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4774.4774.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 212 2875 1 0 0 374.7156 747.4167 2 747.4167 0 0 21.57 0.031 K YLDIPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4640.4640.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 1796 2411 1 0 0 715.3845 1428.7544 2 1428.7572 -0.0029 0 34.81 0.0018 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4123.4123.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 1797 2890 1 0 0 715.3847 1428.7549 2 1428.7572 -0.0024 0 44.18 0.00029 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4657.4657.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 1798 2757 1 0 0 715.3849 1428.7553 2 1428.7572 -0.0019 0 60.35 7.10E-06 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4505.4505.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 1799 2640 1 0 0 715.3854 1428.7563 2 1428.7572 -0.0009 0 66.28 1.80E-06 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4377.4377.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 1800 2522 1 0 0 715.3856 1428.7567 2 1428.7572 -0.0005 0 62.46 4.40E-06 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4249.4249.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2034 3668 1 0 0 769.3897 1536.7649 2 1536.7671 -0.0023 0 60.28 7.50E-06 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5736.5736.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2035 2834 1 0 0 769.3898 1536.7651 2 1536.7671 -0.002 0 66.52 1.80E-06 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4593.4593.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2036 2597 1 0 0 769.39 1536.7655 2 1536.7671 -0.0017 0 70.88 2.30E-07 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4331.4331.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2037 2720 1 0 0 769.3901 1536.7657 2 1536.7671 -0.0014 0 74.65 1.00E-07 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4463.4463.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2038 2480 1 0 0 769.3907 1536.7669 2 1536.7671 -0.0002 0 46.99 7.10E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4201.4201.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2039 2962 1 0 0 769.3909 1536.7672 2 1536.7671 0 0 40.53 0.00041 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4736.4736.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2056 3033 1 0 1 771.9202 1541.8259 2 1541.8301 -0.0042 0 42.99 9.30E-05 K LVSIGAEEIVDGNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4812.4812.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2078 1841 1 0 0 781.3671 1560.7196 2 1560.7242 -0.0046 0 24.07 0.017 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3453.3453.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2080 1331 1 0 0 781.3687 1560.7229 2 1560.7242 -0.0013 0 44.2 0.00018 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2879.2879.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2081 1216 1 0 0 781.3689 1560.7232 2 1560.7242 -0.001 0 51.69 3.40E-05 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2743.2743.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2082 1571 1 0 0 781.369 1560.7234 2 1560.7242 -0.0008 0 23.3 0.023 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3155.3155.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2084 1109 1 0 0 781.3693 1560.724 2 1560.7242 -0.0002 0 45.9 0.00011 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2610.2610.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2086 1449 1 0 0 781.3698 1560.7251 2 1560.7242 0.0009 0 33.8 0.0021 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3017.3017.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2191 2833 1 0 0 804.9057 1607.7968 2 1607.7977 -0.0009 0 64.69 2.70E-06 K CQLEINFNTLQTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4592.4592.2.dta 2 2 ACTN1_HUMAN Alpha-actinin-1 OS=Homo sapiens GN=ACTN1 PE=1 SV=2 656 103563 22 22 6 6 2192 2721 1 0 0 804.906 1607.7975 2 1607.7977 -0.0003 0 53.76 9.10E-06 K CQLEINFNTLQTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4464.4464.2.dta 2 ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 373 104358 9 9 3 3 2034 3668 1 0 0 769.3897 1536.7649 2 1536.7671 -0.0023 0 60.28 7.50E-06 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5736.5736.2.dta 2 ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 373 104358 9 9 3 3 2035 2834 1 0 0 769.3898 1536.7651 2 1536.7671 -0.002 0 66.52 1.80E-06 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4593.4593.2.dta 2 ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 373 104358 9 9 3 3 2036 2597 1 0 0 769.39 1536.7655 2 1536.7671 -0.0017 0 70.88 2.30E-07 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4331.4331.2.dta 2 ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 373 104358 9 9 3 3 2037 2720 1 0 0 769.3901 1536.7657 2 1536.7671 -0.0014 0 74.65 1.00E-07 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4463.4463.2.dta 2 ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 373 104358 9 9 3 3 2038 2480 1 0 0 769.3907 1536.7669 2 1536.7671 -0.0002 0 46.99 7.10E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4201.4201.2.dta 2 ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 373 104358 9 9 3 3 2039 2962 1 0 0 769.3909 1536.7672 2 1536.7671 0 0 40.53 0.00041 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4736.4736.2.dta 2 ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 373 104358 9 9 3 3 2056 3033 1 0 1 771.9202 1541.8259 2 1541.8301 -0.0042 0 42.99 9.30E-05 K LVSIGAEEIVDGNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4812.4812.2.dta 2 ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 373 104358 9 9 3 3 2191 2833 1 0 0 804.9057 1607.7968 2 1607.7977 -0.0009 0 64.69 2.70E-06 K CQLEINFNTLQTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4592.4592.2.dta 2 ACTN2_HUMAN Alpha-actinin-2 OS=Homo sapiens GN=ACTN2 PE=1 SV=1 373 104358 9 9 3 3 2192 2721 1 0 0 804.906 1607.7975 2 1607.7977 -0.0003 0 53.76 9.10E-06 K CQLEINFNTLQTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4464.4464.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 211 2997 1 0 0 374.7154 747.4163 2 747.4167 -0.0004 0 27.18 0.0071 K YLDIPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4774.4774.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 212 2875 1 0 0 374.7156 747.4167 2 747.4167 0 0 21.57 0.031 K YLDIPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4640.4640.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 2034 3668 1 0 0 769.3897 1536.7649 2 1536.7671 -0.0023 0 60.28 7.50E-06 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5736.5736.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 2035 2834 1 0 0 769.3898 1536.7651 2 1536.7671 -0.002 0 66.52 1.80E-06 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4593.4593.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 2036 2597 1 0 0 769.39 1536.7655 2 1536.7671 -0.0017 0 70.88 2.30E-07 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4331.4331.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 2037 2720 1 0 0 769.3901 1536.7657 2 1536.7671 -0.0014 0 74.65 1.00E-07 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4463.4463.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 2038 2480 1 0 0 769.3907 1536.7669 2 1536.7671 -0.0002 0 46.99 7.10E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4201.4201.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 2039 2962 1 0 0 769.3909 1536.7672 2 1536.7671 0 0 40.53 0.00041 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4736.4736.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 2191 2833 1 0 0 804.9057 1607.7968 2 1607.7977 -0.0009 0 64.69 2.70E-06 K CQLEINFNTLQTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4592.4592.2.dta 2 ACTN3_HUMAN Alpha-actinin-3 OS=Homo sapiens GN=ACTN3 PE=1 SV=2 357 103917 10 10 3 3 2192 2721 1 0 0 804.906 1607.7975 2 1607.7977 -0.0003 0 53.76 9.10E-06 K CQLEINFNTLQTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4464.4464.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 35 92 2 1 1 313.6604 625.3062 2 625.3071 -0.0009 0 19.85 0.013 K FSSASK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1187.1187.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 36 9 1 1 1 313.6605 625.3065 2 625.3071 -0.0006 0 25.35 0.0038 K FSSASK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1044.1044.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 37 207 1 1 1 313.6606 625.3066 2 625.3071 -0.0006 0 22.41 0.0075 K FSSASK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1321.1321.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 38 303 1 1 1 313.6606 625.3066 2 625.3071 -0.0005 0 23.49 0.0058 K FSSASK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1444.1444.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 39 365 1 1 1 313.6606 625.3066 2 625.3071 -0.0005 0 17.19 0.025 K FSSASK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1544.1544.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 41 448 1 1 1 313.661 625.3075 2 625.3071 0.0004 0 14.95 0.037 K FSSASK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1665.1665.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 86 778 1 1 1 334.6896 667.3647 2 667.3653 -0.0006 0 25.92 0.0092 R APPIDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2161.2161.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 88 849 1 1 1 334.6897 667.3649 2 667.3653 -0.0004 0 24.9 0.012 R APPIDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2262.2262.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 89 411 1 1 1 334.6898 667.365 2 667.3653 -0.0003 0 24.09 0.014 R APPIDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1613.1613.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 90 677 1 1 1 334.6898 667.365 2 667.3653 -0.0003 0 21.21 0.027 R APPIDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2015.2015.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 91 539 1 1 1 334.6898 667.365 2 667.3653 -0.0003 0 21.53 0.025 R APPIDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1810.1810.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 92 483 1 1 1 334.6898 667.365 2 667.3653 -0.0003 0 38.88 0.00047 R APPIDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1719.1719.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 93 604 1 1 1 334.6898 667.3651 2 667.3653 -0.0002 0 25.82 0.0094 R APPIDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1909.1909.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 226 1105 1 1 1 379.1849 756.3553 2 756.3555 -0.0002 0 17.42 0.043 R AFGSGYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2604.2604.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 231 930 1 1 1 379.1853 756.356 2 756.3555 0.0005 0 17.19 0.045 R AFGSGYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2377.2377.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 370 2768 1 1 1 415.2481 828.4816 2 828.4817 -0.0001 0 35.24 0.0024 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4519.4519.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 371 2424 1 1 1 415.2483 828.4821 2 828.4817 0.0004 0 43.79 0.00033 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4138.4138.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 372 2537 1 1 1 415.2484 828.4823 2 828.4817 0.0006 0 34.42 0.0029 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4265.4265.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 373 2219 1 1 1 415.2484 828.4823 2 828.4817 0.0006 0 49.5 8.90E-05 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3889.3889.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 374 2102 1 1 1 415.2485 828.4824 2 828.4817 0.0007 0 48.08 0.00012 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3758.3758.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 375 1875 1 1 1 415.2485 828.4825 2 828.4817 0.0007 0 39.97 0.0008 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3492.3492.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 376 2658 1 1 1 415.2485 828.4825 2 828.4817 0.0007 0 42.92 0.00041 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4396.4396.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 377 2903 1 1 1 415.2485 828.4825 2 828.4817 0.0007 0 25.23 0.024 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4672.4672.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 378 1992 1 1 1 415.2486 828.4826 2 828.4817 0.0008 0 55.07 2.50E-05 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3626.3626.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 379 2324 1 1 1 415.2487 828.4829 2 828.4817 0.0011 0 38.21 0.0012 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4015.4015.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 380 3037 1 1 1 415.2488 828.483 2 828.4817 0.0013 0 31.69 0.0054 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4817.4817.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 381 1627 1 1 1 415.2494 828.4843 2 828.4817 0.0026 0 28.75 0.01 R GLNISAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3215.3215.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 464 2784 1 1 1 427.7583 853.502 2 853.5021 -0.0002 0 30.31 0.0033 R SILPTAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4539.4539.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 465 2101 1 1 1 427.7583 853.5021 2 853.5021 0 0 29.2 0.0042 R SILPTAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3757.3757.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 466 2536 1 1 1 427.7585 853.5024 2 853.5021 0.0002 0 28.24 0.0052 R SILPTAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4264.4264.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 467 2664 1 1 1 427.7585 853.5024 2 853.5021 0.0002 0 35.45 0.001 R SILPTAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4403.4403.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 468 2218 1 1 1 427.7585 853.5024 2 853.5021 0.0002 0 26.55 0.0077 R SILPTAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3888.3888.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 469 2323 1 1 1 427.7585 853.5024 2 853.5021 0.0003 0 22.17 0.021 R SILPTAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4014.4014.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 848 3254 1 1 1 521.2752 1040.5359 2 1040.5363 -0.0004 1 26.79 0.013 R AAREPNIDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5087.5087.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 1471 644 1 1 1 647.821 1293.6275 2 1293.6313 -0.0038 0 33.06 0.0012 K VAPAQPSEEGPGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1969.1969.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 1472 570 1 1 1 647.822 1293.6294 2 1293.6313 -0.002 0 35.66 0.00097 K VAPAQPSEEGPGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1857.1857.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 1473 508 1 1 1 647.8224 1293.6302 2 1293.6313 -0.0011 0 50.18 4.10E-05 K VAPAQPSEEGPGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1761.1761.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 1476 380 1 1 1 647.8229 1293.6313 2 1293.6313 0 0 43.42 8.50E-05 K VAPAQPSEEGPGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1563.1563.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 1477 449 1 1 1 647.823 1293.6314 2 1293.6313 0.0001 0 39.66 0.00019 K VAPAQPSEEGPGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1667.1667.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 1478 313 1 1 1 647.8233 1293.6321 2 1293.6313 0.0007 0 36.9 0.00054 K VAPAQPSEEGPGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1460.1460.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2019 2208 1 1 1 766.4075 1530.8004 2 1530.8154 -0.015 0 16.13 0.031 R AASIFGGAKPVDTAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3876.3876.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2020 3260 1 1 1 511.2787 1530.8142 3 1530.8154 -0.0012 0 16.53 0.028 R AASIFGGAKPVDTAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5093.5093.3.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2021 3644 1 1 1 766.415 1530.8154 2 1530.8154 0 0 47.24 3.70E-05 R AASIFGGAKPVDTAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5707.5707.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2022 3261 1 1 1 766.4152 1530.8158 2 1530.8154 0.0003 0 44.63 8.30E-05 R AASIFGGAKPVDTAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5094.5094.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2121 143 1 1 1 787.3495 1572.6845 2 1572.6864 -0.0018 0 102.33 1.30E-10 R TGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1244.1244.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2122 248 1 1 1 787.3497 1572.6848 2 1572.6864 -0.0016 0 90 2.30E-09 R TGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1370.1370.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2123 329 1 1 1 787.3497 1572.6849 2 1572.6864 -0.0014 0 83.91 9.30E-09 R TGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1485.1485.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2125 561 1 1 1 787.35 1572.6854 2 1572.6864 -0.001 0 59.42 2.60E-06 R TGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1841.1841.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2126 35 1 1 1 787.3502 1572.6858 2 1572.6864 -0.0006 0 96.6 5.00E-10 R TGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1114.1114.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2127 399 1 1 1 787.3502 1572.6859 2 1572.6864 -0.0005 0 74.71 8.30E-08 R TGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1593.1593.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2128 3880 1 1 1 787.3502 1572.6859 2 1572.6864 -0.0005 0 87.79 4.10E-09 R TGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.984.984.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2129 470 1 1 1 787.3503 1572.686 2 1572.6864 -0.0004 0 53.03 1.20E-05 R TGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1698.1698.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2338 214 1 1 1 840.8682 1679.7219 2 1679.7235 -0.0016 0 53.86 6.00E-06 R SQSSDTEQQSPTSGGGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1329.1329.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2339 14 1 1 1 840.8683 1679.7221 2 1679.7235 -0.0013 0 93.2 6.90E-10 R SQSSDTEQQSPTSGGGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1054.1054.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2340 89 1 1 1 840.8683 1679.7221 2 1679.7235 -0.0013 0 105.79 3.80E-11 R SQSSDTEQQSPTSGGGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1184.1184.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2341 263 1 1 1 840.8691 1679.7237 2 1679.7235 0.0003 0 68.94 2.20E-07 R SQSSDTEQQSPTSGGGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1390.1390.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2555 348 1 1 1 892.3973 1782.78 2 1782.7868 -0.0068 1 29.62 0.0035 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1517.1517.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2558 657 1 1 1 892.3991 1782.7837 2 1782.7868 -0.0031 1 23.78 0.014 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1987.1987.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2559 277 1 1 1 892.3992 1782.7838 2 1782.7868 -0.003 1 24.25 0.012 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1407.1407.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2560 532 1 1 1 892.3994 1782.7843 2 1782.7868 -0.0025 1 29.06 0.0043 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1800.1800.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2561 459 1 1 1 595.2688 1782.7846 3 1782.7868 -0.0022 1 19.12 0.04 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1683.1683.3.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2562 502 1 1 1 892.3998 1782.785 2 1782.7868 -0.0018 1 23.22 0.016 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1750.1750.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2563 415 1 1 1 892.3999 1782.7853 2 1782.7868 -0.0015 1 26.08 0.0088 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1620.1620.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2564 223 1 1 1 595.2691 1782.7855 3 1782.7868 -0.0013 1 26.72 0.0076 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1339.1339.3.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2565 555 1 1 1 595.2692 1782.7857 3 1782.7868 -0.0011 1 20.02 0.035 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1835.1835.3.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2566 312 1 1 1 595.2693 1782.786 3 1782.7868 -0.0007 1 29.7 0.0038 R STPKEDDSSASTSQSTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1459.1459.3.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2689 474 1 1 1 908.9155 1815.8164 2 1815.8195 -0.0031 1 34.2 0.0016 R SRTGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1705.1705.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 2690 550 1 1 1 908.9174 1815.8203 2 1815.8195 0.0008 1 26.28 0.0097 R SRTGSESSQTGTSTTSSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1827.1827.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 3217 2688 1 1 1 1038.4108 2074.807 2 2074.8127 -0.0057 0 26.92 0.002 K YAALSVDGEDENEGEDYAE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4428.4428.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 3218 2820 1 1 1 1038.4115 2074.8084 2 2074.8127 -0.0042 0 23.69 0.0043 K YAALSVDGEDENEGEDYAE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4579.4579.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 3219 2554 1 1 1 1038.4117 2074.8089 2 2074.8127 -0.0037 0 21.48 0.0071 K YAALSVDGEDENEGEDYAE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4283.4283.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 3220 3120 1 1 1 1038.4125 2074.8104 2 2074.8127 -0.0023 0 40.7 8.50E-05 K YAALSVDGEDENEGEDYAE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4906.4906.2.dta 3 1 IF4B_HUMAN Eukaryotic translation initiation factor 4B OS=Homo sapiens GN=EIF4B PE=1 SV=2 1560 69167 73 73 13 13 3221 2255 1 1 1 1038.413 2074.8114 2 2074.8127 -0.0013 0 29.79 0.001 K YAALSVDGEDENEGEDYAE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3932.3932.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 284 665 1 1 1 397.2137 792.4129 2 792.413 0 0 30.4 0.0098 K LYNEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2000.2000.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 286 819 1 1 1 397.2139 792.4133 2 792.413 0.0003 0 34.16 0.0029 K LYNEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2215.2215.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 287 737 1 1 1 397.2139 792.4133 2 792.413 0.0003 0 32.48 0.0043 K LYNEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2103.2103.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 288 596 1 1 1 397.2139 792.4133 2 792.413 0.0003 0 27.33 0.014 K LYNEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1898.1898.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 290 878 1 1 1 397.214 792.4134 2 792.413 0.0004 0 24.11 0.029 K LYNEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2306.2306.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 291 1244 1 1 1 397.214 792.4134 2 792.413 0.0004 0 23.55 0.034 K LYNEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2778.2778.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 292 1366 1 1 1 397.214 792.4135 2 792.413 0.0006 0 24.88 0.025 K LYNEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2922.2922.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 293 534 1 1 1 397.214 792.4135 2 792.413 0.0006 0 21.27 0.043 K LYNEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1803.1803.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 294 1141 1 1 1 397.2141 792.4137 2 792.413 0.0008 0 26.82 0.016 K LYNEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2650.2650.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 487 2968 1 1 1 430.7454 859.4762 2 859.4763 -0.0001 0 40.1 0.0011 R SDLLLSGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4742.4742.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 488 3095 1 1 1 430.7455 859.4765 2 859.4763 0.0002 0 45.31 0.00034 R SDLLLSGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4879.4879.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 618 2464 1 1 1 463.7742 925.5339 2 925.5345 -0.0006 0 51.7 2.30E-05 R GPLVNASLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4183.4183.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 619 2937 1 1 1 463.7744 925.5342 2 925.5345 -0.0003 0 53.92 1.40E-05 R GPLVNASLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4708.4708.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 620 2581 1 1 1 463.7744 925.5343 2 925.5345 -0.0002 0 54.17 1.30E-05 R GPLVNASLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4314.4314.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 621 3074 1 1 1 463.7745 925.5344 2 925.5345 -0.0001 0 38.3 0.0005 R GPLVNASLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4856.4856.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 622 2815 1 1 1 463.7745 925.5345 2 925.5345 0 0 54.15 1.30E-05 R GPLVNASLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4574.4574.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 623 2710 1 1 1 463.7746 925.5346 2 925.5345 0.0001 0 49.67 3.70E-05 R GPLVNASLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4450.4450.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 676 1031 1 1 1 481.2532 960.4919 2 960.4916 0.0002 0 24.81 0.034 R EFIQEPAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2510.2510.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 677 943 1 1 1 481.2533 960.492 2 960.4916 0.0004 0 25.02 0.032 R EFIQEPAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2395.2395.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 678 3655 1 1 1 481.2533 960.4921 2 960.4916 0.0005 0 27.15 0.02 R EFIQEPAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5721.5721.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 680 3664 1 1 1 481.7393 961.464 2 961.4651 -0.0011 0 23.76 0.037 R EGQTICVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5732.5732.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 681 668 1 1 1 481.7393 961.4641 2 961.4651 -0.001 0 28.06 0.014 R EGQTICVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2003.2003.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 683 506 1 1 1 481.7394 961.4643 2 961.4651 -0.0008 0 25.83 0.022 R EGQTICVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1757.1757.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 686 739 1 1 1 481.74 961.4654 2 961.4651 0.0002 0 29.27 0.0067 R EGQTICVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2105.2105.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 864 3228 1 1 1 523.2852 1044.5559 2 1044.5604 -0.0045 0 30.84 0.0069 R DWNTLIVGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5058.5058.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 999 3446 1 1 1 554.8207 1107.6268 2 1107.6288 -0.002 0 37.56 0.00075 R VPLVAPEDLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5392.5392.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 1000 3488 1 1 1 554.8212 1107.6279 2 1107.6288 -0.0009 0 25.84 0.011 R VPLVAPEDLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5468.5468.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 1001 3316 1 1 1 554.8215 1107.6285 2 1107.6288 -0.0003 0 39.89 0.00044 R VPLVAPEDLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5158.5158.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 1002 3355 1 1 1 554.8215 1107.6285 2 1107.6288 -0.0003 0 39.68 0.00046 R VPLVAPEDLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5229.5229.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 1003 3389 1 1 1 554.8217 1107.6288 2 1107.6288 0 0 39.9 0.00037 R VPLVAPEDLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5298.5298.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 1466 962 1 1 1 646.3187 1290.6229 2 1290.6244 -0.0015 0 41.08 0.00063 K YSQYQQAIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2421.2421.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 1467 1110 1 1 1 646.3188 1290.623 2 1290.6244 -0.0014 0 33.64 0.0007 K YSQYQQAIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2611.2611.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 1468 884 1 1 1 646.3191 1290.6236 2 1290.6244 -0.0008 0 44.19 7.20E-05 K YSQYQQAIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2313.2313.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 2170 1546 1 1 1 798.8712 1595.7279 2 1595.729 -0.0011 0 38.96 0.00058 R DPEAQFEMPYVVR L Oxidation (M) 0.0000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3126.3126.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 2582 3682 1 1 1 893.4542 1784.8939 2 1784.8978 -0.0039 0 30.22 0.0015 R DLNCVPEIADTLGAVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5756.5756.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 2583 3010 1 1 1 595.9725 1784.8956 3 1784.8978 -0.0022 0 21.29 0.01 R DLNCVPEIADTLGAVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4787.4787.3.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 2584 3218 1 1 1 893.4553 1784.8961 2 1784.8978 -0.0017 0 67.91 7.90E-07 R DLNCVPEIADTLGAVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5048.5048.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 2585 3122 1 1 1 595.9728 1784.8967 3 1784.8978 -0.0012 0 55.93 5.70E-06 R DLNCVPEIADTLGAVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4911.4911.3.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 2586 2986 1 1 1 893.4557 1784.8968 2 1784.8978 -0.001 0 45.08 9.30E-05 R DLNCVPEIADTLGAVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4762.4762.2.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 2587 3217 1 1 1 595.9729 1784.8969 3 1784.8978 -0.001 0 78.13 4.70E-08 R DLNCVPEIADTLGAVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5047.5047.3.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 3325 3008 1 1 1 724.0203 2169.0391 3 2169.0477 -0.0086 0 34.45 0.00059 K DDGVSIPGEYTSFLAPISSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4785.4785.3.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 3326 3211 1 1 1 724.0223 2169.045 3 2169.0477 -0.0027 0 35.4 0.00072 K DDGVSIPGEYTSFLAPISSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5040.5040.3.dta 4 1 ANM5_HUMAN Protein arginine N-methyltransferase 5 OS=Homo sapiens GN=PRMT5 PE=1 SV=4 808 73322 43 43 11 11 3327 3111 1 1 1 1085.5298 2169.045 2 2169.0477 -0.0027 0 64.44 9.10E-07 K DDGVSIPGEYTSFLAPISSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4897.4897.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1276 1206 1 1 0 614.8162 1227.6178 2 1227.6207 -0.003 0 26.03 0.019 R VEIIANDQGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2730.2730.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1277 965 1 1 0 614.8163 1227.6181 2 1227.6207 -0.0026 0 23.76 0.012 R VEIIANDQGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2424.2424.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1278 1070 1 1 0 614.8165 1227.6185 2 1227.6207 -0.0022 0 28.11 0.008 R VEIIANDQGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2560.2560.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1279 875 1 1 0 614.8171 1227.6197 2 1227.6207 -0.001 0 35.65 0.0022 R VEIIANDQGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2301.2301.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1280 809 1 1 0 614.8173 1227.62 2 1227.6207 -0.0008 0 24.31 0.0094 R VEIIANDQGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2203.2203.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1281 1059 1 1 0 614.8174 1227.6202 2 1227.6207 -0.0005 0 34.91 0.0029 R VEIIANDQGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2545.2545.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1320 1182 1 1 1 617.3154 1232.6162 2 1232.6183 -0.0021 0 27.71 0.016 K DAGTIAGLNVMR I Oxidation (M) 0.000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2701.2701.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1321 1217 1 1 1 617.3157 1232.6168 2 1232.6183 -0.0015 0 26.46 0.021 K DAGTIAGLNVMR I Oxidation (M) 0.000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2744.2744.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1538 3029 1 1 1 658.8223 1315.6301 2 1315.6295 0.0006 0 33.79 0.0027 R NELESYAYSLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4808.4808.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1704 3090 1 1 1 699.3953 1396.776 2 1396.7813 -0.0053 0 29.3 0.0039 K ELEEIVQPIISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4873.4873.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1705 2956 1 1 1 699.3973 1396.78 2 1396.7813 -0.0013 0 35.1 0.0013 K ELEEIVQPIISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4729.4729.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1888 2837 1 1 1 730.8809 1459.7472 2 1459.7518 -0.0047 0 58.67 8.80E-06 K SDIDEIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4596.4596.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 1889 2953 1 1 1 730.8829 1459.7512 2 1459.7518 -0.0007 0 57.63 3.90E-06 K SDIDEIVLVGGSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4726.4726.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2102 2622 1 1 1 783.8907 1565.7669 2 1565.7726 -0.0056 0 40.38 0.00016 R ITPSYVAFTPEGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4358.4358.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2103 2970 1 1 1 783.8918 1565.7691 2 1565.7726 -0.0034 0 53.04 1.60E-05 R ITPSYVAFTPEGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4744.4744.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2104 2742 1 1 1 783.892 1565.7694 2 1565.7726 -0.0032 0 41.38 0.00014 R ITPSYVAFTPEGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4486.4486.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2105 2850 1 1 1 783.8926 1565.7707 2 1565.7726 -0.0018 0 38.79 0.00026 R ITPSYVAFTPEGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4612.4612.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2106 3041 1 1 1 783.8948 1565.7751 2 1565.7726 0.0026 0 25.87 0.0037 R ITPSYVAFTPEGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4821.4821.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2324 1481 1 1 1 839.4065 1676.7984 2 1676.8006 -0.0021 0 58.24 1.00E-05 K NQLTSNPENTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3053.3053.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2325 1432 1 1 1 839.407 1676.7995 2 1676.8006 -0.001 0 67.61 1.20E-06 K NQLTSNPENTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2997.2997.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2326 1636 1 1 1 839.4075 1676.8004 2 1676.8006 -0.0002 0 67.66 1.20E-06 K NQLTSNPENTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3225.3225.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2717 1862 1 1 1 918.9688 1835.9231 2 1835.9265 -0.0034 0 68.8 8.30E-07 K SQIFSTASDNQPTVTIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3477.3477.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2718 1612 1 1 1 918.9697 1835.9249 2 1835.9265 -0.0016 0 88.88 8.10E-09 K SQIFSTASDNQPTVTIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3198.3198.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 2719 1732 1 1 1 918.9697 1835.9249 2 1835.9265 -0.0016 0 80.55 5.50E-08 K SQIFSTASDNQPTVTIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3332.3332.2.dta 5 1 GRP78_HUMAN 78 kDa glucose-regulated protein OS=Homo sapiens GN=HSPA5 PE=1 SV=2 700 72402 25 25 9 9 3357 1392 1 1 1 1088.5002 2174.9859 2 2174.9855 0.0004 1 85.47 1.10E-08 K LYGSAGPPPTGEEDTAEKDEL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2951.2951.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 1214 2981 1 0 1 600.3401 1198.6657 2 1198.667 -0.0012 0 73.77 2.70E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4757.4757.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 1215 2857 1 0 1 600.3403 1198.666 2 1198.667 -0.001 0 73.48 2.90E-07 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4620.4620.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 1276 1206 1 0 0 614.8162 1227.6178 2 1227.6207 -0.003 0 26.03 0.019 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2730.2730.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 1277 965 1 0 0 614.8163 1227.6181 2 1227.6207 -0.0026 0 23.76 0.012 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2424.2424.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 1278 1070 1 0 0 614.8165 1227.6185 2 1227.6207 -0.0022 0 28.11 0.008 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2560.2560.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 1279 875 1 0 0 614.8171 1227.6197 2 1227.6207 -0.001 0 35.65 0.0022 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2301.2301.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 1280 809 1 0 0 614.8173 1227.62 2 1227.6207 -0.0008 0 24.31 0.0094 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2203.2203.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 1281 1059 1 0 0 614.8174 1227.6202 2 1227.6207 -0.0005 0 34.91 0.0029 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2545.2545.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 2242 2847 1 0 1 816.8934 1631.7723 2 1631.7753 -0.003 0 66.92 1.10E-06 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4608.4608.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 2243 2780 1 0 1 816.8942 1631.7738 2 1631.7753 -0.0015 0 43.59 8.90E-05 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4534.4534.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 2244 2670 1 0 1 816.8943 1631.7741 2 1631.7753 -0.0011 0 32.01 0.001 K SFYPEEVSSMVLTK M Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4409.4409.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 2307 1183 1 0 1 833.3987 1664.7829 2 1664.7828 0.0001 0 84.29 2.20E-08 K NQVAMNPTNTVFDAK R Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2702.2702.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 2308 1081 1 0 1 833.3989 1664.7833 2 1664.7828 0.0005 0 58.67 7.90E-06 K NQVAMNPTNTVFDAK R Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2575.2575.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 3081 2450 1 0 1 661.3359 1980.986 3 1980.9905 -0.0045 0 17.72 0.022 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4166.4166.3.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 3082 2565 1 0 1 661.3364 1980.9873 3 1980.9905 -0.0033 0 35.21 0.00061 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4297.4297.3.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 3083 2547 1 0 1 991.5013 1980.988 2 1980.9905 -0.0025 0 42.59 0.0001 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4277.4277.2.dta 5 2 HSP7C_HUMAN Heat shock cognate 71 kDa protein OS=Homo sapiens GN=HSPA8 PE=1 SV=1 430 71082 17 17 5 5 3084 2435 1 0 1 991.5014 1980.9883 2 1980.9905 -0.0023 0 21.54 0.0095 K TVTNAVVTVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4150.4150.2.dta 5 3 HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 113 70294 8 8 3 3 1228 795 1 0 1 602.7703 1203.5261 2 1203.5255 0.0006 0 22.73 0.015 K GGSGSGPTIEEVD - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2183.2183.2.dta 5 3 HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 113 70294 8 8 3 3 1276 1206 1 0 0 614.8162 1227.6178 2 1227.6207 -0.003 0 26.03 0.019 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2730.2730.2.dta 5 3 HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 113 70294 8 8 3 3 1277 965 1 0 0 614.8163 1227.6181 2 1227.6207 -0.0026 0 23.76 0.012 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2424.2424.2.dta 5 3 HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 113 70294 8 8 3 3 1278 1070 1 0 0 614.8165 1227.6185 2 1227.6207 -0.0022 0 28.11 0.008 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2560.2560.2.dta 5 3 HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 113 70294 8 8 3 3 1279 875 1 0 0 614.8171 1227.6197 2 1227.6207 -0.001 0 35.65 0.0022 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2301.2301.2.dta 5 3 HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 113 70294 8 8 3 3 1280 809 1 0 0 614.8173 1227.62 2 1227.6207 -0.0008 0 24.31 0.0094 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2203.2203.2.dta 5 3 HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 113 70294 8 8 3 3 1281 1059 1 0 0 614.8174 1227.6202 2 1227.6207 -0.0005 0 34.91 0.0029 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2545.2545.2.dta 5 3 HS71A_HUMAN Heat shock 70 kDa protein 1A OS=Homo sapiens GN=HSPA1A PE=1 SV=1 113 70294 8 8 3 3 2299 1770 1 0 1 829.9279 1657.8413 2 1657.8424 -0.0011 0 51.03 2.10E-05 K NQVALNPQNTVFDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3374.3374.2.dta 5 HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 74 70730 6 6 1 1 1276 1206 1 0 0 614.8162 1227.6178 2 1227.6207 -0.003 0 26.03 0.019 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2730.2730.2.dta 5 HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 74 70730 6 6 1 1 1277 965 1 0 0 614.8163 1227.6181 2 1227.6207 -0.0026 0 23.76 0.012 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2424.2424.2.dta 5 HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 74 70730 6 6 1 1 1278 1070 1 0 0 614.8165 1227.6185 2 1227.6207 -0.0022 0 28.11 0.008 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2560.2560.2.dta 5 HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 74 70730 6 6 1 1 1279 875 1 0 0 614.8171 1227.6197 2 1227.6207 -0.001 0 35.65 0.0022 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2301.2301.2.dta 5 HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 74 70730 6 6 1 1 1280 809 1 0 0 614.8173 1227.62 2 1227.6207 -0.0008 0 24.31 0.0094 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2203.2203.2.dta 5 HS71L_HUMAN Heat shock 70 kDa protein 1-like OS=Homo sapiens GN=HSPA1L PE=1 SV=2 74 70730 6 6 1 1 1281 1059 1 0 0 614.8174 1227.6202 2 1227.6207 -0.0005 0 34.91 0.0029 K VEIIANDQGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2545.2545.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 1044 888 1 1 1 559.301 1116.5874 2 1116.5887 -0.0014 0 57.75 1.70E-05 K GAAGAVTQSLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2317.2317.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 1439 2740 1 1 1 641.8589 1281.7032 2 1281.7041 -0.0008 0 67.21 7.20E-07 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4484.4484.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 1440 2831 1 1 1 641.8589 1281.7033 2 1281.7041 -0.0007 0 53.76 1.60E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4590.4590.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 1441 2616 1 1 1 641.8592 1281.7038 2 1281.7041 -0.0002 0 48.79 5.00E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4351.4351.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 1448 661 1 1 1 643.8556 1285.6966 2 1285.699 -0.0023 0 59.45 9.10E-06 K ALSAVSAQAAAAQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1994.1994.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 1449 957 1 1 1 643.856 1285.6975 2 1285.699 -0.0015 0 56.23 2.00E-05 K ALSAVSAQAAAAQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2414.2414.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 1450 871 1 1 1 643.8566 1285.6986 2 1285.699 -0.0004 0 69.23 9.60E-07 K ALSAVSAQAAAAQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2296.2296.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 1451 793 1 1 1 643.8567 1285.6989 2 1285.699 0 0 86.8 1.70E-08 K ALSAVSAQAAAAQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2181.2181.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 2732 744 1 1 1 921.9855 1841.9564 2 1841.9595 -0.0032 0 66.41 1.40E-06 K QVSQAQTTVQPSATLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2111.2111.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 2733 696 1 1 1 921.988 1841.9615 2 1841.9595 0.002 0 84.1 2.10E-08 K QVSQAQTTVQPSATLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2041.2041.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 2734 832 1 1 1 921.9954 1841.9762 2 1841.9595 0.0166 0 43.45 0.00021 K QVSQAQTTVQPSATLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2236.2236.2.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 3521 2858 1 1 1 855.4817 2563.4232 3 2563.4222 0.0011 0 42.55 7.50E-05 K TAATVTSALQPPVLSLTQPTQVGVGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4621.4621.3.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 3720 2050 1 1 1 1021.5442 3061.6107 3 3061.6157 -0.0049 0 43.74 9.30E-05 R SPGVQPQLVLGGAAQTASLGTATAVQTGTPQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3694.3694.3.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 3721 2182 1 1 1 766.4108 3061.614 4 3061.6157 -0.0017 0 17.88 0.035 R SPGVQPQLVLGGAAQTASLGTATAVQTGTPQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3849.3849.4.dta 6 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 586 110332 15 15 6 6 3722 2155 1 1 1 1021.5458 3061.6155 3 3061.6157 -0.0002 0 55.58 5.80E-06 R SPGVQPQLVLGGAAQTASLGTATAVQTGTPQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3819.3819.3.dta 6 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 134 91832 3 3 1 1 1439 2740 1 0 1 641.8589 1281.7032 2 1281.7041 -0.0008 0 67.21 7.20E-07 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4484.4484.2.dta 6 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 134 91832 3 3 1 1 1440 2831 1 0 1 641.8589 1281.7033 2 1281.7041 -0.0007 0 53.76 1.60E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4590.4590.2.dta 6 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 134 91832 3 3 1 1 1441 2616 1 0 1 641.8592 1281.7038 2 1281.7041 -0.0002 0 48.79 5.00E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4351.4351.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 401 1279 1 1 1 416.7485 831.4825 2 831.4814 0.0011 0 30.75 0.0068 K SISISVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2819.2819.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 402 1515 1 1 1 416.7486 831.4826 2 831.4814 0.0012 0 30.84 0.0067 K SISISVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3091.3091.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 403 1395 1 1 1 416.7486 831.4827 2 831.4814 0.0013 0 29.19 0.0098 K SISISVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2955.2955.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 832 1149 1 1 1 517.2621 1032.5097 2 1032.5087 0.001 0 25.29 0.032 R TLLEGEESR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2661.2661.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 972 71 1 1 1 546.7547 1091.4948 2 1091.4956 -0.0007 0 91.24 3.70E-09 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1164.1164.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 973 285 1 1 1 546.7547 1091.4948 2 1091.4956 -0.0007 0 67.86 8.10E-07 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1417.1417.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 974 183 1 1 1 546.7548 1091.4951 2 1091.4956 -0.0005 0 72.05 3.10E-07 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1291.1291.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 975 3679 1 1 1 546.7551 1091.4956 2 1091.4956 0 0 41.25 0.00035 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5750.5750.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 976 349 1 1 1 546.7551 1091.4957 2 1091.4956 0.0001 0 63.86 1.90E-06 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1519.1519.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 1407 1726 1 1 1 633.3213 1264.6281 2 1264.6299 -0.0018 0 32.44 0.0045 R TNAENEFVTIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3325.3325.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 1408 1601 1 1 1 633.3218 1264.629 2 1264.6299 -0.0009 0 23.76 0.034 R TNAENEFVTIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3186.3186.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 1409 1855 1 1 1 633.3219 1264.6292 2 1264.6299 -0.0007 0 33.77 0.00072 R TNAENEFVTIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3469.3469.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 1921 1268 1 1 0 738.3954 1474.7762 2 1474.778 -0.0018 0 63.02 4.30E-06 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2806.2806.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 1922 1379 1 1 0 738.3957 1474.7768 2 1474.778 -0.0012 0 57.76 1.50E-05 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2937.2937.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 1923 1509 1 1 0 738.3978 1474.7811 2 1474.778 0.0031 0 60.73 6.50E-06 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3084.3084.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 2400 1733 1 1 1 858.9288 1715.8431 2 1715.8438 -0.0007 0 59.03 2.90E-06 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3333.3333.2.dta 7 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 542 66170 17 17 6 6 2401 1609 1 1 1 858.9299 1715.8453 2 1715.8438 0.0015 0 80.69 2.70E-08 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3195.3195.2.dta 7 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 265 65678 7 7 3 3 1390 776 1 0 1 627.8068 1253.599 2 1253.6001 -0.0011 0 49.33 8.10E-05 R GFSSGSAVVSGGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2158.2158.2.dta 7 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 265 65678 7 7 3 3 1391 855 1 0 1 627.8076 1253.6007 2 1253.6001 0.0006 0 47.96 0.00011 R GFSSGSAVVSGGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2271.2271.2.dta 7 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 265 65678 7 7 3 3 1921 1268 1 0 0 738.3954 1474.7762 2 1474.778 -0.0018 0 63.02 4.30E-06 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2806.2806.2.dta 7 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 265 65678 7 7 3 3 1922 1379 1 0 0 738.3957 1474.7768 2 1474.778 -0.0012 0 57.76 1.50E-05 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2937.2937.2.dta 7 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 265 65678 7 7 3 3 1923 1509 1 0 0 738.3978 1474.7811 2 1474.778 0.0031 0 60.73 6.50E-06 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3084.3084.2.dta 7 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 265 65678 7 7 3 3 2471 326 1 0 1 870.8549 1739.6952 2 1739.6983 -0.0032 0 64.88 3.30E-07 R GSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1479.1479.2.dta 7 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 265 65678 7 7 3 3 2472 413 1 0 1 870.8566 1739.6987 2 1739.6983 0.0004 0 35.62 0.00027 R GSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1617.1617.2.dta 7 K2C1B_HUMAN "Keratin, type II cytoskeletal 1b OS=Homo sapiens GN=KRT77 PE=2 SV=3" 138 62149 3 3 1 1 1921 1268 1 0 0 738.3954 1474.7762 2 1474.778 -0.0018 0 63.02 4.30E-06 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2806.2806.2.dta 7 K2C1B_HUMAN "Keratin, type II cytoskeletal 1b OS=Homo sapiens GN=KRT77 PE=2 SV=3" 138 62149 3 3 1 1 1922 1379 1 0 0 738.3957 1474.7768 2 1474.778 -0.0012 0 57.76 1.50E-05 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2937.2937.2.dta 7 K2C1B_HUMAN "Keratin, type II cytoskeletal 1b OS=Homo sapiens GN=KRT77 PE=2 SV=3" 138 62149 3 3 1 1 1923 1509 1 0 0 738.3978 1474.7811 2 1474.778 0.0031 0 60.73 6.50E-06 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3084.3084.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 463 2423 1 1 1 427.7488 853.4831 2 853.477 0.0062 1 22.23 0.028 R EALTHRK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4137.4137.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 728 2305 1 1 1 494.2571 986.4996 2 986.5033 -0.0037 0 21.39 0.019 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3991.3991.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 729 1308 1 1 1 494.2575 986.5005 2 986.5033 -0.0027 0 31.48 0.0054 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2852.2852.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 730 1739 1 1 1 494.258 986.5014 2 986.5033 -0.0018 0 29.87 0.0016 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3339.3339.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 731 1478 1 1 1 494.2581 986.5017 2 986.5033 -0.0016 0 43.89 0.00032 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3049.3049.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 732 858 1 1 1 494.2586 986.5026 2 986.5033 -0.0007 0 58.42 1.10E-05 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2276.2276.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 734 2174 1 1 1 494.2588 986.5031 2 986.5033 -0.0002 0 18.18 0.028 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3840.3840.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 735 791 1 1 1 494.259 986.5034 2 986.5033 0.0001 0 58.47 9.20E-06 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2179.2179.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 736 712 1 1 1 494.2591 986.5036 2 986.5033 0.0004 0 71.91 4.20E-07 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2065.2065.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 737 1089 1 1 1 494.2591 986.5037 2 986.5033 0.0004 0 57.28 1.20E-05 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2584.2584.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 738 1999 1 1 1 494.2592 986.5038 2 986.5033 0.0005 0 28.15 0.0023 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3635.3635.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 930 681 1 1 1 538.2614 1074.5083 2 1074.5094 -0.0011 0 17.29 0.026 K DNYPQSVPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2019.2019.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 931 605 1 1 1 538.2615 1074.5085 2 1074.5094 -0.0009 0 21.42 0.011 K DNYPQSVPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1910.1910.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 932 544 1 1 1 538.2618 1074.509 2 1074.5094 -0.0004 0 25.76 0.0068 K DNYPQSVPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1817.1817.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 1046 1978 1 1 1 559.7907 1117.5669 2 1117.5689 -0.002 0 32.13 0.0052 K IICDLVEEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3610.3610.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 1047 1738 1 1 1 559.7911 1117.5676 2 1117.5689 -0.0013 0 31.32 0.0063 K IICDLVEEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3338.3338.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 1048 2080 1 1 1 559.7914 1117.5683 2 1117.5689 -0.0006 0 35.8 0.002 K IICDLVEEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3733.3733.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 1049 1856 1 1 1 559.7914 1117.5683 2 1117.5689 -0.0006 0 49.23 0.0001 K IICDLVEEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3471.3471.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 1050 2221 1 1 1 559.7919 1117.5693 2 1117.5689 0.0004 0 29.3 0.0062 K IICDLVEEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3891.3891.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 1244 3076 1 1 1 604.7678 1207.5211 2 1207.522 -0.0009 0 21.73 0.025 K YMDVQFDFK G Oxidation (M) 0.010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4858.4858.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 2382 3026 1 1 1 853.9462 1705.8779 2 1705.8774 0.0005 0 31.04 0.0012 R DGTIDFTPGSELLITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4804.4804.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 2849 2018 1 1 1 951.4924 1900.9703 2 1900.9755 -0.0052 0 100.22 4.00E-10 R VNSININQGSITFAGGPGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3657.3657.2.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 2879 3223 1 1 1 637.7025 1910.0857 3 1910.0877 -0.002 0 53.96 6.60E-06 R VLQALGSEPIQYAVPVVK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5052.5052.3.dta 8 1 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 530 122461 24 24 8 8 2880 3224 1 1 1 956.0506 1910.0866 2 1910.0877 -0.001 0 59.83 1.70E-06 R VLQALGSEPIQYAVPVVK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5053.5053.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 660 565 1 1 1 479.7506 957.4867 2 957.4879 -0.0013 0 21.84 0.033 K VLENAEGAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1847.1847.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 661 414 1 1 1 479.751 957.4875 2 957.4879 -0.0005 0 28.97 0.0076 K VLENAEGAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1619.1619.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 662 491 1 1 1 479.7513 957.488 2 957.4879 0.0001 0 28.51 0.0073 K VLENAEGAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1731.1731.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 1305 715 1 1 1 616.3394 1230.6643 2 1230.6568 0.0075 0 27.66 0.0067 R QAASSLQQASLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2070.2070.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 1344 2611 1 1 1 621.8432 1241.6718 2 1241.6728 -0.0009 0 40.85 0.00063 K DAGQISGLNVLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4347.4347.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 1345 2489 1 1 1 621.8433 1241.672 2 1241.6728 -0.0008 0 62.51 5.00E-06 K DAGQISGLNVLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4212.4212.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 1346 2378 1 1 1 621.8436 1241.6727 2 1241.6728 -0.0001 0 40.47 0.00081 K DAGQISGLNVLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4085.4085.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 1465 2976 1 1 1 645.8432 1289.6718 2 1289.6728 -0.001 0 45.99 0.00024 K VQQTVQDLFGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4751.4751.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 1852 1923 1 1 1 725.8618 1449.7091 2 1449.71 -0.0009 0 62.78 1.30E-06 R TTPSVVAFTADGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3546.3546.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 1853 2035 1 1 1 725.8621 1449.7097 2 1449.71 -0.0003 0 48.94 2.60E-05 R TTPSVVAFTADGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3678.3678.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 1854 1803 1 1 1 725.8638 1449.713 2 1449.71 0.003 0 37.8 0.00079 R TTPSVVAFTADGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3412.3412.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 1896 2982 1 1 1 731.8832 1461.7518 2 1461.7497 0.0021 0 30.7 0.0076 K SDIGEVILVGGMTR M Oxidation (M) 0.00000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4758.4758.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 2113 851 1 1 1 784.8881 1567.7617 2 1567.7631 -0.0014 0 37.01 0.00034 R QAVTNPNNTFYATK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2265.2265.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 2114 923 1 1 1 784.8887 1567.7628 2 1567.7631 -0.0003 0 60.29 3.80E-06 R QAVTNPNNTFYATK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2368.2368.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 2367 2838 1 1 1 847.928 1693.8414 2 1693.8424 -0.001 0 43.14 9.00E-05 K NAVITVPAYFNDSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4598.4598.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 2662 1327 1 1 1 904.9536 1807.8927 2 1807.8952 -0.0025 0 66.49 5.80E-07 K SQVFSTAADGQTQVEIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2874.2874.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 2663 1214 1 1 1 904.9539 1807.8933 2 1807.8952 -0.0019 0 80.38 5.80E-08 K SQVFSTAADGQTQVEIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2740.2740.2.dta 9 1 GRP75_HUMAN "Stress-70 protein, mitochondrial OS=Homo sapiens GN=HSPA9 PE=1 SV=2" 519 73920 18 18 9 9 2664 1382 1 1 1 904.954 1807.8935 2 1807.8952 -0.0017 0 77.53 5.40E-08 K SQVFSTAADGQTQVEIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2940.2940.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 716 235 1 1 1 491.72 981.4255 2 981.4265 -0.0009 0 32.55 0.0018 R FSSSGGGGGGGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1354.1354.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 717 107 1 1 1 491.7202 981.4258 2 981.4265 -0.0007 0 37.52 0.00058 R FSSSGGGGGGGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1204.1204.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 718 18 1 1 1 491.7202 981.4258 2 981.4265 -0.0006 0 53.36 1.50E-05 R FSSSGGGGGGGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1074.1074.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 908 3054 1 1 1 530.7852 1059.5558 2 1059.556 -0.0003 0 24.47 0.034 K TLLDIDNTR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4835.4835.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 1308 986 1 1 1 616.8011 1231.5877 2 1231.5906 -0.0028 0 50.02 2.00E-05 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2453.2453.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 1309 3680 1 1 1 616.8012 1231.5879 2 1231.5906 -0.0027 0 49.13 8.90E-05 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5752.5752.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 1310 828 1 1 1 616.8013 1231.5881 2 1231.5906 -0.0025 0 45.32 0.0002 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2227.2227.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 1311 1090 1 1 1 616.8013 1231.5881 2 1231.5906 -0.0025 0 38.98 0.00092 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2585.2585.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 1312 675 1 1 1 616.8016 1231.5886 2 1231.5906 -0.002 0 68.29 1.10E-06 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2012.2012.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 1313 602 1 1 1 616.8018 1231.5891 2 1231.5906 -0.0015 0 74.71 2.40E-07 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1906.1906.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 1314 900 1 1 1 616.8018 1231.5891 2 1231.5906 -0.0015 0 55.46 1.20E-05 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2335.2335.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 2611 392 1 1 1 896.3665 1790.7185 2 1790.7205 -0.002 0 94.16 3.80E-10 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1582.1582.2.dta 10 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 480 62255 13 13 4 4 2612 310 1 1 1 896.3671 1790.7197 2 1790.7205 -0.0008 0 79.44 1.10E-08 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1456.1456.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1151 1945 1 1 1 586.8073 1171.6001 2 1171.6019 -0.0019 0 27.58 0.014 R GVEICIATPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3571.3571.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1152 1765 1 1 1 586.8079 1171.6013 2 1171.6019 -0.0006 0 26.35 0.018 R GVEICIATPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3368.3368.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1274 2975 1 1 1 613.8582 1225.7018 2 1225.703 -0.0013 0 37.79 0.00042 K APILIATDVASR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4749.4749.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1275 3096 1 1 1 613.8583 1225.702 2 1225.703 -0.001 0 50.78 2.80E-05 K APILIATDVASR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4880.4880.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1556 845 1 1 1 663.3575 1324.7005 2 1324.6986 0.0019 0 50.52 5.00E-05 K VLEEANQAINPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2256.2256.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1606 2979 1 1 1 677.8183 1353.622 2 1353.6235 -0.0014 0 41.32 0.00045 R CTYLVLDEADR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4754.4754.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1631 2422 1 1 0 684.8171 1367.6196 2 1367.6214 -0.0017 0 23.74 0.0059 R MLDMGFEPQIR K 2 Oxidation (M) 0.10010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4135.4135.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1632 2085 1 1 0 684.8189 1367.6233 2 1367.6214 0.0019 0 21.92 0.0088 R MLDMGFEPQIR K 2 Oxidation (M) 0.10010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3738.3738.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1864 980 1 1 1 728.3432 1454.6718 2 1454.675 -0.0031 0 38.5 0.00066 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2445.2445.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1865 936 1 1 1 728.3438 1454.6731 2 1454.675 -0.0019 0 53.93 1.90E-05 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2385.2385.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1866 862 1 1 1 728.3441 1454.6737 2 1454.675 -0.0013 0 55.39 1.40E-05 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2284.2284.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1867 720 1 1 1 728.3444 1454.6742 2 1454.675 -0.0008 0 53.72 2.00E-05 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2077.2077.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 1869 1114 1 1 1 728.345 1454.6754 2 1454.675 0.0004 0 38.18 0.00026 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2615.2615.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 2360 2340 1 1 1 846.4122 1690.8099 2 1690.8162 -0.0063 0 36.56 0.00037 R ELAQQVQQVADDYGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4035.4035.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 2361 2122 1 1 1 846.4145 1690.8145 2 1690.8162 -0.0017 0 51.37 1.50E-05 R ELAQQVQQVADDYGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3780.3780.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 2362 1892 1 1 1 846.4147 1690.8149 2 1690.8162 -0.0013 0 62.74 1.30E-06 R ELAQQVQQVADDYGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3511.3511.2.dta 11 1 DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 452 80906 17 17 7 7 2363 2005 1 1 1 846.4151 1690.8156 2 1690.8162 -0.0006 0 63.49 1.10E-06 R ELAQQVQQVADDYGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3643.3643.2.dta 11 2 DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 98 73597 5 5 4 4 297 1445 1 0 1 399.6989 797.3833 2 797.382 0.0013 0 18.19 0.046 R FSGGFGAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3012.3012.2.dta 11 2 DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 98 73597 5 5 4 4 1125 510 1 0 1 582.2981 1162.5816 2 1162.583 -0.0013 0 28.54 0.012 R VGSTSENITQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1766.1766.2.dta 11 2 DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 98 73597 5 5 4 4 1619 396 1 0 1 681.2997 1360.5849 2 1360.5855 -0.0006 0 72.48 1.20E-07 R QSSGASSSSFSSSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1588.1588.2.dta 11 2 DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 98 73597 5 5 4 4 1631 2422 1 0 0 684.8171 1367.6196 2 1367.6214 -0.0017 0 23.74 0.0059 R MLDMGFEPQIR R 2 Oxidation (M) 0.10010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4135.4135.2.dta 11 2 DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 98 73597 5 5 4 4 1632 2085 1 0 0 684.8189 1367.6233 2 1367.6214 0.0019 0 21.92 0.0088 R MLDMGFEPQIR R 2 Oxidation (M) 0.10010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3738.3738.2.dta 11 DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 101 69618 6 6 3 3 1151 1945 1 0 1 586.8073 1171.6001 2 1171.6019 -0.0019 0 27.58 0.014 R GVEICIATPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3571.3571.2.dta 11 DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 101 69618 6 6 3 3 1152 1765 1 0 1 586.8079 1171.6013 2 1171.6019 -0.0006 0 26.35 0.018 R GVEICIATPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3368.3368.2.dta 11 DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 101 69618 6 6 3 3 1274 2975 1 0 1 613.8582 1225.7018 2 1225.703 -0.0013 0 37.79 0.00042 K APILIATDVASR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4749.4749.2.dta 11 DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 101 69618 6 6 3 3 1275 3096 1 0 1 613.8583 1225.702 2 1225.703 -0.001 0 50.78 2.80E-05 K APILIATDVASR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4880.4880.2.dta 11 DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 101 69618 6 6 3 3 1631 2422 1 0 0 684.8171 1367.6196 2 1367.6214 -0.0017 0 23.74 0.0059 R MLDMGFEPQIR K 2 Oxidation (M) 0.10010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4135.4135.2.dta 11 DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 101 69618 6 6 3 3 1632 2085 1 0 0 684.8189 1367.6233 2 1367.6214 0.0019 0 21.92 0.0088 R MLDMGFEPQIR K 2 Oxidation (M) 0.10010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3738.3738.2.dta 11 DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 42 73564 4 4 3 3 297 1445 1 0 1 399.6989 797.3833 2 797.382 0.0013 0 18.19 0.046 R FSGGFGAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3012.3012.2.dta 11 DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 42 73564 4 4 3 3 1125 510 1 0 1 582.2981 1162.5816 2 1162.583 -0.0013 0 28.54 0.012 R VGSTSENITQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1766.1766.2.dta 11 DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 42 73564 4 4 3 3 1631 2422 1 0 0 684.8171 1367.6196 2 1367.6214 -0.0017 0 23.74 0.0059 R MLDMGFEPQIR R 2 Oxidation (M) 0.10010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4135.4135.2.dta 11 DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 42 73564 4 4 3 3 1632 2085 1 0 0 684.8189 1367.6233 2 1367.6214 0.0019 0 21.92 0.0088 R MLDMGFEPQIR R 2 Oxidation (M) 0.10010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3738.3738.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 263 357 1 1 1 387.2023 772.3901 2 772.3902 0 0 26.28 0.017 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1532.1532.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 265 451 1 1 1 387.2027 772.3908 2 772.3902 0.0006 0 25.84 0.017 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1670.1670.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 484 2951 1 1 1 429.2633 856.5121 2 856.513 -0.001 0 29.51 0.011 K LNTLLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4724.4724.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 1707 2512 1 1 1 699.8486 1397.6826 2 1397.686 -0.0035 0 22.3 0.019 K YNILGTNTIMDK M Oxidation (M) 0.000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4236.4236.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 1708 2629 1 1 1 699.8499 1397.6853 2 1397.686 -0.0008 0 23.72 0.036 K YNILGTNTIMDK M Oxidation (M) 0.000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4365.4365.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 2269 2534 1 1 1 824.425 1646.8354 2 1646.8376 -0.0022 0 84.32 3.60E-08 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4261.4261.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 2270 2765 1 1 1 824.4254 1646.8362 2 1646.8376 -0.0015 0 111.58 6.70E-11 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4515.4515.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 2271 2651 1 1 1 824.4254 1646.8363 2 1646.8376 -0.0013 0 108.48 1.40E-10 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4388.4388.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 2272 2891 1 1 1 824.4257 1646.8369 2 1646.8376 -0.0007 0 94.22 3.60E-09 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4658.4658.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 2398 3677 1 1 1 857.9586 1713.9026 2 1713.905 -0.0024 0 20.57 0.012 K SSGPTSLFAVTVAPPGAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5748.5748.2.dta 12 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 404 91269 11 11 5 5 2399 3219 1 1 1 857.9592 1713.9039 2 1713.905 -0.0011 0 63.55 3.00E-06 K SSGPTSLFAVTVAPPGAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5049.5049.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 1085 562 1 1 1 574.7933 1147.572 2 1147.5721 -0.0001 0 37.85 0.00094 R ITESEEVVSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1842.1842.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 1617 676 1 1 1 680.3448 1358.6751 2 1358.679 -0.0039 0 61.03 5.70E-06 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2013.2013.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 1618 603 1 1 1 680.3456 1358.6766 2 1358.679 -0.0024 0 44.54 6.90E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1907.1907.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 1731 723 1 1 1 703.8215 1405.6285 2 1405.633 -0.0045 0 21.48 0.025 R TVLCGTCGQPADK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2081.2081.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 2096 1900 1 1 1 783.8713 1565.728 2 1565.7434 -0.0154 0 47.66 8.40E-05 R SVGGSGGGSFGDNLVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3520.3520.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 2097 2016 1 1 1 783.8755 1565.7365 2 1565.7434 -0.0069 0 24.32 0.02 R SVGGSGGGSFGDNLVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3655.3655.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 2098 2134 1 1 1 783.8756 1565.7367 2 1565.7434 -0.0068 0 43.79 0.00011 R SVGGSGGGSFGDNLVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3793.3793.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 2099 1502 1 1 1 783.8772 1565.7398 2 1565.7434 -0.0036 0 95.58 1.50E-09 R SVGGSGGGSFGDNLVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3076.3076.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 2100 1625 1 1 1 783.8774 1565.7403 2 1565.7434 -0.0031 0 98.89 7.00E-10 R SVGGSGGGSFGDNLVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3213.3213.2.dta 13 1 LMNA_HUMAN Prelamin-A/C OS=Homo sapiens GN=LMNA PE=1 SV=1 381 74380 10 10 4 4 2101 1779 1 1 1 783.8788 1565.7431 2 1565.7434 -0.0003 0 74.26 1.10E-07 R SVGGSGGGSFGDNLVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3384.3384.2.dta 14 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 296 13403 7 7 1 1 1490 3656 1 1 1 652.3111 1302.6076 2 1302.6092 -0.0016 0 53.45 3.00E-05 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5723.5723.2.dta 14 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 296 13403 7 7 1 1 1491 1986 1 1 1 652.3113 1302.608 2 1302.6092 -0.0012 0 69.61 7.20E-07 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3619.3619.2.dta 14 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 296 13403 7 7 1 1 1492 1865 1 1 1 652.3116 1302.6087 2 1302.6092 -0.0005 0 75.29 1.90E-07 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3481.3481.2.dta 14 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 296 13403 7 7 1 1 1493 1741 1 1 1 652.3116 1302.6087 2 1302.6092 -0.0005 0 79.25 7.70E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3342.3342.2.dta 14 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 296 13403 7 7 1 1 1494 2211 1 1 1 652.3117 1302.6089 2 1302.6092 -0.0004 0 36.56 0.0014 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3880.3880.2.dta 14 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 296 13403 7 7 1 1 1495 2316 1 1 1 652.3119 1302.6092 2 1302.6092 0 0 39.65 0.00028 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4006.4006.2.dta 14 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 296 13403 7 7 1 1 1496 2093 1 1 1 652.312 1302.6095 2 1302.6092 0.0003 0 64.57 2.30E-06 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3748.3748.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 489 3236 1 1 1 430.7656 859.5167 2 859.5167 0 0 32.94 0.0017 R LFVGSIPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5067.5067.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1469 711 1 1 1 647.2983 1292.582 2 1292.5853 -0.0033 0 18.46 0.049 R LMMDPLSGQNR G 2 Oxidation (M) 0.01100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2063.2063.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1505 1232 1 1 1 656.3299 1310.6452 2 1310.6467 -0.0014 0 47.37 3.60E-05 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2764.2764.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1506 3031 1 1 1 656.3299 1310.6452 2 1310.6467 -0.0014 0 20.23 0.013 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4810.4810.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1507 1040 1 1 1 656.33 1310.6454 2 1310.6467 -0.0013 0 56.84 6.20E-06 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2521.2521.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1508 3658 1 1 1 656.3302 1310.6458 2 1310.6467 -0.0008 0 38.31 0.0006 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5726.5726.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1509 1132 1 1 1 656.3303 1310.646 2 1310.6467 -0.0007 0 54.68 7.50E-06 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2638.2638.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1510 2006 1 1 1 656.3303 1310.6461 2 1310.6467 -0.0006 0 17.68 0.026 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3644.3644.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1511 2213 1 1 1 656.3304 1310.6462 2 1310.6467 -0.0005 0 19.51 0.025 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3882.3882.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1512 954 1 1 1 656.3307 1310.6468 2 1310.6467 0.0002 0 71.42 5.30E-07 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2408.2408.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 1513 2844 1 1 1 656.3331 1310.6517 2 1310.6467 0.005 0 22.54 0.0077 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4604.4604.2.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 3489 2874 1 1 1 836.4188 2506.2346 3 2506.2381 -0.0034 0 45.02 0.00012 K YGGPPPDSVYSGVQPGIGTEVFVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4639.4639.3.dta 15 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 286 71184 13 13 4 4 3490 2866 1 1 1 1254.1267 2506.2389 2 2506.2381 0.0008 0 41.89 0.00025 K YGGPPPDSVYSGVQPGIGTEVFVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4630.4630.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 489 3236 1 0 1 430.7656 859.5167 2 859.5167 0 0 32.94 0.0017 R LFVGSIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5067.5067.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 1505 1232 1 0 1 656.3299 1310.6452 2 1310.6467 -0.0014 0 47.37 3.60E-05 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2764.2764.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 1506 3031 1 0 1 656.3299 1310.6452 2 1310.6467 -0.0014 0 20.23 0.013 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4810.4810.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 1507 1040 1 0 1 656.33 1310.6454 2 1310.6467 -0.0013 0 56.84 6.20E-06 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2521.2521.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 1508 3658 1 0 1 656.3302 1310.6458 2 1310.6467 -0.0008 0 38.31 0.0006 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5726.5726.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 1509 1132 1 0 1 656.3303 1310.646 2 1310.6467 -0.0007 0 54.68 7.50E-06 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2638.2638.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 1510 2006 1 0 1 656.3303 1310.6461 2 1310.6467 -0.0006 0 17.68 0.026 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3644.3644.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 1511 2213 1 0 1 656.3304 1310.6462 2 1310.6467 -0.0005 0 19.51 0.025 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3882.3882.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 1512 954 1 0 1 656.3307 1310.6468 2 1310.6467 0.0002 0 71.42 5.30E-07 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2408.2408.2.dta 15 HNRPQ_HUMAN Heterogeneous nuclear ribonucleoprotein Q OS=Homo sapiens GN=SYNCRIP PE=1 SV=2 234 69788 10 10 2 2 1513 2844 1 0 1 656.3331 1310.6517 2 1310.6467 0.005 0 22.54 0.0077 R TGYTLDVTTGQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4604.4604.2.dta 16 1 PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 264 70854 7 7 3 3 818 913 1 1 1 508.2748 1014.535 2 1014.5346 0.0004 0 37.19 0.0012 K AVNSATGVPTV - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2355.2355.2.dta 16 1 PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 264 70854 7 7 3 3 1437 2852 1 1 0 641.8199 1281.6252 2 1281.6275 -0.0023 0 28.99 0.0019 R ALDTMNFDVIK G Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4614.4614.2.dta 16 1 PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 264 70854 7 7 3 3 1438 2969 1 1 0 641.8204 1281.6263 2 1281.6275 -0.0012 0 55.6 1.80E-05 R ALDTMNFDVIK G Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4743.4743.2.dta 16 1 PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 264 70854 7 7 3 3 2952 2607 1 1 0 964.9592 1927.9039 2 1927.9064 -0.0025 0 60.88 3.40E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4342.4342.2.dta 16 1 PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 264 70854 7 7 3 3 2953 2741 1 1 0 964.9592 1927.9039 2 1927.9064 -0.0025 0 62.07 2.60E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4485.4485.2.dta 16 1 PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 264 70854 7 7 3 3 2954 2851 1 1 0 964.9593 1927.904 2 1927.9064 -0.0024 0 64.55 1.40E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4613.4613.2.dta 16 1 PABP1_HUMAN Polyadenylate-binding protein 1 OS=Homo sapiens GN=PABPC1 PE=1 SV=2 264 70854 7 7 3 3 2955 2641 1 1 0 964.9596 1927.9046 2 1927.9064 -0.0018 0 68.32 6.30E-07 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4378.4378.2.dta 16 2 PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 254 71080 7 7 3 3 210 485 1 0 1 746.4042 745.397 1 745.397 -0.0001 0 20.61 0.012 K VGAVAAATS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1721.1721.1.dta 16 2 PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 254 71080 7 7 3 3 1437 2852 1 0 0 641.8199 1281.6252 2 1281.6275 -0.0023 0 28.99 0.0019 R ALDTMNFDVIK G Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4614.4614.2.dta 16 2 PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 254 71080 7 7 3 3 1438 2969 1 0 0 641.8204 1281.6263 2 1281.6275 -0.0012 0 55.6 1.80E-05 R ALDTMNFDVIK G Oxidation (M) 0.00001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4743.4743.2.dta 16 2 PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 254 71080 7 7 3 3 2952 2607 1 0 0 964.9592 1927.9039 2 1927.9064 -0.0025 0 60.88 3.40E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4342.4342.2.dta 16 2 PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 254 71080 7 7 3 3 2953 2741 1 0 0 964.9592 1927.9039 2 1927.9064 -0.0025 0 62.07 2.60E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4485.4485.2.dta 16 2 PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 254 71080 7 7 3 3 2954 2851 1 0 0 964.9593 1927.904 2 1927.9064 -0.0024 0 64.55 1.40E-06 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4613.4613.2.dta 16 2 PABP4_HUMAN Polyadenylate-binding protein 4 OS=Homo sapiens GN=PABPC4 PE=1 SV=1 254 71080 7 7 3 3 2955 2641 1 0 0 964.9596 1927.9046 2 1927.9064 -0.0018 0 68.32 6.30E-07 R SLGYAYVNFQQPADAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4378.4378.2.dta 16 PABP3_HUMAN Polyadenylate-binding protein 3 OS=Homo sapiens GN=PABPC3 PE=1 SV=2 37 70215 1 1 1 1 818 913 1 0 1 508.2748 1014.535 2 1014.5346 0.0004 0 37.19 0.0012 K AVNSATGVPTV - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2355.2355.2.dta 17 1 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 154 116336 3 3 3 3 2137 2563 1 1 1 787.9351 1573.8557 2 1573.8563 -0.0006 0 49.28 5.50E-05 R VDQSILTGESVSVIK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4294.4294.2.dta 17 1 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 154 116336 3 3 3 3 2212 2961 1 1 1 810.9096 1619.8047 2 1619.8076 -0.003 0 94.59 2.60E-09 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4735.4735.2.dta 17 1 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 154 116336 3 3 3 3 3015 2403 1 1 1 976.9686 1951.9226 2 1951.9231 -0.0005 0 46.57 4.30E-05 R SLPSVETLGCTSVICSDK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4114.4114.2.dta 17 AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 123 115444 2 2 2 2 2212 2961 1 0 1 810.9096 1619.8047 2 1619.8076 -0.003 0 94.59 2.60E-09 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4735.4735.2.dta 17 AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 123 115444 2 2 2 2 3015 2403 1 0 1 976.9686 1951.9226 2 1951.9231 -0.0005 0 46.57 4.30E-05 R SLPSVETLGCTSVICSDK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4114.4114.2.dta 17 AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 79 111550 2 2 2 2 2137 2563 1 0 1 787.9351 1573.8557 2 1573.8563 -0.0006 0 49.28 5.50E-05 R VDQSILTGESVSVIK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4294.4294.2.dta 17 AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 79 111550 2 2 2 2 3015 2403 1 0 1 976.9686 1951.9226 2 1951.9231 -0.0005 0 46.57 4.30E-05 R SLPSVETLGCTSVICSDK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4114.4114.2.dta 18 1 NXF1_HUMAN Nuclear RNA export factor 1 OS=Homo sapiens GN=NXF1 PE=1 SV=1 150 70652 3 3 2 2 1329 1097 1 1 1 619.3054 1236.5962 2 1236.5986 -0.0025 0 34.5 0.0022 R YDGSQQALDLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2594.2594.2.dta 18 1 NXF1_HUMAN Nuclear RNA export factor 1 OS=Homo sapiens GN=NXF1 PE=1 SV=1 150 70652 3 3 2 2 2146 2913 1 1 1 792.8978 1583.7811 2 1583.7831 -0.002 0 73.77 2.70E-07 R AQFFVEDASTASALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4683.4683.2.dta 18 1 NXF1_HUMAN Nuclear RNA export factor 1 OS=Homo sapiens GN=NXF1 PE=1 SV=1 150 70652 3 3 2 2 2147 3036 1 1 1 792.8986 1583.7826 2 1583.7831 -0.0006 0 81.3 3.20E-08 R AQFFVEDASTASALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4816.4816.2.dta 19 1 ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens GN=ILF3 PE=1 SV=3 132 95678 5 5 2 2 1880 973 1 1 1 730.3638 1458.713 2 1458.7137 -0.0007 0 23.67 0.006 K VLQDMGLPTGAEGR D Oxidation (M) 0.00001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2437.2437.2.dta 19 1 ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens GN=ILF3 PE=1 SV=3 132 95678 5 5 2 2 1881 934 1 1 1 730.3646 1458.7147 2 1458.7137 0.001 0 28 0.0063 K VLQDMGLPTGAEGR D Oxidation (M) 0.00001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2382.2382.2.dta 19 1 ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens GN=ILF3 PE=1 SV=3 132 95678 5 5 2 2 2858 2806 1 1 1 955.4951 1908.9756 2 1908.9793 -0.0037 0 60.16 2.30E-06 K VLAGETLSVNDPPDVLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4563.4563.2.dta 19 1 ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens GN=ILF3 PE=1 SV=3 132 95678 5 5 2 2 2859 2927 1 1 1 955.4969 1908.9793 2 1908.9793 0.0001 0 51.81 1.40E-05 K VLAGETLSVNDPPDVLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4698.4698.2.dta 19 1 ILF3_HUMAN Interleukin enhancer-binding factor 3 OS=Homo sapiens GN=ILF3 PE=1 SV=3 132 95678 5 5 2 2 2860 3070 1 1 1 955.4971 1908.9796 2 1908.9793 0.0003 0 30.65 0.0013 K VLAGETLSVNDPPDVLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4851.4851.2.dta 20 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 131 76625 7 7 5 5 316 1418 1 1 1 406.7351 811.4557 2 811.4552 0.0005 0 23.28 0.025 R LELQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2981.2981.2.dta 20 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 131 76625 7 7 5 5 648 3022 1 1 1 469.2531 936.4916 2 936.4917 0 0 34.4 0.002 K TGISDVFAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4800.4800.2.dta 20 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 131 76625 7 7 5 5 794 1567 1 1 1 500.7743 999.5341 2 999.5349 -0.0008 0 37.76 0.0012 K NDLAVVDVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3150.3150.2.dta 20 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 131 76625 7 7 5 5 795 1715 1 1 1 500.7745 999.5345 2 999.5349 -0.0005 0 52.76 3.80E-05 K NDLAVVDVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3313.3313.2.dta 20 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 131 76625 7 7 5 5 796 1924 1 1 1 500.7747 999.5348 2 999.5349 -0.0001 0 41.95 0.00046 K NDLAVVDVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3547.3547.2.dta 20 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 131 76625 7 7 5 5 1118 2804 1 1 1 580.7947 1159.5748 2 1159.5761 -0.0013 0 35.33 0.0022 R SISLYYTGEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4561.4561.2.dta 20 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 131 76625 7 7 5 5 1164 2474 1 1 1 589.787 1177.5595 2 1177.5615 -0.0019 0 27.79 0.0077 K EVFEDAAEIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4194.4194.2.dta 21 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 126 59020 5 5 3 3 1662 1045 1 1 1 691.3252 1380.6358 2 1380.6408 -0.005 0 35.32 0.00049 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2528.2528.2.dta 21 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 126 59020 5 5 3 3 1663 985 1 1 1 691.3258 1380.6371 2 1380.6408 -0.0038 0 38.6 0.00032 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2451.2451.2.dta 21 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 126 59020 5 5 3 3 1664 894 1 1 1 691.3268 1380.6391 2 1380.6408 -0.0017 0 36.92 0.00034 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2327.2327.2.dta 21 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 126 59020 5 5 3 3 3236 2579 1 1 1 1041.9841 2081.9537 2 2081.9575 -0.0038 0 57.39 7.80E-06 R AETECQNTEYQQLLDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4311.4311.2.dta 21 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 126 59020 5 5 3 3 3661 2642 1 1 1 968.7971 2903.3695 3 2903.3753 -0.0058 0 24.51 0.014 R NVSTGDVNVEMNAAPGVDLTQLLNNMR S 2 Oxidation (M) 0.000000000010000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4379.4379.3.dta 22 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 114 533462 5 5 4 4 1740 2447 1 1 1 708.845 1415.6755 2 1415.678 -0.0025 0 46.9 0.00012 R LEDLLQDAQDEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4162.4162.2.dta 22 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 114 533462 5 5 4 4 1983 863 1 1 1 755.853 1509.6915 2 1509.6947 -0.0032 0 28.97 0.0046 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2285.2285.2.dta 22 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 114 533462 5 5 4 4 2714 3107 1 1 1 917.9487 1833.8828 2 1833.8857 -0.0029 0 61.05 5.50E-06 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4892.4892.2.dta 22 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 114 533462 5 5 4 4 3123 2299 1 1 1 665.7031 1994.0874 3 1994.0909 -0.0035 0 24.46 0.0082 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3984.3984.3.dta 22 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 114 533462 5 5 4 4 3124 2393 1 1 1 665.7036 1994.0888 3 1994.0909 -0.0021 0 25.55 0.0063 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4102.4102.3.dta 23 1 DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 112 87804 4 4 3 3 1069 3046 1 1 1 564.3372 1126.6599 2 1126.6598 0.0001 0 33.08 0.0024 R IGVPSATEIIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4827.4827.2.dta 23 1 DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 112 87804 4 4 3 3 1131 2832 1 1 1 582.8583 1163.7021 2 1163.7026 -0.0005 0 40.54 8.80E-05 R APQVLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4591.4591.2.dta 23 1 DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 112 87804 4 4 3 3 1132 2952 1 1 1 582.8583 1163.7021 2 1163.7026 -0.0005 0 47.18 1.90E-05 R APQVLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4725.4725.2.dta 23 1 DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens GN=DDX21 PE=1 SV=5 112 87804 4 4 3 3 1384 1735 1 1 1 626.8243 1251.6341 2 1251.6347 -0.0005 0 40.45 0.00067 K STYEQVDLIGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3335.3335.2.dta 24 1 JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens GN=JAK1 PE=1 SV=2 106 135016 7 7 3 3 954 3063 1 1 1 544.321 1086.6274 2 1086.6284 -0.001 0 25.66 0.011 R EISNLLVATK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4845.4845.2.dta 24 1 JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens GN=JAK1 PE=1 SV=2 106 135016 7 7 3 3 1595 2559 1 1 1 676.3124 1350.6102 2 1350.6126 -0.0024 0 21.78 0.023 R EGIDSECGPFIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4290.4290.2.dta 24 1 JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens GN=JAK1 PE=1 SV=2 106 135016 7 7 3 3 1596 2840 1 1 1 676.3126 1350.6107 2 1350.6126 -0.0019 0 19.63 0.046 R EGIDSECGPFIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4600.4600.2.dta 24 1 JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens GN=JAK1 PE=1 SV=2 106 135016 7 7 3 3 1597 2722 1 1 1 676.3128 1350.6111 2 1350.6126 -0.0015 0 26.74 0.0086 R EGIDSECGPFIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4465.4465.2.dta 24 1 JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens GN=JAK1 PE=1 SV=2 106 135016 7 7 3 3 1598 2598 1 1 1 676.3134 1350.6122 2 1350.6126 -0.0004 0 25.01 0.013 R EGIDSECGPFIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4332.4332.2.dta 24 1 JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens GN=JAK1 PE=1 SV=2 106 135016 7 7 3 3 2175 2792 1 1 1 799.3784 1596.7422 2 1596.7453 -0.0032 0 45.65 0.00014 R LGSGEYTAEELCIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4547.4547.2.dta 24 1 JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens GN=JAK1 PE=1 SV=2 106 135016 7 7 3 3 2176 2678 1 1 1 799.3793 1596.7441 2 1596.7453 -0.0012 0 56.65 1.10E-05 R LGSGEYTAEELCIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4418.4418.2.dta 25 1 HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens GN=HSP90AA1 PE=1 SV=5 106 85006 3 3 2 2 1347 2999 1 1 1 621.8565 1241.6985 2 1241.6979 0.0005 0 36.63 0.0013 K ADLINNLGTIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4776.4776.2.dta 25 1 HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens GN=HSP90AA1 PE=1 SV=5 106 85006 3 3 2 2 1985 2711 1 1 1 757.3954 1512.7763 2 1512.7784 -0.002 0 61.45 2.10E-06 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4451.4451.2.dta 25 1 HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens GN=HSP90AA1 PE=1 SV=5 106 85006 3 3 2 2 1987 2817 1 1 1 757.3967 1512.7788 2 1512.7784 0.0004 0 46.17 0.00012 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4576.4576.2.dta 25 TRAP1_HUMAN "Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens GN=TRAP1 PE=1 SV=3" 89 80345 2 2 1 1 1985 2711 1 0 1 757.3954 1512.7763 2 1512.7784 -0.002 0 61.45 2.10E-06 R GVVDSEDIPLNLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4451.4451.2.dta 25 TRAP1_HUMAN "Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens GN=TRAP1 PE=1 SV=3" 89 80345 2 2 1 1 1987 2817 1 0 1 757.3967 1512.7788 2 1512.7784 0.0004 0 46.17 0.00012 R GVVDSEDIPLNLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4576.4576.2.dta 25 H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens GN=HSP90AB2P PE=1 SV=2 37 44492 1 1 1 1 1347 2999 1 0 1 621.8565 1241.6985 2 1241.6979 0.0005 0 36.63 0.0013 K ADLINNLGTIAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4776.4776.2.dta 26 1 RBM14_HUMAN RNA-binding protein 14 OS=Homo sapiens GN=RBM14 PE=1 SV=2 106 69620 2 2 1 1 2494 2595 1 1 1 876.4407 1750.8669 2 1750.8672 -0.0003 0 61.63 1.70E-06 K IFVGNVSAACTSQELR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4328.4328.2.dta 26 1 RBM14_HUMAN RNA-binding protein 14 OS=Homo sapiens GN=RBM14 PE=1 SV=2 106 69620 2 2 1 1 2495 2430 1 1 1 876.4418 1750.8691 2 1750.8672 0.0019 0 60.74 2.60E-06 K IFVGNVSAACTSQELR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4144.4144.2.dta 27 1 HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens GN=HNRNPL PE=1 SV=2 104 64720 5 5 3 3 1053 1181 1 1 1 561.2554 1120.4962 2 1120.4971 -0.001 0 27.74 0.0061 K LCFSTAQHAS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2700.2700.2.dta 27 1 HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens GN=HNRNPL PE=1 SV=2 104 64720 5 5 3 3 1054 1082 1 1 1 561.2556 1120.4966 2 1120.4971 -0.0006 0 27.41 0.0067 K LCFSTAQHAS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2577.2577.2.dta 27 1 HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens GN=HNRNPL PE=1 SV=2 104 64720 5 5 3 3 1055 1297 1 1 1 561.2559 1120.4973 2 1120.4971 0.0001 0 24.14 0.015 K LCFSTAQHAS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2839.2839.2.dta 27 1 HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens GN=HNRNPL PE=1 SV=2 104 64720 5 5 3 3 1268 3015 1 1 1 611.8007 1221.5869 2 1221.5877 -0.0008 0 45.02 0.00024 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4792.4792.2.dta 27 1 HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens GN=HNRNPL PE=1 SV=2 104 64720 5 5 3 3 2426 1511 1 1 1 865.3964 1728.7782 2 1728.7811 -0.0029 0 53.63 1.60E-05 K ASLNGADIYSGCCTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3086.3086.2.dta 28 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 97 18296 4 4 1 1 2590 2605 1 1 1 894.467 1786.9194 2 1786.92 -0.0006 0 31.01 0.0018 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4340.4340.2.dta 28 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 97 18296 4 4 1 1 2591 2490 1 1 1 894.4672 1786.9198 2 1786.92 -0.0002 0 51.1 5.20E-05 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4213.4213.2.dta 28 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 97 18296 4 4 1 1 2592 2380 1 1 1 894.4672 1786.9199 2 1786.92 -0.0001 0 34.34 0.0025 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4088.4088.2.dta 28 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 97 18296 4 4 1 1 2593 2349 1 1 1 894.4679 1786.9212 2 1786.92 0.0012 0 36.31 0.00065 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4048.4048.2.dta 29 1 TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 93 89950 3 3 1 1 3328 2715 1 1 1 1085.5646 2169.1146 2 2169.1165 -0.0019 0 54.85 1.50E-05 R LIVDEAINEDNSVVSLSQPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4456.4456.2.dta 29 1 TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 93 89950 3 3 1 1 3329 2725 1 1 1 724.0455 2169.1148 3 2169.1165 -0.0017 0 22.35 0.028 R LIVDEAINEDNSVVSLSQPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4468.4468.3.dta 29 1 TERA_HUMAN Transitional endoplasmic reticulum ATPase OS=Homo sapiens GN=VCP PE=1 SV=4 93 89950 3 3 1 1 3330 2823 1 1 1 1085.5652 2169.1158 2 2169.1165 -0.0007 0 54.2 1.80E-05 R LIVDEAINEDNSVVSLSQPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4582.4582.2.dta 30 1 CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 93 74528 3 3 2 2 1679 2943 1 1 1 694.8842 1387.7539 2 1387.7559 -0.002 0 47.34 6.40E-05 K TVELLSGVVDQTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4714.4714.2.dta 30 1 CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 93 74528 3 3 2 2 1680 3067 1 1 1 694.8843 1387.754 2 1387.7559 -0.0019 0 49.45 7.80E-05 K TVELLSGVVDQTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4849.4849.2.dta 30 1 CMC2_HUMAN Calcium-binding mitochondrial carrier protein Aralar2 OS=Homo sapiens GN=SLC25A13 PE=1 SV=2 93 74528 3 3 2 2 2136 2776 1 1 1 787.8632 1573.7119 2 1573.7195 -0.0076 0 35.19 0.0013 R AGQTTYSGVIDCFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4528.4528.2.dta 30 CMC1_HUMAN Calcium-binding mitochondrial carrier protein Aralar1 OS=Homo sapiens GN=SLC25A12 PE=1 SV=2 35 75114 1 1 1 1 2136 2776 1 0 1 787.8632 1573.7119 2 1573.7195 -0.0076 0 35.19 0.0013 R AGQTTYSGVIDCFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4528.4528.2.dta 31 1 MIC60_HUMAN MICOS complex subunit MIC60 OS=Homo sapiens GN=IMMT PE=1 SV=1 86 84026 2 2 1 1 2784 2704 1 1 1 936.5015 1870.9885 2 1870.9888 -0.0002 0 44.44 0.00019 K TSSAETPTIPLGSAVEAIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4444.4444.2.dta 31 1 MIC60_HUMAN MICOS complex subunit MIC60 OS=Homo sapiens GN=IMMT PE=1 SV=1 86 84026 2 2 1 1 2785 2813 1 1 1 936.5017 1870.9889 2 1870.9888 0.0001 0 60.8 2.70E-06 K TSSAETPTIPLGSAVEAIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4571.4571.2.dta 32 1 KHDR1_HUMAN "KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens GN=KHDRBS1 PE=1 SV=1" 85 48311 7 7 4 4 66 116 1 1 1 323.1874 644.3603 2 644.3606 -0.0002 0 42.73 0.00073 R TAGIQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1214.1214.2.dta 32 1 KHDR1_HUMAN "KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens GN=KHDRBS1 PE=1 SV=1" 85 48311 7 7 4 4 67 249 1 1 1 323.1875 644.3604 2 644.3606 -0.0001 0 29.85 0.014 R TAGIQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1371.1371.2.dta 32 1 KHDR1_HUMAN "KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens GN=KHDRBS1 PE=1 SV=1" 85 48311 7 7 4 4 95 3237 1 1 0 334.7386 667.4627 2 667.4632 -0.0006 0 25.73 0.0027 R VLIPVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5068.5068.2.dta 32 1 KHDR1_HUMAN "KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens GN=KHDRBS1 PE=1 SV=1" 85 48311 7 7 4 4 844 1052 1 1 1 520.8085 1039.6024 2 1039.6026 -0.0002 0 25.99 0.0072 K ILGPQGNTIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2537.2537.2.dta 32 1 KHDR1_HUMAN "KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens GN=KHDRBS1 PE=1 SV=1" 85 48311 7 7 4 4 845 1145 1 1 1 520.8086 1039.6026 2 1039.6026 0 0 24.08 0.011 K ILGPQGNTIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2655.2655.2.dta 32 1 KHDR1_HUMAN "KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens GN=KHDRBS1 PE=1 SV=1" 85 48311 7 7 4 4 3844 2315 1 1 1 932.5031 3725.9831 4 3725.988 -0.0049 0 26.73 0.0024 R ASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4005.4005.4.dta 32 1 KHDR1_HUMAN "KH domain-containing, RNA-binding, signal transduction-associated protein 1 OS=Homo sapiens GN=KHDRBS1 PE=1 SV=1" 85 48311 7 7 4 4 3846 2236 1 1 1 1243.004 3725.9903 3 3725.988 0.0022 0 13.26 0.05 R ASPATQPPPLLPPSATGPDATVGGPAPTPLLPPSATASVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3911.3911.3.dta 33 1 FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens GN=FUS PE=1 SV=1 80 53622 4 4 1 1 1744 880 1 1 1 710.8326 1419.6506 2 1419.6518 -0.0012 0 38.88 0.00061 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2308.2308.2.dta 33 1 FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens GN=FUS PE=1 SV=1 80 53622 4 4 1 1 1745 1049 1 1 1 710.8329 1419.6513 2 1419.6518 -0.0004 0 37.37 0.00083 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2533.2533.2.dta 33 1 FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens GN=FUS PE=1 SV=1 80 53622 4 4 1 1 1746 961 1 1 1 710.833 1419.6515 2 1419.6518 -0.0003 0 34.96 0.0015 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2419.2419.2.dta 33 1 FUS_HUMAN RNA-binding protein FUS OS=Homo sapiens GN=FUS PE=1 SV=1 80 53622 4 4 1 1 1747 1143 1 1 1 710.8333 1419.652 2 1419.6518 0.0002 0 25.38 0.013 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2652.2652.2.dta 34 1 NU107_HUMAN Nuclear pore complex protein Nup107 OS=Homo sapiens GN=NUP107 PE=1 SV=1 78 107048 1 1 1 1 2824 1639 1 1 1 945.4722 1888.9298 2 1888.9279 0.0019 0 78.46 4.40E-08 R VLLQASQDENFGNTTPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3228.3228.2.dta 35 1 ZCCHV_HUMAN Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens GN=ZC3HAV1 PE=1 SV=3 75 103135 2 2 2 2 1719 1648 1 1 1 701.3469 1400.6792 2 1400.6783 0.0008 0 21.78 0.032 R ASLEDAPVDDLTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3238.3238.2.dta 35 1 ZCCHV_HUMAN Zinc finger CCCH-type antiviral protein 1 OS=Homo sapiens GN=ZC3HAV1 PE=1 SV=3 75 103135 2 2 2 2 2752 1793 1 1 1 926.4697 1850.9248 2 1850.9222 0.0026 0 73.25 3.20E-07 R VALVNDSLSDVTSTTSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3399.3399.2.dta 36 1 U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 73 110336 3 3 1 1 1691 1968 1 1 1 696.8889 1391.7633 2 1391.766 -0.0027 0 34.11 0.0016 K IAVEPVNPSELPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3598.3598.2.dta 36 1 U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 73 110336 3 3 1 1 1692 1724 1 1 1 696.8898 1391.765 2 1391.766 -0.001 0 35.02 0.0016 K IAVEPVNPSELPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3323.3323.2.dta 36 1 U5S1_HUMAN 116 kDa U5 small nuclear ribonucleoprotein component OS=Homo sapiens GN=EFTUD2 PE=1 SV=1 73 110336 3 3 1 1 1693 1846 1 1 1 696.8898 1391.7651 2 1391.766 -0.0009 0 43.54 0.00022 K IAVEPVNPSELPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3459.3459.2.dta 37 1 SFPQ_HUMAN "Splicing factor, proline- and glutamine-rich OS=Homo sapiens GN=SFPQ PE=1 SV=2" 73 76216 2 2 1 1 1573 788 1 1 1 671.3358 1340.6571 2 1340.6586 -0.0015 0 55.06 2.10E-05 R FGQGGAGPVGGQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2175.2175.2.dta 37 1 SFPQ_HUMAN "Splicing factor, proline- and glutamine-rich OS=Homo sapiens GN=SFPQ PE=1 SV=2" 73 76216 2 2 1 1 1574 886 1 1 1 671.3359 1340.6572 2 1340.6586 -0.0014 0 39.03 0.00084 R FGQGGAGPVGGQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2315.2315.2.dta 38 1 PARP1_HUMAN Poly [ADP-ribose] polymerase 1 OS=Homo sapiens GN=PARP1 PE=1 SV=4 73 113811 1 1 1 1 2236 2871 1 1 1 812.9029 1623.7912 2 1623.7992 -0.008 0 72.88 3.70E-07 R VVSEDFLQDVSASTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4635.4635.2.dta 39 1 TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 69 85274 5 5 3 3 1226 2645 1 1 1 602.3397 1202.6649 2 1202.6659 -0.001 0 36.53 0.0013 R AAAEVAGQFVIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4381.4381.2.dta 39 1 TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 69 85274 5 5 3 3 1230 1757 1 1 1 602.8198 1203.6251 2 1203.6248 0.0003 0 33.89 0.0045 K LLNENSYVPR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3359.3359.2.dta 39 1 TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 69 85274 5 5 3 3 1909 1863 1 1 1 734.908 1467.8014 2 1467.8045 -0.0032 0 20.15 0.042 R SSGLPNIPVQTISR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3478.3478.2.dta 39 1 TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 69 85274 5 5 3 3 1910 1979 1 1 1 734.9085 1467.8025 2 1467.8045 -0.0021 0 29.35 0.0046 R SSGLPNIPVQTISR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3611.3611.2.dta 39 1 TFR1_HUMAN Transferrin receptor protein 1 OS=Homo sapiens GN=TFRC PE=1 SV=2 69 85274 5 5 3 3 1911 2086 1 1 1 734.9097 1467.8048 2 1467.8045 0.0002 0 29.3 0.0047 R SSGLPNIPVQTISR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3740.3740.2.dta 40 1 4F2_HUMAN 4F2 cell-surface antigen heavy chain OS=Homo sapiens GN=SLC3A2 PE=1 SV=3 58 68180 3 3 3 3 1142 2610 1 1 1 585.828 1169.6415 2 1169.6404 0.001 0 29.09 0.006 K ADLLLSTQPGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4345.4345.2.dta 40 1 4F2_HUMAN 4F2 cell-surface antigen heavy chain OS=Homo sapiens GN=SLC3A2 PE=1 SV=3 58 68180 3 3 3 3 1380 3023 1 1 1 626.8062 1251.5978 2 1251.5983 -0.0005 0 30.4 0.004 K EDFDSLLQSAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4801.4801.2.dta 40 1 4F2_HUMAN 4F2 cell-surface antigen heavy chain OS=Homo sapiens GN=SLC3A2 PE=1 SV=3 58 68180 3 3 3 3 3066 2594 1 1 1 988.4832 1974.9519 2 1974.9535 -0.0016 0 33.95 0.00065 K DDVAQTDLLQIDPNFGSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4327.4327.2.dta 41 1 HNRL2_HUMAN Heterogeneous nuclear ribonucleoprotein U-like protein 2 OS=Homo sapiens GN=HNRNPUL2 PE=1 SV=1 56 85622 1 1 1 1 1938 2163 1 1 1 745.3875 1488.7605 2 1488.7606 -0.0001 0 55.66 1.20E-05 R DLLVQQASQCLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3828.3828.2.dta 42 1 MCM3_HUMAN DNA replication licensing factor MCM3 OS=Homo sapiens GN=MCM3 PE=1 SV=3 54 91551 1 1 1 1 2716 2580 1 1 1 918.9486 1835.8827 2 1835.8789 0.0038 0 53.63 2.70E-05 R DSEEPFSSVEIQAALSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4312.4312.2.dta 43 1 DREB_HUMAN Drebrin OS=Homo sapiens GN=DBN1 PE=1 SV=4 53 71842 1 1 1 1 2767 998 1 1 1 931.4427 1860.8709 2 1860.8701 0.0008 0 53.18 2.40E-05 R SPSDSSTASTPVAEQIER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2467.2467.2.dta 44 1 IPO8_HUMAN Importin-8 OS=Homo sapiens GN=IPO8 PE=1 SV=2 50 120945 1 1 1 1 1964 816 1 1 1 752.8621 1503.7097 2 1503.7053 0.0044 0 50.26 5.30E-05 R ETENDDVTNVIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2210.2210.2.dta 45 1 RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens GN=RIOK1 PE=1 SV=2 48 65884 2 2 1 1 1701 2816 1 1 1 698.8742 1395.7339 2 1395.7358 -0.0019 0 50.74 5.50E-05 K VPALLENQVEER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4575.4575.2.dta 45 1 RIOK1_HUMAN Serine/threonine-protein kinase RIO1 OS=Homo sapiens GN=RIOK1 PE=1 SV=2 48 65884 2 2 1 1 1702 2583 1 1 1 698.8754 1395.7362 2 1395.7358 0.0004 0 14.27 0.046 K VPALLENQVEER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4316.4316.2.dta 46 1 FUBP1_HUMAN Far upstream element-binding protein 1 OS=Homo sapiens GN=FUBP1 PE=1 SV=3 47 67690 1 1 1 1 1565 2633 1 1 1 668.8649 1335.7152 2 1335.7147 0.0005 0 46.75 0.00011 R IGGNEGIDVPIPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4369.4369.2.dta 47 1 HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens GN=HNRNPM PE=1 SV=3 47 77749 2 2 2 2 1445 680 1 1 1 642.8178 1283.6211 2 1283.6219 -0.0008 0 45.63 0.00014 K QGGGGGGGSVPGIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2018.2018.2.dta 47 1 HNRPM_HUMAN Heterogeneous nuclear ribonucleoprotein M OS=Homo sapiens GN=HNRNPM PE=1 SV=3 47 77749 2 2 2 2 1879 1123 1 1 1 730.3508 1458.687 2 1458.6959 -0.0089 0 18.52 0.026 R MGPAMGPALGAGIER M 2 Oxidation (M) 0.100010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2626.2626.2.dta 48 1 CDC5L_HUMAN Cell division cycle 5-like protein OS=Homo sapiens GN=CDC5L PE=1 SV=2 47 92422 1 1 1 1 3138 3113 1 1 1 1005.0078 2008.0011 2 2008.0001 0.001 0 46.63 4.20E-05 K ESDLPSAILQTSGVSEFTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4899.4899.2.dta 49 1 DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 45 91673 2 2 1 1 1673 1662 1 1 1 693.3406 1384.6667 2 1384.6722 -0.0055 0 43.05 0.0003 R EVDDLGPEVGDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3254.3254.2.dta 49 1 DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 45 91673 2 2 1 1 1674 1824 1 1 1 693.3436 1384.6727 2 1384.6722 0.0005 0 22.18 0.041 R EVDDLGPEVGDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3434.3434.2.dta 50 1 ALBU_HUMAN Serum albumin OS=Homo sapiens GN=ALB PE=1 SV=2 44 71317 1 1 1 1 817 1599 1 1 1 507.3032 1012.5919 2 1012.5917 0.0002 0 44.36 0.00014 K LVAASQAALGL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3184.3184.2.dta 51 1 MCM4_HUMAN DNA replication licensing factor MCM4 OS=Homo sapiens GN=MCM4 PE=1 SV=5 40 97068 1 1 1 1 1627 3093 1 1 1 683.3453 1364.676 2 1364.6824 -0.0064 0 40.22 0.00017 R ALADDDFLTVTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4876.4876.2.dta 52 1 RPN1_HUMAN Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 1 OS=Homo sapiens GN=RPN1 PE=1 SV=1 40 68641 1 1 1 1 1807 2526 1 1 1 718.3574 1434.7003 2 1434.699 0.0013 0 40.09 0.00056 K NIEIDSPYEISR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4253.4253.2.dta 53 1 INSI1_HUMAN Insulin-induced gene 1 protein OS=Homo sapiens GN=INSIG1 PE=1 SV=3 38 30367 5 5 1 1 248 167 2 0 1 380.2214 758.4283 2 758.4286 -0.0003 0 25.21 0.04 R ASAAGLAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1272.1272.2.dta 53 1 INSI1_HUMAN Insulin-induced gene 1 protein OS=Homo sapiens GN=INSIG1 PE=1 SV=3 38 30367 5 5 1 1 249 343 2 0 1 380.2214 758.4283 2 758.4286 -0.0003 0 29.79 0.014 R ASAAGLAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1508.1508.2.dta 53 1 INSI1_HUMAN Insulin-induced gene 1 protein OS=Homo sapiens GN=INSIG1 PE=1 SV=3 38 30367 5 5 1 1 250 272 2 0 1 380.2215 758.4284 2 758.4286 -0.0002 0 27.28 0.025 R ASAAGLAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1402.1402.2.dta 53 1 INSI1_HUMAN Insulin-induced gene 1 protein OS=Homo sapiens GN=INSIG1 PE=1 SV=3 38 30367 5 5 1 1 252 490 1 0 1 380.2216 758.4287 2 758.4286 0.0001 0 26.84 0.028 R ASAAGLAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1730.1730.2.dta 53 1 INSI1_HUMAN Insulin-induced gene 1 protein OS=Homo sapiens GN=INSIG1 PE=1 SV=3 38 30367 5 5 1 1 253 410 1 1 1 380.2216 758.4287 2 758.4286 0.0001 0 25.26 0.04 R ASAAGLAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.1612.1612.2.dta 54 1 LMNB1_HUMAN Lamin-B1 OS=Homo sapiens GN=LMNB1 PE=1 SV=2 35 66653 2 2 2 2 1107 831 1 1 1 577.8114 1153.6083 2 1153.6091 -0.0009 0 28.72 0.0033 R AGGPTTPLSPTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2232.2232.2.dta 54 1 LMNB1_HUMAN Lamin-B1 OS=Homo sapiens GN=LMNB1 PE=1 SV=2 35 66653 2 2 2 2 1842 2615 1 1 1 723.8993 1445.784 2 1445.7725 0.0115 0 24.57 0.021 R IESLSSQLSNLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4350.4350.2.dta 55 1 MISP_HUMAN Mitotic interactor and substrate of PLK1 OS=Homo sapiens GN=MISP PE=1 SV=1 35 75482 1 1 1 1 1961 1864 1 1 1 750.3887 1498.7629 2 1498.7627 0.0002 0 34.67 0.00063 R ALSSDSILSPAPDAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3479.3479.2.dta 56 1 MTA2_HUMAN Metastasis-associated protein MTA2 OS=Homo sapiens GN=MTA2 PE=1 SV=1 34 75717 1 1 1 1 2279 3061 1 1 1 826.9531 1651.8916 2 1651.8934 -0.0018 0 33.7 0.002 K LNPADAPNPVVFVATK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4842.4842.2.dta 57 1 IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2 33 64008 2 2 1 1 2251 1849 1 1 1 818.4164 1634.8182 2 1634.8185 -0.0003 0 26.36 0.0098 K SITILSTPEGTSAACK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3462.3462.2.dta 57 1 IF2B3_HUMAN Insulin-like growth factor 2 mRNA-binding protein 3 OS=Homo sapiens GN=IGF2BP3 PE=1 SV=2 33 64008 2 2 1 1 2252 1941 1 1 1 818.4166 1634.8187 2 1634.8185 0.0002 0 26.62 0.017 K SITILSTPEGTSAACK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3567.3567.2.dta 58 1 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 31 132928 3 3 3 3 788 3087 1 1 1 499.8158 997.617 2 997.6172 -0.0002 0 24.92 0.0039 K IIIAEVVNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4870.4870.2.dta 58 1 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 31 132928 3 3 3 3 1156 3018 1 1 1 587.2932 1172.5719 2 1172.5713 0.0006 0 16.42 0.029 R YNYLSLDSAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4795.4795.2.dta 58 1 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 31 132928 3 3 3 3 2075 2158 1 1 1 778.9044 1555.7942 2 1555.7994 -0.0053 0 21.47 0.039 K VSTTLNVAQAYYAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3822.3822.2.dta 59 1 CCD87_HUMAN Coiled-coil domain-containing protein 87 OS=Homo sapiens GN=CCDC87 PE=1 SV=2 27 96741 4 4 1 1 432 3229 1 1 1 421.7582 841.5019 2 841.5021 -0.0002 1 24.02 0.017 K ELKSIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5059.5059.2.dta 59 1 CCD87_HUMAN Coiled-coil domain-containing protein 87 OS=Homo sapiens GN=CCDC87 PE=1 SV=2 27 96741 4 4 1 1 433 3684 2 1 1 421.7583 841.502 2 841.5021 -0.0001 1 20.25 0.04 K ELKSIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5759.5759.2.dta 59 1 CCD87_HUMAN Coiled-coil domain-containing protein 87 OS=Homo sapiens GN=CCDC87 PE=1 SV=2 27 96741 4 4 1 1 434 947 1 1 1 421.7583 841.5021 2 841.5021 0 1 19.63 0.046 K ELKSIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2400.2400.2.dta 59 1 CCD87_HUMAN Coiled-coil domain-containing protein 87 OS=Homo sapiens GN=CCDC87 PE=1 SV=2 27 96741 4 4 1 1 436 2060 1 1 1 421.7584 841.5023 2 841.5021 0.0002 1 20.23 0.04 K ELKSIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3708.3708.2.dta 60 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 27 160611 1 1 1 1 1658 3043 1 1 1 690.8303 1379.646 2 1379.647 -0.001 0 27.08 0.0029 K SFVSSNWAETPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4823.4823.2.dta 61 1 PLOD3_HUMAN "Procollagen-lysine,2-oxoglutarate 5-dioxygenase 3 OS=Homo sapiens GN=PLOD3 PE=1 SV=1" 27 85302 1 1 1 1 1775 1630 1 1 1 712.8782 1423.7419 2 1423.7307 0.0112 0 26.97 0.0071 K LVGPEEALSPGEAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3218.3218.2.dta 62 1 KDM8_HUMAN Lysine-specific demethylase 8 OS=Homo sapiens GN=KDM8 PE=1 SV=1 26 47867 1 1 1 1 433 3684 1 0 1 421.7583 841.502 2 841.5021 -0.0001 1 25.72 0.011 K LEKTVPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5759.5759.2.dta 63 1 LRMP_HUMAN Lymphoid-restricted membrane protein OS=Homo sapiens GN=LRMP PE=1 SV=3 25 62767 3 3 1 1 476 1874 1 1 1 428.7662 855.5179 2 855.5178 0.0001 0 21.56 0.025 R VTIASLPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3491.3491.2.dta 63 1 LRMP_HUMAN Lymphoid-restricted membrane protein OS=Homo sapiens GN=LRMP PE=1 SV=3 25 62767 3 3 1 1 477 2887 1 1 1 428.7662 855.5179 2 855.5178 0.0001 0 19.86 0.038 R VTIASLPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4654.4654.2.dta 63 1 LRMP_HUMAN Lymphoid-restricted membrane protein OS=Homo sapiens GN=LRMP PE=1 SV=3 25 62767 3 3 1 1 482 1991 1 1 1 428.7664 855.5182 2 855.5178 0.0004 0 19.77 0.038 R VTIASLPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3625.3625.2.dta 64 1 INT4_HUMAN Integrator complex subunit 4 OS=Homo sapiens GN=INTS4 PE=1 SV=2 24 109071 3 3 3 3 1330 1385 1 1 1 619.3067 1236.5989 2 1236.5986 0.0002 0 17.17 0.025 K LLSDDYEQVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2943.2943.2.dta 64 1 INT4_HUMAN Integrator complex subunit 4 OS=Homo sapiens GN=INTS4 PE=1 SV=2 24 109071 3 3 3 3 1782 3016 1 1 1 713.3344 1424.6543 2 1424.6572 -0.0029 0 17.05 0.047 K IIGDYFSDQDPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4793.4793.2.dta 64 1 INT4_HUMAN Integrator complex subunit 4 OS=Homo sapiens GN=INTS4 PE=1 SV=2 24 109071 3 3 3 3 3691 2950 1 1 1 995.1828 2982.5266 3 2982.5298 -0.0032 0 21.53 0.02 K LVSSAVSPSIIPQEDPSQQFLQQSLER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4722.4722.3.dta 65 1 NUP93_HUMAN Nuclear pore complex protein Nup93 OS=Homo sapiens GN=NUP93 PE=1 SV=2 24 93943 1 1 1 1 1724 2139 1 1 1 701.8589 1401.7033 2 1401.7034 -0.0001 0 23.99 0.014 R CGDLLAASQVVNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.3799.3799.2.dta 66 1 SAMD7_HUMAN Sterile alpha motif domain-containing protein 7 OS=Homo sapiens GN=SAMD7 PE=2 SV=1 24 49481 2 2 1 1 405 2839 1 1 1 417.2437 832.4728 2 832.4807 -0.0079 0 22.84 0.035 K TLSFPIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4599.4599.2.dta 66 1 SAMD7_HUMAN Sterile alpha motif domain-containing protein 7 OS=Homo sapiens GN=SAMD7 PE=2 SV=1 24 49481 2 2 1 1 411 3354 1 1 1 417.2461 832.4776 2 832.4807 -0.0031 0 21.43 0.039 K TLSFPIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5228.5228.2.dta 67 1 DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 20 101168 1 1 1 1 1331 3042 1 1 1 619.342 1236.6694 2 1236.6714 -0.002 0 20.14 0.046 R QTLLFSATQTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4822.4822.2.dta 68 1 SNP47_HUMAN Synaptosomal-associated protein 47 OS=Homo sapiens GN=SNAP47 PE=1 SV=3 20 52814 1 1 1 1 3150 3701 1 1 1 1008.0037 2013.9928 2 2014.0007 -0.0079 1 20.13 0.02 R EDVDDIKVHSPYEISIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.607.607.2.dta 69 1 SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 19 122513 1 1 1 1 1130 3055 1 1 1 582.8036 1163.5927 2 1163.5935 -0.0007 0 18.65 0.045 K QNLLSVGDYR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4836.4836.2.dta 70 1 YK033_HUMAN Putative uncharacterized protein FLJ41423 OS=Homo sapiens PE=5 SV=1 18 18294 2 2 1 1 1534 3303 1 1 1 657.3655 1312.7165 2 1312.7139 0.0026 0 16.63 0.028 R IWVTASVTPSPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5140.5140.2.dta 70 1 YK033_HUMAN Putative uncharacterized protein FLJ41423 OS=Homo sapiens PE=5 SV=1 18 18294 2 2 1 1 1536 3378 1 1 1 657.3658 1312.7171 2 1312.7139 0.0032 0 14.94 0.04 R IWVTASVTPSPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.5268.5268.2.dta 71 1 ERN1_HUMAN Serine/threonine-protein kinase/endoribonuclease IRE1 OS=Homo sapiens GN=ERN1 PE=1 SV=2 17 110521 1 1 1 1 1291 1080 1 1 1 615.3184 1228.6223 2 1228.6299 -0.0076 1 17.04 0.041 R ENVIPADSEKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.2574.2574.2.dta 72 1 SDHA_HUMAN "Succinate dehydrogenase [ubiquinone] flavoprotein subunit, mitochondrial OS=Homo sapiens GN=SDHA PE=1 SV=2" 15 73672 1 1 1 1 2485 3080 1 1 1 872.4173 1742.82 2 1742.8298 -0.0097 0 15.15 0.038 R AAFGLSEAGFNTACVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-2.4861.4861.2.dta