Header -------------------------------------------------------- Search title orb_190624_AE-MF-7_#1-5.raw Timestamp 2019-06-28T04:26:41Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/mascotdata/data/20190628/F081295.dat Peak list data path D:\data\oda\190624_AE-MF-7\orb_190624_AE-MF-7_#1-5.raw Peak list format Mascot generic Search type MIS Mascot version 2.6.0 Database SwissProt Fasta file SwissProt_2017_05.fasta Total sequences 554515 Total residues 198509421 Sequences after taxonomy filter 20202 Number of queries 5514 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter . . . . . . . . . . . . . . . . Homo sapiens (human) Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 310 2428 1 1 1 389.1978 776.381 2 776.3817 -0.0008 0 26.36 0.029 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3717.3717.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 311 3250 1 1 1 389.1978 776.3811 2 776.3817 -0.0006 0 25.97 0.031 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4595.4595.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 312 2590 1 1 1 389.1978 776.3811 2 776.3817 -0.0006 0 29.49 0.014 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3899.3899.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 313 2263 1 1 1 389.1979 776.3812 2 776.3817 -0.0005 0 27.91 0.02 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3535.3535.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 314 3090 1 1 1 389.1979 776.3812 2 776.3817 -0.0005 0 28.37 0.018 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4425.4425.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 315 3410 1 1 1 389.1979 776.3813 2 776.3817 -0.0004 0 27.57 0.022 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4765.4765.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 316 1611 1 1 1 389.1979 776.3813 2 776.3817 -0.0004 0 36.71 0.0027 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2810.2810.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 317 3561 1 1 1 389.1979 776.3813 2 776.3817 -0.0004 0 25.25 0.038 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4925.4925.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 318 2927 1 1 1 389.198 776.3814 2 776.3817 -0.0003 0 26.06 0.032 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4255.4255.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 319 3854 1 1 1 389.198 776.3815 2 776.3817 -0.0002 0 29.82 0.013 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5235.5235.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 321 4385 1 1 1 389.1981 776.3816 2 776.3817 -0.0002 0 27.76 0.021 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5796.5796.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 322 4500 1 1 1 389.1981 776.3816 2 776.3817 -0.0002 0 27.59 0.022 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5925.5925.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 323 2755 1 1 1 389.1981 776.3816 2 776.3817 -0.0001 0 27.97 0.016 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4076.4076.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 324 3998 1 1 1 389.1981 776.3816 2 776.3817 -0.0001 0 24.16 0.039 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5386.5386.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 325 4261 1 1 1 389.1981 776.3817 2 776.3817 0 0 24.1 0.039 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5663.5663.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 326 2103 1 1 1 389.1982 776.3818 2 776.3817 0.0001 0 28.06 0.016 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3355.3355.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 327 4615 1 1 1 389.1982 776.3818 2 776.3817 0.0001 0 29.81 0.011 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6056.6056.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 328 3715 1 1 1 389.1982 776.3819 2 776.3817 0.0002 0 29.79 0.011 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5086.5086.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 329 1781 1 1 1 389.1982 776.3819 2 776.3817 0.0002 0 41.46 0.00073 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2999.2999.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 330 4132 1 1 1 389.1982 776.3819 2 776.3817 0.0002 0 23.9 0.041 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5525.5525.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 331 4723 1 1 1 389.1982 776.3819 2 776.3817 0.0002 0 23.79 0.042 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6184.6184.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 332 1939 1 1 1 389.1987 776.3828 2 776.3817 0.0011 0 29.57 0.011 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3175.3175.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2153 2130 1 1 1 652.3109 1302.6073 2 1302.6092 -0.0019 0 53.49 9.60E-06 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3385.3385.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2154 5044 1 1 1 652.3112 1302.6079 2 1302.6092 -0.0013 0 50.37 6.00E-05 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6611.6611.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2155 4992 1 1 1 652.3112 1302.6079 2 1302.6092 -0.0013 0 65.51 1.80E-06 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6519.6519.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2156 4961 1 1 1 652.3115 1302.6084 2 1302.6092 -0.0008 0 66.22 1.60E-06 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6457.6457.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2157 4287 1 1 1 652.3115 1302.6085 2 1302.6092 -0.0007 0 73.84 2.70E-07 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5690.5690.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2158 4524 1 1 1 652.3115 1302.6085 2 1302.6092 -0.0007 0 89.18 7.90E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5953.5953.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2159 4405 1 1 1 652.3116 1302.6086 2 1302.6092 -0.0006 0 84.75 2.20E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5822.5822.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2160 4158 1 1 1 652.3118 1302.6091 2 1302.6092 -0.0001 0 82.54 3.60E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5552.5552.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2161 2291 1 1 1 652.3119 1302.6092 2 1302.6092 0 0 85.69 1.80E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3565.3565.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2162 4026 1 1 1 652.3119 1302.6093 2 1302.6092 0.0001 0 81.05 5.10E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5415.5415.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2163 3117 1 1 1 652.312 1302.6095 2 1302.6092 0.0003 0 89.48 7.30E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4455.4455.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2164 4636 1 1 1 652.312 1302.6095 2 1302.6092 0.0003 0 91.29 4.80E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6082.6082.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2165 3743 1 1 1 652.3121 1302.6096 2 1302.6092 0.0004 0 97.09 1.30E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5115.5115.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2166 3438 1 1 1 652.3121 1302.6096 2 1302.6092 0.0004 0 92.73 3.50E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4795.4795.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2167 4848 1 1 1 652.3123 1302.61 2 1302.6092 0.0007 0 81.59 4.50E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6328.6328.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2168 2784 1 1 1 652.3124 1302.6102 2 1302.6092 0.001 0 87.82 1.10E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4105.4105.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 2169 2956 1 1 1 652.3124 1302.6103 2 1302.6092 0.0011 0 88.87 8.40E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4285.4285.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3244 2354 1 1 1 830.4189 1658.8232 2 1658.8264 -0.0032 1 102.46 4.40E-10 R FSGSGSGTDFTLKISR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3635.3635.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3245 2348 1 1 1 553.9487 1658.8244 3 1658.8264 -0.0021 1 25.4 0.0066 R FSGSGSGTDFTLKISR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3628.3628.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3938 2314 1 1 1 687.9979 2060.9718 3 2060.9804 -0.0086 1 26.35 0.0034 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3590.3590.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3939 5005 1 1 1 687.999 2060.9752 3 2060.9804 -0.0051 1 18.07 0.02 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6541.6541.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3940 2523 1 1 1 1031.4955 2060.9764 2 2060.9804 -0.004 1 71.39 2.00E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3823.3823.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3941 2851 1 1 1 1031.4962 2060.9779 2 2060.9804 -0.0025 1 56.57 5.00E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4176.4176.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3942 4787 1 1 1 1031.4963 2060.9781 2 2060.9804 -0.0023 1 55.96 5.70E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6257.6257.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3943 4199 1 1 1 688 2060.9782 3 2060.9804 -0.0022 1 54.24 2.00E-05 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5596.5596.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3944 2516 1 1 1 688 2060.9782 3 2060.9804 -0.0022 1 40.34 0.00035 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3816.3816.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3945 4442 1 1 1 688.0001 2060.9784 3 2060.9804 -0.002 1 65.5 1.20E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5863.5863.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3946 4668 1 1 1 688.0001 2060.9784 3 2060.9804 -0.002 1 60.01 4.10E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6121.6121.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3947 4969 1 1 1 688.0001 2060.9784 3 2060.9804 -0.002 1 39.93 0.00036 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6473.6473.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3948 4896 1 1 1 1031.4965 2060.9784 2 2060.9804 -0.002 1 66.98 5.20E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6380.6380.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3949 3779 1 1 1 688.0001 2060.9785 3 2060.9804 -0.0018 1 71.08 3.80E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5155.5155.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3950 3014 1 1 1 1031.4966 2060.9786 2 2060.9804 -0.0018 1 60.03 2.40E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4346.4346.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3951 3496 1 1 1 1031.4966 2060.9786 2 2060.9804 -0.0018 1 62.72 1.30E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4855.4855.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3952 4075 1 1 1 1031.4967 2060.9789 2 2060.9804 -0.0015 1 68.28 4.00E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5466.5466.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3953 4776 1 1 1 688.0002 2060.9789 3 2060.9804 -0.0015 1 52.14 2.10E-05 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6245.6245.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3954 4328 1 1 1 688.0003 2060.9791 3 2060.9804 -0.0013 1 68.5 6.80E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5734.5734.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3955 3933 1 1 1 1031.4968 2060.9791 2 2060.9804 -0.0013 1 49.95 2.10E-05 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5316.5316.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3956 4574 1 1 1 1031.4968 2060.9791 2 2060.9804 -0.0013 1 63.92 1.00E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6007.6007.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3957 4883 1 1 1 688.0004 2060.9793 3 2060.9804 -0.0011 1 58.12 8.50E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6366.6366.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3958 2679 1 1 1 1031.4969 2060.9793 2 2060.9804 -0.001 1 73.02 1.40E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3996.3996.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3959 4338 1 1 1 1031.4969 2060.9793 2 2060.9804 -0.001 1 75.76 7.90E-08 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5745.5745.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3960 4451 1 1 1 1031.4969 2060.9793 2 2060.9804 -0.001 1 71.86 1.80E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5872.5872.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3961 3184 1 1 1 1031.4971 2060.9796 2 2060.9804 -0.0008 1 72.29 1.70E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4525.4525.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3962 4209 1 1 1 1031.4972 2060.9798 2 2060.9804 -0.0005 1 64.81 8.40E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5607.5607.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3963 4567 1 1 1 688.0006 2060.98 3 2060.9804 -0.0004 1 62.06 2.90E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5999.5999.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3964 4680 1 1 1 1031.4973 2060.9801 2 2060.9804 -0.0003 1 59.02 2.90E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6134.6134.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3966 3013 1 1 1 688.0007 2060.9804 3 2060.9804 0 1 74.96 1.70E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4345.4345.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3967 3650 1 1 1 1031.4976 2060.9806 2 2060.9804 0.0002 1 64.28 9.40E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5016.5016.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3968 3788 1 1 1 1031.4976 2060.9806 2 2060.9804 0.0002 1 64.36 9.20E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5165.5165.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3969 3174 1 1 1 688.001 2060.9813 3 2060.9804 0.0009 1 66.64 1.10E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4515.4515.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3970 2850 1 1 1 688.001 2060.9813 3 2060.9804 0.0009 1 54.06 2.10E-05 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4175.4175.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3971 3347 1 1 1 1031.4984 2060.9823 2 2060.9804 0.0019 1 69.54 3.00E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4696.4696.2.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3972 3489 1 1 1 688.0015 2060.9827 3 2060.9804 0.0024 1 62.23 3.50E-06 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4848.4848.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3973 2678 1 1 1 688.0019 2060.9838 3 2060.9804 0.0035 1 72.66 3.00E-07 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3995.3995.3.dta 1 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 2762 13403 77 77 4 4 3974 3337 1 1 1 688.0019 2060.9838 3 2060.9804 0.0035 1 48.72 5.10E-05 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4685.4685.3.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2153 2130 1 0 1 652.3109 1302.6073 2 1302.6092 -0.0019 0 53.49 9.60E-06 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3385.3385.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2154 5044 1 0 1 652.3112 1302.6079 2 1302.6092 -0.0013 0 50.37 6.00E-05 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6611.6611.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2155 4992 1 0 1 652.3112 1302.6079 2 1302.6092 -0.0013 0 65.51 1.80E-06 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6519.6519.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2156 4961 1 0 1 652.3115 1302.6084 2 1302.6092 -0.0008 0 66.22 1.60E-06 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6457.6457.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2157 4287 1 0 1 652.3115 1302.6085 2 1302.6092 -0.0007 0 73.84 2.70E-07 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5690.5690.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2158 4524 1 0 1 652.3115 1302.6085 2 1302.6092 -0.0007 0 89.18 7.90E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5953.5953.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2159 4405 1 0 1 652.3116 1302.6086 2 1302.6092 -0.0006 0 84.75 2.20E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5822.5822.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2160 4158 1 0 1 652.3118 1302.6091 2 1302.6092 -0.0001 0 82.54 3.60E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5552.5552.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2161 2291 1 0 1 652.3119 1302.6092 2 1302.6092 0 0 85.69 1.80E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3565.3565.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2162 4026 1 0 1 652.3119 1302.6093 2 1302.6092 0.0001 0 81.05 5.10E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5415.5415.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2163 3117 1 0 1 652.312 1302.6095 2 1302.6092 0.0003 0 89.48 7.30E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4455.4455.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2164 4636 1 0 1 652.312 1302.6095 2 1302.6092 0.0003 0 91.29 4.80E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6082.6082.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2165 3743 1 0 1 652.3121 1302.6096 2 1302.6092 0.0004 0 97.09 1.30E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5115.5115.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2166 3438 1 0 1 652.3121 1302.6096 2 1302.6092 0.0004 0 92.73 3.50E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4795.4795.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2167 4848 1 0 1 652.3123 1302.61 2 1302.6092 0.0007 0 81.59 4.50E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6328.6328.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2168 2784 1 0 1 652.3124 1302.6102 2 1302.6092 0.001 0 87.82 1.10E-08 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4105.4105.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 2169 2956 1 0 1 652.3124 1302.6103 2 1302.6092 0.0011 0 88.87 8.40E-09 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4285.4285.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 3244 2354 1 0 1 830.4189 1658.8232 2 1658.8264 -0.0032 1 102.46 4.40E-10 R FSGSGSGTDFTLKISR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3635.3635.2.dta 1 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 1121 13062 19 19 2 2 3245 2348 1 0 1 553.9487 1658.8244 3 1658.8264 -0.0021 1 25.4 0.0066 R FSGSGSGTDFTLKISR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3628.3628.3.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 64 2821 1 0 1 325.2175 648.4204 2 648.421 -0.0006 0 38.87 0.00013 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4145.4145.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 65 2651 1 0 1 325.2175 648.4205 2 648.421 -0.0005 0 38.87 0.00013 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3965.3965.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 66 3608 1 0 1 325.2175 648.4205 2 648.421 -0.0005 0 38.89 0.00013 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4975.4975.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 68 2984 1 0 1 325.2176 648.4207 2 648.421 -0.0003 0 35.1 0.00031 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4315.4315.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 69 4414 1 0 1 325.2177 648.4208 2 648.421 -0.0003 0 22.74 0.0053 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5832.5832.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 70 4168 1 0 1 325.2177 648.4208 2 648.421 -0.0002 0 27.51 0.0018 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5562.5562.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 71 4752 1 0 1 325.2177 648.4208 2 648.421 -0.0002 0 19.83 0.01 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6215.6215.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 72 5304 1 0 1 325.2177 648.4209 2 648.421 -0.0001 0 34.94 0.00032 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.7041.7041.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 73 4855 1 0 1 325.2177 648.4209 2 648.421 -0.0001 0 19.95 0.01 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6335.6335.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 74 4534 1 0 1 325.2178 648.421 2 648.421 0 0 22.38 0.0058 R LLIYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5963.5963.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 310 2428 1 0 1 389.1978 776.381 2 776.3817 -0.0008 0 26.36 0.029 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3717.3717.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 311 3250 1 0 1 389.1978 776.3811 2 776.3817 -0.0006 0 25.97 0.031 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4595.4595.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 312 2590 1 0 1 389.1978 776.3811 2 776.3817 -0.0006 0 29.49 0.014 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3899.3899.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 313 2263 1 0 1 389.1979 776.3812 2 776.3817 -0.0005 0 27.91 0.02 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3535.3535.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 314 3090 1 0 1 389.1979 776.3812 2 776.3817 -0.0005 0 28.37 0.018 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4425.4425.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 315 3410 1 0 1 389.1979 776.3813 2 776.3817 -0.0004 0 27.57 0.022 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4765.4765.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 316 1611 1 0 1 389.1979 776.3813 2 776.3817 -0.0004 0 36.71 0.0027 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2810.2810.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 317 3561 1 0 1 389.1979 776.3813 2 776.3817 -0.0004 0 25.25 0.038 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4925.4925.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 318 2927 1 0 1 389.198 776.3814 2 776.3817 -0.0003 0 26.06 0.032 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4255.4255.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 319 3854 1 0 1 389.198 776.3815 2 776.3817 -0.0002 0 29.82 0.013 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5235.5235.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 321 4385 1 0 1 389.1981 776.3816 2 776.3817 -0.0002 0 27.76 0.021 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5796.5796.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 322 4500 1 0 1 389.1981 776.3816 2 776.3817 -0.0002 0 27.59 0.022 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5925.5925.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 323 2755 1 0 1 389.1981 776.3816 2 776.3817 -0.0001 0 27.97 0.016 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4076.4076.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 324 3998 1 0 1 389.1981 776.3816 2 776.3817 -0.0001 0 24.16 0.039 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5386.5386.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 325 4261 1 0 1 389.1981 776.3817 2 776.3817 0 0 24.1 0.039 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5663.5663.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 326 2103 1 0 1 389.1982 776.3818 2 776.3817 0.0001 0 28.06 0.016 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3355.3355.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 327 4615 1 0 1 389.1982 776.3818 2 776.3817 0.0001 0 29.81 0.011 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6056.6056.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 328 3715 1 0 1 389.1982 776.3819 2 776.3817 0.0002 0 29.79 0.011 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5086.5086.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 329 1781 1 0 1 389.1982 776.3819 2 776.3817 0.0002 0 41.46 0.00073 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2999.2999.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 330 4132 1 0 1 389.1982 776.3819 2 776.3817 0.0002 0 23.9 0.041 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5525.5525.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 331 4723 1 0 1 389.1982 776.3819 2 776.3817 0.0002 0 23.79 0.042 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6184.6184.2.dta 1 KV224_HUMAN Immunoglobulin kappa variable 2-24 OS=Homo sapiens GN=IGKV2-24 PE=3 SV=1 299 13185 32 32 2 2 332 1939 1 0 1 389.1987 776.3828 2 776.3817 0.0011 0 29.57 0.011 R FSGVPDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3175.3175.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 208 1211 1 1 1 360.2004 718.3862 2 718.3861 0.0001 0 43.73 0.00055 R GSDSLIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2369.2369.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 293 2500 1 1 1 384.2135 766.4125 2 766.4126 -0.0001 0 32.13 0.0033 R AIFFNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3797.3797.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 683 221 1 1 1 445.7391 889.4637 2 889.4617 0.002 0 36.34 0.00062 K TIATSQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1244.1244.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 717 2669 1 1 1 450.2868 898.5591 2 898.56 -0.0009 0 33.96 0.0015 R AQVSLLIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3985.3985.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 990 882 1 1 1 491.2478 980.4811 2 980.4814 -0.0004 0 51.93 2.00E-05 R EYTAAVEAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2002.2002.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 1091 1968 1 1 1 497.7455 993.4764 2 993.4767 -0.0003 0 53.65 2.70E-05 R LGLDYEER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3205.3205.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 1359 110 1 1 1 529.2723 1056.5301 2 1056.5312 -0.0011 0 57.95 1.10E-05 K QVAQQEAQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1122.1122.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 1573 1613 1 1 1 561.8222 1121.6299 2 1121.6305 -0.0007 1 32.47 0.0028 K DLAGRLPAGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2812.2812.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 1753 2487 1 1 1 589.3196 1176.6247 2 1176.6251 -0.0004 0 60.49 8.30E-06 K FNASQLITQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3782.3782.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 1770 3142 1 1 1 594.8233 1187.6321 2 1187.6332 -0.0012 0 57.43 1.60E-05 K DLQMVNISLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4481.4481.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 1807 2528 1 1 1 602.8208 1203.627 2 1203.6281 -0.0011 0 54.98 3.00E-05 K DLQMVNISLR V Oxidation (M) 0.0001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3829.3829.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 1822 3565 1 1 1 605.8732 1209.7318 2 1209.7333 -0.0015 0 26.6 0.0023 R VLPSIVNEVLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4929.4929.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 1840 735 1 1 1 608.3138 1214.6131 2 1214.6142 -0.0011 0 71.16 4.90E-07 K IVQAEGEAEAAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1837.1837.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 1846 1667 1 1 1 609.2978 1216.581 2 1216.5837 -0.0026 0 58.14 9.00E-06 R ESVFTVEGGHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2872.2872.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 2014 3070 1 1 1 630.377 1258.7395 2 1258.7397 -0.0003 0 96.85 5.40E-10 K LLLGAGAVAYGVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4405.4405.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 2682 766 1 1 1 736.3898 1470.7651 2 1470.7678 -0.0027 1 49.02 4.20E-05 R QKIVQAEGEAEAAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1871.1871.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 2818 1812 1 1 1 512.9407 1535.8004 3 1535.8017 -0.0014 1 22.5 0.039 K MLGEALSKNPGYIK L Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3033.3033.3.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 2819 1802 1 1 1 768.9077 1535.8009 2 1535.8017 -0.0009 1 69.05 7.70E-07 K MLGEALSKNPGYIK L Oxidation (M) 0.10000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3022.3022.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 3520 3241 1 1 1 927.4959 1852.9773 2 1852.9796 -0.0023 0 103.02 2.30E-10 R IGGVQQDTILAEGLHFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4586.4586.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 3521 3231 1 1 1 618.6665 1852.9777 3 1852.9796 -0.0019 0 71.42 3.40E-07 R IGGVQQDTILAEGLHFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4576.4576.3.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 3601 1518 1 1 1 952.9841 1903.9536 2 1903.9574 -0.0038 0 33.83 0.0019 R VLSRPNAQELPSMYQR L Oxidation (M) 0.0000000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2709.2709.2.dta 2 1 PHB2_HUMAN Prohibitin-2 OS=Homo sapiens GN=PHB2 PE=1 SV=2 790 33276 22 22 19 19 4600 4030 1 1 1 1113.0736 2224.1327 2 2224.1375 -0.0049 0 80.79 2.70E-08 R IYLTADNLVLNLQDESFTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5419.5419.2.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 369 104 1 1 1 399.1805 796.3465 2 796.3464 0.0001 0 40.3 0.00037 R GGSGGSYGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1115.1115.2.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 1004 143 1 1 1 491.7191 981.4236 2 981.4265 -0.0029 0 63.36 1.30E-06 R FSSSGGGGGGGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1158.1158.2.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 1388 1067 1 1 1 533.2527 1064.4908 2 1064.492 -0.0012 0 46.9 0.00013 K STMQELNSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2207.2207.2.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 1400 1833 1 1 1 537.7631 1073.5117 2 1073.5142 -0.0025 0 31.75 0.0038 R QFSSSYLSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3057.3057.2.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 1886 1008 1 1 1 616.8017 1231.5888 2 1231.5906 -0.0017 0 109.27 8.50E-11 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2142.2142.2.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 1955 660 1 1 1 618.2672 1234.5199 2 1234.5215 -0.0016 0 84.37 6.20E-09 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1753.1753.2.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 3444 494 1 1 1 896.3683 1790.722 2 1790.7205 0.0015 0 136.38 2.30E-14 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1569.1569.2.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 3543 2241 1 1 1 934.4636 1866.9126 2 1866.9145 -0.0019 1 28.01 0.0044 K TLNDMRQEYEQLIAK N Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3510.3510.2.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 3544 2237 1 1 1 623.3118 1866.9137 3 1866.9145 -0.0009 1 19.37 0.04 K TLNDMRQEYEQLIAK N Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3506.3506.3.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 4529 982 1 1 1 733.6512 2197.9319 3 2197.9373 -0.0054 1 49.55 1.10E-05 R FSSSGGGGGGGRFSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2113.2113.3.dta 3 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 578 62255 11 11 10 10 5368 1060 1 1 1 1075.095 3222.2631 3 3222.2744 -0.0113 0 137.76 1.70E-14 R GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2199.2199.3.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 211 1888 1 1 1 360.7053 719.396 2 719.3966 -0.0006 0 20.24 0.048 R AVIFDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3118.3118.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 1216 2437 1 1 1 512.2902 1022.5659 2 1022.5661 -0.0003 1 28.74 0.0036 R AVIFDRFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3727.3727.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 1674 2580 1 1 1 575.2981 1148.5816 2 1148.5826 -0.0009 0 63.03 4.30E-06 R FDAGELITQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3888.3888.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 1766 2506 1 1 1 593.3326 1184.6507 2 1184.6513 -0.0006 0 57.81 1.80E-05 K DLQNVNITLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3805.3805.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 1812 842 1 1 1 603.3295 1204.6445 2 1204.6452 -0.0007 1 48.83 0.00011 R FVVEKAEQQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1958.1958.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 1833 3304 1 1 1 607.3737 1212.7329 2 1212.7329 0 0 43.43 7.70E-05 R VLPSITTEILK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4650.4650.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 2102 276 1 1 1 643.3333 1284.652 2 1284.6534 -0.0015 1 31.17 0.0046 K QVAQQEAERAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1304.1304.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 2508 2544 1 1 1 466.2852 1395.8338 3 1395.835 -0.0012 0 41.61 8.60E-05 R ILFRPVASQLPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3847.3847.3.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 2639 2404 1 1 1 722.8324 1443.6502 2 1443.6518 -0.0015 0 56.14 8.30E-06 R IFTSIGEDYDER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3690.3690.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 3059 2812 1 1 1 536.285 1605.8331 3 1605.8362 -0.0031 1 38.01 0.0012 R KLEAAEDIAYQLSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4135.4135.3.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 3060 2804 1 1 1 803.9239 1605.8332 2 1605.8362 -0.003 1 109.21 9.00E-11 R KLEAAEDIAYQLSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4126.4126.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 3523 3970 1 1 1 928.0193 1854.0241 2 1854.0251 -0.0009 0 53.39 1.30E-05 R NITYLPAGQSVLLQLPQ - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5355.5355.2.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 3817 3988 1 1 1 666.6998 1997.0775 3 1997.0793 -0.0018 0 63.83 1.50E-06 K AAELIANSLATAGDGLIELR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5375.5375.3.dta 4 1 PHB_HUMAN Prohibitin OS=Homo sapiens GN=PHB PE=1 SV=1 521 29843 14 14 12 12 3818 3980 1 1 1 999.5462 1997.0779 2 1997.0793 -0.0014 0 111.59 2.50E-11 K AAELIANSLATAGDGLIELR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5366.5366.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 43 816 1 1 0 319.2105 636.4065 2 636.4071 -0.0006 0 19.67 0.013 R HVLLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1929.1929.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 197 1960 1 1 1 357.7288 713.443 2 713.4436 -0.0006 0 40.13 0.00058 R QGVLGIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3196.3196.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 377 2445 1 1 1 399.7631 797.5116 2 797.5123 -0.0007 0 49.71 1.60E-05 K LLGGLAVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3736.3736.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 502 1688 1 1 1 419.7155 837.4164 2 837.4167 -0.0003 0 27.84 0.0086 R ACYGVLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2895.2895.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 675 1034 1 1 1 444.7431 887.4716 2 887.4712 0.0004 0 35.91 0.0027 R TQNVLGEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2171.2171.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 690 2852 1 1 1 448.747 895.4795 2 895.4804 -0.0008 0 23.85 0.025 K FVADGIFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4177.4177.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 859 802 1 1 1 467.7365 933.4585 2 933.459 -0.0005 0 45.58 5.30E-05 K GCEVVVSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1912.1912.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 1093 1241 1 1 1 497.7669 993.5192 2 993.5178 0.0014 1 27.09 0.016 R RACYGVLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2402.2402.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 1218 2425 1 1 1 512.7945 1023.5744 2 1023.5753 -0.0009 1 25.1 0.013 R KFVADGIFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3713.3713.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 1244 2905 1 1 1 515.3185 1028.6225 2 1028.623 -0.0004 0 65.48 6.70E-07 R TEIIILATR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4231.4231.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 1284 1007 1 1 1 522.3135 1042.6124 2 1042.6135 -0.0011 1 38.79 0.001 R ELTAVVQKR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2141.2141.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 1474 2756 1 1 1 546.7875 1091.5604 2 1091.5611 -0.0007 0 50.91 7.40E-05 K AELNEFLTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4077.4077.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 1697 1510 1 1 1 578.8553 1155.6961 2 1155.6975 -0.0014 1 43.38 0.00015 R IRELTAVVQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2700.2700.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 1698 1511 1 1 1 386.2399 1155.6979 3 1155.6975 0.0003 1 36 0.00057 R IRELTAVVQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2701.2701.3.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 1744 3344 1 1 1 587.302 1172.5895 2 1172.59 -0.0005 0 24.45 0.03 K IMLPWDPTGK I Oxidation (M) 0.0100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4692.4692.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 2110 2542 1 1 1 644.8388 1287.6631 2 1287.6605 0.0026 0 58.63 1.20E-05 R GLCAIAQAESLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3845.3845.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 2581 1797 1 1 1 712.3381 1422.6616 2 1422.6627 -0.0011 0 60.7 4.10E-06 R ELAEDGYSGVEVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3016.3016.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 2679 2356 1 1 1 735.8866 1469.7586 2 1469.7613 -0.0027 0 65.17 2.20E-06 K DEILPTTPISEQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3637.3637.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 2959 2729 1 1 1 792.4769 1582.9393 2 1582.9406 -0.0013 1 38.76 0.00013 R VTPTRTEIIILATR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4049.4049.2.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 2960 2726 1 1 1 528.6541 1582.9403 3 1582.9406 -0.0003 1 32.5 0.00056 R VTPTRTEIIILATR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4046.4046.3.dta 5 1 RS3_HUMAN 40S ribosomal protein S3 OS=Homo sapiens GN=RPS3 PE=1 SV=2 479 26842 21 21 19 19 2973 1248 1 1 1 795.4045 1588.7944 2 1588.7919 0.0025 0 34.84 0.00057 K GGKPEPPAMPQPVPTA - Oxidation (M) 0.0000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2410.2410.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 1526 1327 1 1 1 554.8257 1107.6368 2 1107.64 -0.0032 1 23.7 0.018 R RLPPQQIEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2497.2497.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 1741 2727 1 1 1 586.303 1170.5915 2 1170.5921 -0.0005 0 54.49 2.40E-05 R STLNEIYFGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4047.4047.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 1882 2502 1 1 1 616.2739 1230.5333 2 1230.5339 -0.0006 0 42.31 0.00012 K DYLLCDYNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3799.3799.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 1982 1543 1 1 1 623.8254 1245.6363 2 1245.6387 -0.0024 1 48.15 0.00016 R LVEDMENKIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2736.2736.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 2015 808 1 1 1 631.8242 1261.6339 2 1261.6336 0.0003 1 40.17 0.00036 R LVEDMENKIR S Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1919.1919.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 2286 2015 1 1 1 669.3261 1336.6377 2 1336.6405 -0.0028 0 100.44 5.90E-10 K SGSGTMNLGGSLTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3257.3257.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 2904 2384 1 1 1 784.87 1567.7254 2 1567.7267 -0.0012 0 71.42 3.40E-07 K LEVEANNAFDQYR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3668.3668.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 3320 2454 1 1 1 843.4 1684.7855 2 1684.7879 -0.0024 0 51.33 1.70E-05 K GCWDSIHVVEVQEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3746.3746.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 3321 2448 1 1 1 562.6025 1684.7856 3 1684.7879 -0.0023 0 23.81 0.0098 K GCWDSIHVVEVQEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3739.3739.3.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 3335 2097 1 1 1 848.9152 1695.8158 2 1695.8216 -0.0058 1 96.6 8.90E-10 R KLEVEANNAFDQYR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3348.3348.2.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 3336 2114 1 1 1 566.2808 1695.8205 3 1695.8216 -0.0012 1 32.82 0.0039 R KLEVEANNAFDQYR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3367.3367.3.dta 6 1 CAPZB_HUMAN F-actin-capping protein subunit beta OS=Homo sapiens GN=CAPZB PE=1 SV=4 448 31616 12 12 9 9 4859 1453 1 1 1 768.3499 2302.0279 3 2302.0318 -0.0039 1 69.81 3.10E-07 R QMEKDETVSDCSPHIANIGR L Oxidation (M) 0.01000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2636.2636.3.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 101 1575 1 1 0 336.2439 670.4732 2 670.4741 -0.0009 1 27.28 0.0039 R IKLGLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2770.2770.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 255 699 1 1 0 373.7237 745.4328 2 745.4334 -0.0006 0 24.4 0.027 K GTLVQTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1797.1797.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 343 5376 1 1 1 392.7372 783.4599 2 783.4603 -0.0003 0 59.93 3.70E-06 K KPAAAAGAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.837.837.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 402 485 1 1 0 406.2004 810.3862 2 810.3872 -0.001 0 34.08 0.0017 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1559.1559.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 451 5420 1 1 0 416.2377 830.4609 2 830.461 -0.0001 1 66.39 2.60E-06 K AVAASKER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.897.897.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 547 5432 1 1 1 422.7479 843.4812 2 843.4814 -0.0002 1 51.76 7.70E-05 K KATGAATPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.910.910.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 974 1683 1 1 1 487.3056 972.5966 2 972.5968 -0.0002 1 63.21 9.10E-07 R SGVSLAALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2890.2890.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 1016 5382 1 1 1 492.3032 982.5918 2 982.5923 -0.0005 1 25.51 0.0053 K AKKPAAAAGAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.849.849.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 1024 5323 1 1 0 493.7846 985.5547 2 985.5556 -0.0009 1 53.3 4.00E-05 K KAASGEAKPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.724.724.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 1515 1552 1 1 1 554.2871 1106.5597 2 1106.5608 -0.0011 0 43.26 0.00033 K ALAAAGYDVEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2744.2744.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 1729 1111 1 1 0 583.8112 1165.6078 2 1165.6091 -0.0014 1 29.76 0.0048 K GTGASGSFKLNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2256.2256.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 1799 2342 1 1 1 599.8373 1197.66 2 1197.6605 -0.0005 0 52.47 3.70E-05 K ASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3621.3621.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 2238 1943 1 1 1 442.9261 1325.7564 3 1325.7554 0.001 1 36.8 0.00087 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3179.3179.3.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 2239 1925 1 1 1 663.8869 1325.7593 2 1325.7554 0.0038 1 62.42 2.00E-06 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3159.3159.2.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 2952 1213 1 1 1 526.9337 1577.7791 3 1577.7797 -0.0006 1 24.11 0.014 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2371.2371.3.dta 7 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 439 21852 16 16 14 14 2953 1215 1 1 1 789.897 1577.7794 2 1577.7797 -0.0003 1 70.73 2.30E-07 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2373.2373.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 101 1575 1 0 0 336.2439 670.4732 2 670.4741 -0.0009 1 27.28 0.0039 R IKLGLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2770.2770.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 255 699 1 0 0 373.7237 745.4328 2 745.4334 -0.0006 0 24.4 0.027 K GTLVQTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1797.1797.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 402 485 1 0 0 406.2004 810.3862 2 810.3872 -0.001 0 34.08 0.0017 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1559.1559.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 451 5420 1 0 0 416.2377 830.4609 2 830.461 -0.0001 1 66.39 2.60E-06 K AVAASKER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.897.897.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 948 5397 1 0 1 323.5341 967.5804 3 967.5814 -0.001 1 39.83 0.0002 K AKKPAGATPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.868.868.3.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 1024 5323 1 0 0 493.7846 985.5547 2 985.5556 -0.0009 1 53.3 4.00E-05 K KAASGEAKPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.724.724.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 1476 1449 1 0 1 547.2785 1092.5425 2 1092.5451 -0.0027 0 57.45 6.90E-06 K ALAAGGYDVEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2632.2632.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 1729 1111 1 0 0 583.8112 1165.6078 2 1165.6091 -0.0014 1 29.76 0.0048 K GTGASGSFKLNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2256.2256.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 1828 2375 1 0 1 606.8447 1211.6748 2 1211.6761 -0.0014 0 39.4 0.00049 K ATGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3658.3658.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 1861 1102 1 0 1 611.3253 1220.636 2 1220.6401 -0.0041 1 46.53 0.00011 K KALAAGGYDVEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2246.2246.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 2297 1996 1 0 1 447.5971 1339.7696 3 1339.7711 -0.0015 1 50.75 3.30E-05 R KATGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3236.3236.3.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 2899 1098 1 0 1 782.8862 1563.7578 2 1563.7641 -0.0063 1 80.15 4.30E-08 K ALAAGGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2242.2242.2.dta 7 2 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 344 22566 13 13 12 12 2900 1097 1 0 1 522.2626 1563.7659 3 1563.7641 0.0018 1 21.78 0.017 K ALAAGGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2241.2241.3.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 101 1575 1 0 0 336.2439 670.4732 2 670.4741 -0.0009 1 27.28 0.0039 R IKLGLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2770.2770.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 255 699 1 0 0 373.7237 745.4328 2 745.4334 -0.0006 0 24.4 0.027 K GTLVQTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1797.1797.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 402 485 1 0 0 406.2004 810.3862 2 810.3872 -0.001 0 34.08 0.0017 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1559.1559.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 451 5420 1 0 0 416.2377 830.4609 2 830.461 -0.0001 1 66.39 2.60E-06 K AVAASKER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.897.897.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 974 1683 1 0 1 487.3056 972.5966 2 972.5968 -0.0002 1 63.21 9.10E-07 R SGVSLAALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2890.2890.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 1024 5323 1 0 0 493.7846 985.5547 2 985.5556 -0.0009 1 53.3 4.00E-05 K KAASGEAKPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.724.724.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 1515 1552 1 0 1 554.2871 1106.5597 2 1106.5608 -0.0011 0 43.26 0.00033 K ALAAAGYDVEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2744.2744.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 1729 1111 1 0 0 583.8112 1165.6078 2 1165.6091 -0.0014 1 29.76 0.0048 K GTGASGSFKLNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2256.2256.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 1799 2342 1 0 1 599.8373 1197.66 2 1197.6605 -0.0005 0 52.47 3.70E-05 K ASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3621.3621.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 2238 1943 1 0 1 442.9261 1325.7564 3 1325.7554 0.001 1 36.8 0.00087 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3179.3179.3.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 2239 1925 1 0 1 663.8869 1325.7593 2 1325.7554 0.0038 1 62.42 2.00E-06 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3159.3159.2.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 2952 1213 1 0 1 526.9337 1577.7791 3 1577.7797 -0.0006 1 24.11 0.014 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2371.2371.3.dta 7 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 358 21352 13 13 11 11 2953 1215 1 0 1 789.897 1577.7794 2 1577.7797 -0.0003 1 70.73 2.30E-07 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2373.2373.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 101 1575 1 0 0 336.2439 670.4732 2 670.4741 -0.0009 1 27.28 0.0039 R IKLGLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2770.2770.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 255 699 1 0 0 373.7237 745.4328 2 745.4334 -0.0006 0 24.4 0.027 K GTLVQTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1797.1797.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 402 485 1 0 0 406.2004 810.3862 2 810.3872 -0.001 0 34.08 0.0017 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1559.1559.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 451 5420 1 0 0 416.2377 830.4609 2 830.461 -0.0001 1 66.39 2.60E-06 K AVAASKER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.897.897.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 974 1683 1 0 1 487.3056 972.5966 2 972.5968 -0.0002 1 63.21 9.10E-07 R SGVSLAALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2890.2890.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 1515 1552 1 0 1 554.2871 1106.5597 2 1106.5608 -0.0011 0 43.26 0.00033 K ALAAAGYDVEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2744.2744.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 1729 1111 1 0 0 583.8112 1165.6078 2 1165.6091 -0.0014 1 29.76 0.0048 K GTGASGSFKLNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2256.2256.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 1799 2342 1 0 1 599.8373 1197.66 2 1197.6605 -0.0005 0 52.47 3.70E-05 K ASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3621.3621.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 2238 1943 1 0 1 442.9261 1325.7564 3 1325.7554 0.001 1 36.8 0.00087 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3179.3179.3.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 2239 1925 1 0 1 663.8869 1325.7593 2 1325.7554 0.0038 1 62.42 2.00E-06 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3159.3159.2.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 2952 1213 1 0 1 526.9337 1577.7791 3 1577.7797 -0.0006 1 24.11 0.014 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2371.2371.3.dta 7 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 327 22336 12 12 10 10 2953 1215 1 0 1 789.897 1577.7794 2 1577.7797 -0.0003 1 70.73 2.30E-07 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2373.2373.2.dta 7 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 141 21829 7 7 6 6 101 1575 1 0 1 336.2439 670.4732 2 670.4741 -0.0009 1 27.28 0.0039 R IKLGIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2770.2770.2.dta 7 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 141 21829 7 7 6 6 255 699 1 0 0 373.7237 745.4328 2 745.4334 -0.0006 0 24.4 0.027 K GTLVQTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1797.1797.2.dta 7 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 141 21829 7 7 6 6 402 485 1 0 0 406.2004 810.3862 2 810.3872 -0.001 0 34.08 0.0017 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1559.1559.2.dta 7 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 141 21829 7 7 6 6 1515 1552 1 0 1 554.2871 1106.5597 2 1106.5608 -0.0011 0 43.26 0.00033 K ALAAAGYDVEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2744.2744.2.dta 7 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 141 21829 7 7 6 6 1729 1111 1 0 0 583.8112 1165.6078 2 1165.6091 -0.0014 1 29.76 0.0048 K GTGASGSFKLNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2256.2256.2.dta 7 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 141 21829 7 7 6 6 2952 1213 1 0 1 526.9337 1577.7791 3 1577.7797 -0.0006 1 24.11 0.014 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2371.2371.3.dta 7 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 141 21829 7 7 6 6 2953 1215 1 0 1 789.897 1577.7794 2 1577.7797 -0.0003 1 70.73 2.30E-07 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2373.2373.2.dta 7 H1T_HUMAN Histone H1t OS=Homo sapiens GN=HIST1H1T PE=2 SV=4 116 22006 4 4 3 3 402 485 1 0 0 406.2004 810.3862 2 810.3872 -0.001 0 34.08 0.0017 R GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1559.1559.2.dta 7 H1T_HUMAN Histone H1t OS=Homo sapiens GN=HIST1H1T PE=2 SV=4 116 22006 4 4 3 3 1515 1552 1 0 1 554.2871 1106.5597 2 1106.5608 -0.0011 0 43.26 0.00033 K ALAAAGYDVEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2744.2744.2.dta 7 H1T_HUMAN Histone H1t OS=Homo sapiens GN=HIST1H1T PE=2 SV=4 116 22006 4 4 3 3 2952 1213 1 0 1 526.9337 1577.7791 3 1577.7797 -0.0006 1 24.11 0.014 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2371.2371.3.dta 7 H1T_HUMAN Histone H1t OS=Homo sapiens GN=HIST1H1T PE=2 SV=4 116 22006 4 4 3 3 2953 1215 1 0 1 789.897 1577.7794 2 1577.7797 -0.0003 1 70.73 2.30E-07 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2373.2373.2.dta 8 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 383 283140 9 9 8 8 265 28 1 1 1 377.7011 753.3877 2 753.3882 -0.0005 0 41.03 0.00033 R QSLGHGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1031.1031.2.dta 8 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 383 283140 9 9 8 8 1585 265 1 1 1 563.267 1124.5194 2 1124.521 -0.0016 1 35 0.0017 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1292.1292.2.dta 8 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 383 283140 9 9 8 8 1966 5478 1 1 1 620.7861 1239.5576 2 1239.5592 -0.0016 0 45.71 8.30E-05 R HGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.960.960.2.dta 8 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 383 283140 9 9 8 8 2292 5381 1 1 1 670.3085 1338.6024 2 1338.6025 -0.0001 0 75.65 1.20E-07 R QGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.848.848.2.dta 8 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 383 283140 9 9 8 8 2342 5364 1 1 1 674.8081 1347.6017 2 1347.6028 -0.0012 0 59.07 4.10E-06 R HGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.801.801.2.dta 8 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 383 283140 9 9 8 8 2343 5362 1 1 1 450.2079 1347.6018 3 1347.6028 -0.001 0 39.84 0.00035 R HGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.799.799.3.dta 8 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 383 283140 9 9 8 8 2961 424 1 1 1 792.8614 1583.7083 2 1583.7077 0.0007 0 88.03 7.10E-09 R GPYESGSGHSSGLGHR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1491.1491.2.dta 8 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 383 283140 9 9 8 8 3476 5477 1 1 1 603.5892 1807.7457 3 1807.747 -0.0013 0 71.82 1.40E-07 R HGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.959.959.3.dta 8 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 383 283140 9 9 8 8 4179 0 1 1 1 708.2968 2121.8684 3 2121.8696 -0.0012 0 67.81 1.70E-07 R GEQHGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1000.1000.3.dta 9 1 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 378 65678 8 8 8 8 334 602 1 1 1 390.1931 778.3716 2 778.3722 -0.0006 0 43.41 0.0003 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1689.1689.2.dta 9 1 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 378 65678 8 8 8 8 1265 2080 1 1 1 519.2659 1036.5173 2 1036.5189 -0.0016 0 26.9 0.015 R YLDGLTAER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3329.3329.2.dta 9 1 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 378 65678 8 8 8 8 1514 1159 1 1 1 554.2745 1106.5344 2 1106.5356 -0.0012 0 33.34 0.0019 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2311.2311.2.dta 9 1 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 378 65678 8 8 8 8 1795 594 1 1 1 599.2774 1196.5403 2 1196.5422 -0.002 0 78.31 6.50E-08 K GGSISGGGYGSGGGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1680.1680.2.dta 9 1 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 378 65678 8 8 8 8 1993 1259 1 1 1 627.807 1253.5995 2 1253.6001 -0.0006 0 84.71 2.30E-08 R GFSSGSAVVSGGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2422.2422.2.dta 9 1 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 378 65678 8 8 8 8 2224 1376 1 1 1 660.7947 1319.5748 2 1319.5756 -0.0008 0 72.36 1.30E-07 R HGGGGGGFGGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2551.2551.2.dta 9 1 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 378 65678 8 8 8 8 2269 3940 1 1 1 665.3665 1328.7184 2 1328.7187 -0.0004 0 70.35 6.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5323.5323.2.dta 9 1 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 378 65678 8 8 8 8 3405 530 1 1 1 870.8555 1739.6964 2 1739.6983 -0.0019 0 100.93 8.10E-11 R GSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1609.1609.2.dta 9 2 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 294 66170 6 6 6 6 1389 1043 1 0 1 533.2637 1064.5128 2 1064.5138 -0.001 0 36.9 0.0014 K AQYEDIAQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2181.2181.2.dta 9 2 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 294 66170 6 6 6 6 1473 251 1 0 1 546.7538 1091.4931 2 1091.4956 -0.0025 0 73.14 2.40E-07 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1278.1278.2.dta 9 2 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 294 66170 6 6 6 6 1759 2059 1 0 1 590.3032 1178.5918 2 1178.5931 -0.0014 0 66.53 1.70E-06 K YEELQITAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3306.3306.2.dta 9 2 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 294 66170 6 6 6 6 2464 3209 1 0 1 692.3461 1382.6777 2 1382.683 -0.0053 0 42.83 0.00027 K SLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4552.4552.2.dta 9 2 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 294 66170 6 6 6 6 3243 2223 1 0 1 829.3994 1656.7843 2 1656.7856 -0.0013 0 67.35 4.80E-07 R SGGGFSSGSAGIINYQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3490.3490.2.dta 9 2 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 294 66170 6 6 6 6 3416 2014 1 0 1 883.3694 1764.7243 2 1764.7275 -0.0032 0 99.97 1.00E-10 R FSSCGGGGGSFGAGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3256.3256.2.dta 9 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 130 60315 3 3 3 3 1514 1159 1 0 1 554.2745 1106.5344 2 1106.5356 -0.0012 0 33.34 0.0019 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2311.2311.2.dta 9 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 130 60315 3 3 3 3 1759 2059 1 0 1 590.3032 1178.5918 2 1178.5931 -0.0014 0 66.53 1.70E-06 K YEELQITAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3306.3306.2.dta 9 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 130 60315 3 3 3 3 2269 3940 1 0 1 665.3665 1328.7184 2 1328.7187 -0.0004 0 70.35 6.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5323.5323.2.dta 9 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 84 60293 2 2 2 2 1514 1159 1 0 1 554.2745 1106.5344 2 1106.5356 -0.0012 0 33.34 0.0019 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2311.2311.2.dta 9 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 84 60293 2 2 2 2 2269 3940 1 0 1 665.3665 1328.7184 2 1328.7187 -0.0004 0 70.35 6.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5323.5323.2.dta 9 K2C5_HUMAN "Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3" 70 62568 1 1 1 1 2269 3940 1 0 1 665.3665 1328.7184 2 1328.7187 -0.0004 0 70.35 6.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5323.5323.2.dta 9 K22O_HUMAN "Keratin, type II cytoskeletal 2 oral OS=Homo sapiens GN=KRT76 PE=1 SV=2" 33 66370 1 1 1 1 1514 1159 1 0 1 554.2745 1106.5344 2 1106.5356 -0.0012 0 33.34 0.0019 R AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2311.2311.2.dta 10 1 STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 358 31882 9 9 8 8 450 751 1 1 1 415.7525 829.4904 2 829.4909 -0.0005 1 27.41 0.013 R VEIKDVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1854.1854.2.dta 10 1 STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 358 31882 9 9 8 8 568 1742 1 1 1 427.2657 852.5169 2 852.5181 -0.0012 0 32.74 0.001 K LPVQLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2954.2954.2.dta 10 1 STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 358 31882 9 9 8 8 773 1738 1 1 1 458.2843 914.554 2 914.5549 -0.0009 0 39.91 0.00051 R LLAQTTLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2950.2950.2.dta 10 1 STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 358 31882 9 9 8 8 1986 1252 1 1 1 624.3073 1246.6001 2 1246.5975 0.0025 0 55.13 6.80E-06 K VIAAEGEMNASR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2414.2414.2.dta 10 1 STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 358 31882 9 9 8 8 2018 620 1 1 1 632.3027 1262.5909 2 1262.5925 -0.0016 0 68.35 9.40E-07 K VIAAEGEMNASR A Oxidation (M) 0.000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1709.1709.2.dta 10 1 STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 358 31882 9 9 8 8 2354 2606 1 1 1 676.3798 1350.7451 2 1350.7395 0.0056 0 65.43 1.50E-06 R YLQTLTTIAAEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3917.3917.2.dta 10 1 STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 358 31882 9 9 8 8 2672 551 1 1 1 731.8674 1461.7202 2 1461.7245 -0.0043 1 68.48 3.80E-07 R AKVIAAEGEMNASR A Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1632.1632.2.dta 10 1 STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 358 31882 9 9 8 8 3029 3427 1 1 1 801.4424 1600.8702 2 1600.8712 -0.001 0 58.52 6.00E-06 R TISFDIPPQEILTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4783.4783.2.dta 10 1 STOM_HUMAN Erythrocyte band 7 integral membrane protein OS=Homo sapiens GN=STOM PE=1 SV=3 358 31882 9 9 8 8 3677 2429 1 1 1 965.5016 1928.9886 2 1928.9915 -0.0029 0 90.64 3.20E-09 R VQNATLAVANITNADSATR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3718.3718.2.dta 10 STML3_HUMAN Stomatin-like protein 3 OS=Homo sapiens GN=STOML3 PE=2 SV=1 33 32343 1 1 1 1 568 1742 1 0 1 427.2657 852.5169 2 852.5181 -0.0012 0 32.74 0.001 R IPVQLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2954.2954.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 774 2076 1 1 0 458.7712 915.5278 2 915.529 -0.0012 1 28.93 0.0071 R LRVEFPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3325.3325.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 775 2060 1 1 0 306.1835 915.5287 3 915.529 -0.0003 1 23.27 0.026 R LRVEFPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3307.3307.3.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 1095 1109 1 1 1 498.2254 994.4362 2 994.4356 0.0006 0 33.07 0.002 R DAEDAVYGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2254.2254.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 1236 2947 1 1 1 514.7509 1027.4872 2 1027.4862 0.0009 0 41.19 0.00029 K DIEDVFYK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4276.4276.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 1411 2490 1 1 1 539.7797 1077.5448 2 1077.5455 -0.0007 0 60.95 7.40E-06 R DGTGVVEFVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3786.3786.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 1575 1540 1 1 1 562.2191 1122.4236 2 1122.4254 -0.0019 0 40.92 8.10E-05 R DGYDYDGYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2733.2733.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 1594 612 1 1 1 564.7703 1127.5261 2 1127.5281 -0.002 1 34.33 0.0017 R KEDMTYAVR K Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1700.1700.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 1707 917 1 1 1 581.7772 1161.5398 2 1161.5414 -0.0017 0 44.38 6.90E-05 R SHEGETAYIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2041.2041.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 1708 920 1 1 1 388.1873 1161.5402 3 1161.5414 -0.0012 0 29.47 0.0065 R SHEGETAYIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2044.2044.3.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 2006 2591 1 1 1 628.8535 1255.6925 2 1255.6925 0 0 55.96 1.80E-05 R IYVGNLPPDIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3900.3900.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 2011 2345 1 1 1 629.322 1256.6294 2 1256.6289 0.0005 1 49.9 3.10E-05 R TKDIEDVFYK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3625.3625.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 2491 2011 1 1 1 696.8115 1391.6085 2 1391.6106 -0.0021 1 26.57 0.0057 R DGYDYDGYRLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3252.3252.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 2558 1937 1 1 1 709.3076 1416.6007 2 1416.598 0.0027 0 51.47 1.10E-05 R EAGDVCYADVYR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3172.3172.2.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 3371 3422 1 1 1 574.2854 1719.8344 3 1719.8369 -0.0025 1 30.72 0.0025 R RGGPPFAFVEFEDPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4778.4778.3.dta 11 1 SRSF1_HUMAN Serine/arginine-rich splicing factor 1 OS=Homo sapiens GN=SRSF1 PE=1 SV=2 332 27842 15 15 13 13 4990 3759 1 1 1 847.7275 2540.1606 3 2540.1608 -0.0002 1 33.27 0.0015 R GGPPFAFVEFEDPRDAEDAVYGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5132.5132.3.dta 11 2 SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens GN=SRSF9 PE=1 SV=1 105 25640 4 4 3 3 774 2076 1 0 0 458.7712 915.5278 2 915.529 -0.0012 1 28.93 0.0071 R LRVEFPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3325.3325.2.dta 11 2 SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens GN=SRSF9 PE=1 SV=1 105 25640 4 4 3 3 775 2060 1 0 0 306.1835 915.5287 3 915.529 -0.0003 1 23.27 0.026 R LRVEFPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3307.3307.3.dta 11 2 SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens GN=SRSF9 PE=1 SV=1 105 25640 4 4 3 3 1983 2447 1 0 1 623.8423 1245.67 2 1245.6717 -0.0017 0 45.52 0.00019 R IYVGNLPTDVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3738.3738.2.dta 11 2 SRSF9_HUMAN Serine/arginine-rich splicing factor 9 OS=Homo sapiens GN=SRSF9 PE=1 SV=1 105 25640 4 4 3 3 2360 1264 1 0 1 677.8013 1353.5881 2 1353.5871 0.001 0 65.37 7.70E-07 R EAGDVCYADVQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2427.2427.2.dta 12 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 322 59020 6 6 6 6 1510 497 1 1 0 553.7666 1105.5187 2 1105.5186 0.0001 0 41.05 0.00059 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1572.1572.2.dta 12 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 322 59020 6 6 6 6 1528 2628 1 1 1 555.248 1108.4815 2 1108.4825 -0.001 0 48.88 4.40E-05 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3941.3941.2.dta 12 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 322 59020 6 6 6 6 2461 1685 1 1 1 691.3274 1380.6402 2 1380.6408 -0.0006 0 81.03 4.90E-08 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2892.2892.2.dta 12 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 322 59020 6 6 6 6 2742 948 1 1 1 747.3694 1492.7242 2 1492.727 -0.0028 1 43.31 0.00021 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2075.2075.2.dta 12 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 322 59020 6 6 6 6 2840 975 1 1 1 775.3408 1548.667 2 1548.67 -0.003 0 76.32 4.30E-08 R SGGGGGGGGCGGGGGVSSLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2105.2105.2.dta 12 1 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 322 59020 6 6 6 6 3346 2655 1 1 1 854.3879 1706.7613 2 1706.7649 -0.0036 0 124.12 1.40E-12 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3969.3969.2.dta 12 2 K1C14_HUMAN "Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4" 87 51872 2 2 2 2 1510 497 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 41.05 0.00059 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1572.1572.2.dta 12 2 K1C14_HUMAN "Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4" 87 51872 2 2 2 2 2588 1526 1 0 1 713.3493 1424.6841 2 1424.6896 -0.0055 0 64.96 8.10E-07 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2717.2717.2.dta 12 K1C25_HUMAN "Keratin, type I cytoskeletal 25 OS=Homo sapiens GN=KRT25 PE=1 SV=1" 70 49858 2 2 2 2 1510 497 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 41.05 0.00059 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1572.1572.2.dta 12 K1C25_HUMAN "Keratin, type I cytoskeletal 25 OS=Homo sapiens GN=KRT25 PE=1 SV=1" 70 49858 2 2 2 2 1528 2628 1 0 1 555.248 1108.4815 2 1108.4825 -0.001 0 48.88 4.40E-05 R DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3941.3941.2.dta 12 K1C16_HUMAN "Keratin, type I cytoskeletal 16 OS=Homo sapiens GN=KRT16 PE=1 SV=4" 41 51578 1 1 1 1 1510 497 1 0 0 553.7666 1105.5187 2 1105.5186 0.0001 0 41.05 0.00059 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1572.1572.2.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 1485 2550 1 1 1 549.8112 1097.6078 2 1097.6081 -0.0003 0 65.93 9.70E-07 R VSALEVLPDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3853.3853.2.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 1877 2465 1 1 1 614.824 1227.6334 2 1227.6347 -0.0013 0 19.63 0.021 R EPGEVVDSLVGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3758.3758.2.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 2235 438 1 1 1 663.3628 1324.711 2 1324.7099 0.0011 0 54.44 1.90E-05 R SSVGPSKPVSQPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1507.1507.2.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 2236 439 1 1 1 442.5777 1324.7112 3 1324.7099 0.0013 0 27.79 0.0088 R SSVGPSKPVSQPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1508.1508.3.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 2480 1402 1 1 1 694.3462 1386.6778 2 1386.6813 -0.0035 0 64.35 1.50E-06 R ISDAHLADTMIGK A Oxidation (M) 0.0000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2580.2580.2.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 3112 2483 1 1 1 806.9536 1611.8927 2 1611.8944 -0.0017 1 42.68 0.00025 R VSALEVLPDRVATSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3778.3778.2.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 3526 3790 1 1 1 928.5295 1855.0444 2 1855.0455 -0.0011 0 52.5 9.30E-06 K GTVLDQVPVNPSLYLIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5167.5167.2.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 4063 2992 1 1 1 1046.9648 2091.9151 2 2091.9208 -0.0056 1 40.31 0.0002 K YDGFDCVYGLELNKDER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4322.4322.2.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 4064 2978 1 1 1 698.3126 2091.916 3 2091.9208 -0.0047 1 26.72 0.0047 K YDGFDCVYGLELNKDER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4309.4309.3.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 5137 2892 1 1 1 880.0931 2637.2576 3 2637.2592 -0.0016 1 24.89 0.0098 R IMPDSNDSPPAEREPGEVVDSLVGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4219.4219.3.dta 13 1 SPIN1_HUMAN Spindlin-1 OS=Homo sapiens GN=SPIN1 PE=1 SV=3 289 29696 11 11 8 8 5150 2753 1 1 1 885.4246 2653.252 3 2653.2541 -0.0021 1 46.06 0.00011 R IMPDSNDSPPAEREPGEVVDSLVGK Q Oxidation (M) 0.0100000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4073.4073.3.dta 13 SPIN3_HUMAN Spindlin-3 OS=Homo sapiens GN=SPIN3 PE=1 SV=1 52 29303 1 1 1 1 3526 3790 1 0 1 928.5295 1855.0444 2 1855.0455 -0.0011 0 52.5 9.30E-06 K GTVLDQVPVNPSLYLIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5167.5167.2.dta 14 1 RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens GN=RPS3A PE=1 SV=2 288 30154 8 8 8 8 869 2010 1 1 1 469.7503 937.4861 2 937.4869 -0.0008 0 44.68 0.00018 K TTDGYLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3251.3251.2.dta 14 1 RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens GN=RPS3A PE=1 SV=2 288 30154 8 8 8 8 1129 1239 1 1 1 501.7778 1001.541 2 1001.5393 0.0017 0 34.78 0.0047 K LITEDVQGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2400.2400.2.dta 14 1 RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens GN=RPS3A PE=1 SV=2 288 30154 8 8 8 8 1892 236 1 1 1 617.3061 1232.5976 2 1232.5997 -0.0021 1 78.27 1.10E-07 K ATGDETGAKVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1261.1261.2.dta 14 1 RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens GN=RPS3A PE=1 SV=2 288 30154 8 8 8 8 2113 2042 1 1 1 645.7973 1289.5801 2 1289.5776 0.0025 0 21.67 0.022 R ADGYEPPVQESV - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3287.3287.2.dta 14 1 RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens GN=RPS3A PE=1 SV=2 288 30154 8 8 8 8 2256 2068 1 1 1 664.3754 1326.7362 2 1326.7395 -0.0033 1 42.66 0.00027 K LIPDSIGKDIEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3316.3316.2.dta 14 1 RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens GN=RPS3A PE=1 SV=2 288 30154 8 8 8 8 2777 1506 1 1 1 758.4027 1514.7909 2 1514.794 -0.0032 1 62.37 4.40E-06 R EVQTNDLKEVVNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2695.2695.2.dta 14 1 RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens GN=RPS3A PE=1 SV=2 288 30154 8 8 8 8 3303 1851 1 1 1 837.9 1673.7855 2 1673.7897 -0.0042 1 54.39 1.70E-05 K VERADGYEPPVQESV - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3077.3077.2.dta 14 1 RS3A_HUMAN 40S ribosomal protein S3a OS=Homo sapiens GN=RPS3A PE=1 SV=2 288 30154 8 8 8 8 3704 3860 1 1 1 976.49 1950.9654 2 1950.9687 -0.0033 0 90.12 3.50E-09 R VFEVSLADLQNDEVAFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5240.5240.2.dta 15 1 RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 287 24475 9 9 8 8 338 81 1 1 1 391.2432 780.4719 2 780.4718 0 1 16.95 0.036 R RIHTVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1090.1090.2.dta 15 1 RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 287 24475 9 9 8 8 904 1557 1 1 1 476.2424 950.4702 2 950.4709 -0.0007 0 49.61 8.40E-05 R ADGYVLEGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2750.2750.2.dta 15 1 RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 287 24475 9 9 8 8 1853 976 1 1 1 610.3235 1218.6325 2 1218.6357 -0.0031 0 48.95 0.00012 K YELGRPAANTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2106.2106.2.dta 15 1 RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 287 24475 9 9 8 8 2196 2156 1 1 1 657.8383 1313.6621 2 1313.6714 -0.0093 0 34.42 0.0013 K LTPEEEEILNK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3413.3413.2.dta 15 1 RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 287 24475 9 9 8 8 2649 2829 1 1 1 725.8734 1449.7322 2 1449.7286 0.0036 0 44.5 0.00032 K NCIVLIDSTPYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4153.4153.2.dta 15 1 RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 287 24475 9 9 8 8 2762 2670 1 1 1 753.8925 1505.7704 2 1505.7726 -0.0022 0 75.55 2.00E-07 K ISSLLEEQFQQGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3986.3986.2.dta 15 1 RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 287 24475 9 9 8 8 3366 2818 1 1 1 859.9549 1717.8952 2 1717.8999 -0.0046 0 84.15 1.30E-08 R IIDVVYNASNNELVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4140.4140.2.dta 15 1 RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 287 24475 9 9 8 8 3367 2824 1 1 1 573.64 1717.8982 3 1717.8999 -0.0017 0 50.12 2.00E-05 R IIDVVYNASNNELVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4148.4148.3.dta 15 1 RS8_HUMAN 40S ribosomal protein S8 OS=Homo sapiens GN=RPS8 PE=1 SV=2 287 24475 9 9 8 8 3597 3469 1 1 1 634.6592 1900.9557 3 1900.957 -0.0013 1 31.09 0.0012 R ADGYVLEGKELEFYLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4827.4827.3.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 103 601 1 1 0 337.1972 672.3799 2 672.3806 -0.0008 0 39.73 0.001 R LAADVGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1688.1688.2.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 599 1931 1 1 0 431.2307 860.4469 2 860.4426 0.0043 0 25.83 0.027 R GLGDCLVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3166.3166.2.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 723 2543 1 1 0 451.7455 901.4765 2 901.477 -0.0005 0 43.32 0.00037 K GAWSNVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3846.3846.2.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 797 561 1 1 1 308.5109 922.5109 3 922.5124 -0.0014 1 23.38 0.016 K IYKSDGIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1643.1643.3.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 845 713 1 1 0 310.85 929.5281 3 929.5294 -0.0013 1 33.51 0.0038 R TRLAADVGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1812.1812.3.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 982 2411 1 1 0 488.7764 975.5382 2 975.5389 -0.0007 0 50.71 6.10E-05 K QIFLGGVDK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3698.3698.2.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 1104 1629 1 1 0 499.7502 997.4858 2 997.4869 -0.0011 1 56.84 1.50E-05 R DEGGKAFFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2830.2830.2.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 1564 4180 1 1 0 561.29 1120.5655 2 1120.5665 -0.001 0 15.92 0.038 K EQGVLSFWR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5575.5575.2.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 1565 3600 1 1 0 561.2901 1120.5656 2 1120.5665 -0.0009 0 40.02 0.00025 K EQGVLSFWR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4967.4967.2.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 1606 1971 1 1 1 378.2204 1131.6394 3 1131.64 -0.0007 1 32.51 0.0029 K QIFLGGVDKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3208.3208.3.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 1643 1720 1 1 0 379.5641 1135.6706 3 1135.6713 -0.0007 0 20.67 0.015 K LLLQVQHASK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2930.2930.3.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 1852 2754 1 1 1 610.303 1218.5915 2 1218.5921 -0.0005 0 59.82 7.50E-06 R AAYFGIYDTAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4075.4075.2.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 1854 3158 1 1 1 610.3373 1218.66 2 1218.6608 -0.0008 0 67.72 1.00E-06 K DFLAGGVAAAISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4498.4498.2.dta 16 1 ADT2_HUMAN ADP/ATP translocase 2 OS=Homo sapiens GN=SLC25A5 PE=1 SV=7 286 33059 14 14 13 13 2641 3855 1 1 0 723.8735 1445.7324 2 1445.7343 -0.0019 0 32.8 0.0047 R YFPTQALNFAFK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5236.5236.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 103 601 1 0 0 337.1972 672.3799 2 672.3806 -0.0008 0 39.73 0.001 R LAADVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1688.1688.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 599 1931 1 0 0 431.2307 860.4469 2 860.4426 0.0043 0 25.83 0.027 R GLGDCLVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3166.3166.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 723 2543 1 0 0 451.7455 901.4765 2 901.477 -0.0005 0 43.32 0.00037 K GAWSNVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3846.3846.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 845 713 1 0 0 310.85 929.5281 3 929.5294 -0.0013 1 33.51 0.0038 R TRLAADVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1812.1812.3.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 982 2411 1 0 0 488.7764 975.5382 2 975.5389 -0.0007 0 50.71 6.10E-05 K QIFLGGVDK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3698.3698.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 1104 1629 1 0 0 499.7502 997.4858 2 997.4869 -0.0011 1 56.84 1.50E-05 R DEGGKAFFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2830.2830.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 1564 4180 1 0 0 561.29 1120.5655 2 1120.5665 -0.001 0 15.92 0.038 K EQGVLSFWR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5575.5575.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 1565 3600 1 0 0 561.2901 1120.5656 2 1120.5665 -0.0009 0 40.02 0.00025 K EQGVLSFWR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4967.4967.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 1643 1720 1 0 0 379.5641 1135.6706 3 1135.6713 -0.0007 0 20.67 0.015 K LLLQVQHASK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2930.2930.3.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 1810 2463 1 0 1 603.2951 1204.5757 2 1204.5764 -0.0008 0 62.26 2.90E-06 R AAYFGVYDTAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3756.3756.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 1943 3543 1 0 1 617.3448 1232.675 2 1232.6765 -0.0014 0 80.03 5.30E-08 K DFLAGGIAAAISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4905.4905.2.dta 16 2 ADT3_HUMAN ADP/ATP translocase 3 OS=Homo sapiens GN=SLC25A6 PE=1 SV=4 284 33073 12 12 11 11 2641 3855 1 0 0 723.8735 1445.7324 2 1445.7343 -0.0019 0 32.8 0.0047 R YFPTQALNFAFK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5236.5236.2.dta 16 ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 131 33271 6 6 6 6 103 601 1 0 0 337.1972 672.3799 2 672.3806 -0.0008 0 39.73 0.001 R LAADVGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1688.1688.2.dta 16 ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 131 33271 6 6 6 6 723 2543 1 0 0 451.7455 901.4765 2 901.477 -0.0005 0 43.32 0.00037 K GAWSNVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3846.3846.2.dta 16 ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 131 33271 6 6 6 6 845 713 1 0 0 310.85 929.5281 3 929.5294 -0.0013 1 33.51 0.0038 R TRLAADVGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1812.1812.3.dta 16 ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 131 33271 6 6 6 6 1643 1720 1 0 0 379.5641 1135.6706 3 1135.6713 -0.0007 0 20.67 0.015 K LLLQVQHASK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2930.2930.3.dta 16 ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 131 33271 6 6 6 6 1810 2463 1 0 1 603.2951 1204.5757 2 1204.5764 -0.0008 0 62.26 2.90E-06 R AAYFGVYDTAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3756.3756.2.dta 16 ADT1_HUMAN ADP/ATP translocase 1 OS=Homo sapiens GN=SLC25A4 PE=1 SV=4 131 33271 6 6 6 6 2641 3855 1 0 0 723.8735 1445.7324 2 1445.7343 -0.0019 0 32.8 0.0047 R YFPTQALNFAFK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5236.5236.2.dta 16 ADT4_HUMAN ADP/ATP translocase 4 OS=Homo sapiens GN=SLC25A31 PE=2 SV=1 33 35285 1 1 1 1 2641 3855 1 0 0 723.8735 1445.7324 2 1445.7343 -0.0019 0 32.8 0.0047 R YFPTQALNFAFK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5236.5236.2.dta 17 1 VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 277 30981 8 8 7 7 13 1447 1 1 0 303.6832 605.3518 2 605.3537 -0.0018 0 40.84 0.00063 R FGIAAK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2630.2630.2.dta 17 1 VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 277 30981 8 8 7 7 423 244 1 1 1 409.2011 816.3877 2 816.3878 -0.0001 0 24.2 0.016 K NFSAGGHK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1270.1270.2.dta 17 1 VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 277 30981 8 8 7 7 646 1095 1 1 1 437.1829 872.3512 2 872.3521 -0.0009 0 26.99 0.0021 K YMLDCR T Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2238.2238.2.dta 17 1 VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 277 30981 8 8 7 7 1246 3439 1 1 1 515.8107 1029.6068 2 1029.607 -0.0002 0 65.41 1.10E-06 K LTLSALIDGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4796.4796.2.dta 17 1 VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 277 30981 8 8 7 7 1995 2287 1 1 1 627.8275 1253.6404 2 1253.6404 -0.0001 0 55.82 2.20E-05 K LSQNNFALGYK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3560.3560.2.dta 17 1 VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 277 30981 8 8 7 7 2275 2376 1 1 1 665.8254 1329.6363 2 1329.6387 -0.0024 0 61.19 4.10E-06 K VCNYGLTFTQK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3659.3659.2.dta 17 1 VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 277 30981 8 8 7 7 3803 1494 1 1 1 995.9232 1989.8319 2 1989.8375 -0.0056 0 89.28 1.20E-09 K SCSGVEFSTSGHAYTDTGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2682.2682.2.dta 17 1 VDAC3_HUMAN Voltage-dependent anion-selective channel protein 3 OS=Homo sapiens GN=VDAC3 PE=1 SV=1 277 30981 8 8 7 7 3804 1485 1 1 1 664.2851 1989.8335 3 1989.8375 -0.004 0 35.13 0.00031 K SCSGVEFSTSGHAYTDTGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2672.2672.3.dta 17 2 VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens GN=VDAC1 PE=1 SV=2 203 30868 4 4 4 4 13 1447 1 0 0 303.6832 605.3518 2 605.3537 -0.0018 0 40.84 0.00063 R FGIAAK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2630.2630.2.dta 17 2 VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens GN=VDAC1 PE=1 SV=2 203 30868 4 4 4 4 1246 3439 1 0 1 515.8107 1029.6068 2 1029.607 -0.0002 0 65.41 1.10E-06 K LTLSALLDGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4796.4796.2.dta 17 2 VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens GN=VDAC1 PE=1 SV=2 203 30868 4 4 4 4 1831 1757 1 0 1 607.3132 1212.6119 2 1212.6139 -0.002 0 69.98 5.30E-07 R VTQSNFAVGYK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2972.2972.2.dta 17 2 VDAC1_HUMAN Voltage-dependent anion-selective channel protein 1 OS=Homo sapiens GN=VDAC1 PE=1 SV=2 203 30868 4 4 4 4 3711 1752 1 0 1 980.4412 1958.8678 2 1958.8705 -0.0027 0 82.82 1.20E-08 K SENGLEFTSSGSANTETTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2966.2966.2.dta 18 1 RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 274 23696 7 7 7 7 106 1654 1 1 0 337.713 673.4115 2 673.4123 -0.0008 0 33.21 0.0033 K SSLVLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2857.2857.2.dta 18 1 RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 274 23696 7 7 7 7 1452 2736 1 1 1 543.3316 1084.6487 2 1084.6492 -0.0005 0 46.83 8.00E-05 K LVLLGESAVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4057.4057.2.dta 18 1 RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 274 23696 7 7 7 7 1823 294 1 1 1 606.2916 1210.5686 2 1210.569 -0.0005 0 37.17 0.00064 K NEPQNATGAPGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1324.1324.2.dta 18 1 RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 274 23696 7 7 7 7 2139 1190 1 1 1 650.317 1298.6194 2 1298.6215 -0.0021 0 64.42 1.80E-06 R GVDLQENNPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2345.2345.2.dta 18 1 RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 274 23696 7 7 7 7 2352 2939 1 1 1 676.316 1350.6174 2 1350.6204 -0.003 0 54.6 1.70E-05 K FEIWDTAGQER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4268.4268.2.dta 18 1 RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 274 23696 7 7 7 7 2502 3017 1 1 1 698.4009 1394.7873 2 1394.7881 -0.0008 0 76.86 6.90E-08 R QASPNIVIALAGNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4349.4349.2.dta 18 1 RAB5C_HUMAN Ras-related protein Rab-5C OS=Homo sapiens GN=RAB5C PE=1 SV=2 274 23696 7 7 7 7 3888 3558 1 1 1 1013.5149 2025.0152 2 2025.0167 -0.0015 0 72.21 1.70E-07 R GAQAAIVVYDITNTDTFAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4921.4921.2.dta 18 RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 96 23872 3 3 3 3 106 1654 1 0 0 337.713 673.4115 2 673.4123 -0.0008 0 33.21 0.0033 K SSLVLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2857.2857.2.dta 18 RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 96 23872 3 3 3 3 1452 2736 1 0 1 543.3316 1084.6487 2 1084.6492 -0.0005 0 46.83 8.00E-05 K LVLLGESAVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4057.4057.2.dta 18 RAB5A_HUMAN Ras-related protein Rab-5A OS=Homo sapiens GN=RAB5A PE=1 SV=2 96 23872 3 3 3 3 2352 2939 1 0 1 676.316 1350.6174 2 1350.6204 -0.003 0 54.6 1.70E-05 K FEIWDTAGQER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4268.4268.2.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 205 5500 1 1 1 359.7264 717.4383 2 717.4385 -0.0002 1 43.24 6.20E-05 K KITAASK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.984.984.2.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 541 350 1 1 1 422.2687 842.5229 2 842.5225 0.0004 1 29.26 0.0058 R IIKNEVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1385.1385.2.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 602 1061 1 1 1 431.748 861.4815 2 861.4821 -0.0005 1 28.37 0.011 R RFVEVGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2201.2201.2.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 988 54 1 1 1 489.7899 977.5652 2 977.5658 -0.0006 1 52.15 1.70E-05 K APAQKAPAPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1060.1060.2.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 1267 148 1 1 1 519.3075 1036.6004 2 1036.6029 -0.0025 1 32.11 0.0018 K APAQKVPAQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1163.1163.2.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 1839 1566 1 1 1 608.3104 1214.6063 2 1214.6078 -0.0015 0 63.22 2.00E-06 R ALVDGPCTQVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2760.2760.2.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 2036 3808 1 1 1 634.8221 1267.6297 2 1267.6305 -0.0007 0 37.98 0.0012 K CMQLTDFILK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5186.5186.2.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 2079 3321 1 1 1 642.8201 1283.6256 2 1283.6254 0.0002 0 37.95 0.001 K CMQLTDFILK F Oxidation (M) 0.0100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4669.4669.2.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 2362 3395 1 1 1 452.2607 1353.7604 3 1353.7616 -0.0012 0 25.07 0.012 K LVAIVDVIDQNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4748.4748.3.dta 19 1 RL14_HUMAN 60S ribosomal protein L14 OS=Homo sapiens GN=RPL14 PE=1 SV=4 255 23531 10 10 8 8 2363 3377 1 1 1 677.8885 1353.7625 2 1353.7616 0.0009 0 72.21 2.10E-07 K LVAIVDVIDQNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4728.4728.2.dta 20 1 SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 247 27578 7 7 5 5 1176 783 1 1 1 508.7488 1015.4831 2 1015.4835 -0.0004 0 32.9 0.0017 R RPFDPNDR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1890.1890.2.dta 20 1 SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 247 27578 7 7 5 5 1638 1633 1 1 1 568.3085 1134.6025 2 1134.6033 -0.0008 0 63.95 1.10E-06 K VYVGNLGTGAGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2834.2834.2.dta 20 1 SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 247 27578 7 7 5 5 3128 3656 1 1 1 811.3847 1620.7549 2 1620.7573 -0.0024 0 59.04 6.20E-06 R NPPGFAFVEFEDPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5022.5022.2.dta 20 1 SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 247 27578 7 7 5 5 3129 3794 1 1 1 811.3855 1620.7564 2 1620.7573 -0.0008 0 48.46 7.10E-05 R NPPGFAFVEFEDPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5171.5171.2.dta 20 1 SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 247 27578 7 7 5 5 3369 1783 1 1 1 860.4526 1718.8907 2 1718.8951 -0.0044 1 72.5 2.70E-07 K VYVGNLGTGAGKGELER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3001.3001.2.dta 20 1 SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 247 27578 7 7 5 5 3370 1782 1 1 1 573.9716 1718.893 3 1718.8951 -0.0021 1 44.87 0.0002 K VYVGNLGTGAGKGELER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3000.3000.3.dta 20 1 SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 247 27578 7 7 5 5 4922 3508 1 1 1 793.3721 2377.0944 3 2377.0975 -0.0031 1 38.3 0.0005 R NPPGFAFVEFEDPRDAEDAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4868.4868.3.dta 20 SRSF3_HUMAN Serine/arginine-rich splicing factor 3 OS=Homo sapiens GN=SRSF3 PE=1 SV=1 88 19546 2 2 1 1 3128 3656 1 0 1 811.3847 1620.7549 2 1620.7573 -0.0024 0 59.04 6.20E-06 R NPPGFAFVEFEDPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5022.5022.2.dta 20 SRSF3_HUMAN Serine/arginine-rich splicing factor 3 OS=Homo sapiens GN=SRSF3 PE=1 SV=1 88 19546 2 2 1 1 3129 3794 1 0 1 811.3855 1620.7564 2 1620.7573 -0.0008 0 48.46 7.10E-05 R NPPGFAFVEFEDPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5171.5171.2.dta 21 1 RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 219 24731 4 4 4 4 539 5371 1 1 1 422.2091 842.4037 2 842.4035 0.0002 0 45.27 0.00011 K HYHTSAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.828.828.2.dta 21 1 RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 219 24731 4 4 4 4 2284 4249 1 1 1 668.8434 1335.6722 2 1335.6744 -0.0022 0 76.93 1.40E-07 K GIEELFLDLCK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5649.5649.2.dta 21 1 RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 219 24731 4 4 4 4 2740 3974 1 1 1 746.8948 1491.7751 2 1491.7755 -0.0004 1 49.64 8.70E-05 K GIEELFLDLCKR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5359.5359.2.dta 21 1 RAB21_HUMAN Ras-related protein Rab-21 OS=Homo sapiens GN=RAB21 PE=1 SV=3 219 24731 4 4 4 4 3471 2488 1 1 1 902.9388 1803.863 2 1803.8639 -0.0009 0 107.31 8.70E-11 R HVSIQEAESYAESVGAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3783.3783.2.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 8 171 2 1 1 300.6995 599.3845 2 599.3867 -0.0022 1 21.33 0.022 M GRVIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1189.1189.2.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 141 1308 1 1 1 347.1872 692.3599 2 692.3606 -0.0007 0 36.43 0.0015 K GAGSVFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2476.2476.2.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 150 1721 1 1 1 350.2289 698.4432 2 698.4439 -0.0007 0 37.09 0.00092 K VGLIAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2931.2931.2.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 417 632 1 1 1 408.2528 814.4911 2 814.4912 -0.0001 1 27.85 0.01 R VKLPSGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1722.1722.2.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 445 1070 1 1 1 413.7736 825.5327 2 825.5324 0.0003 0 20.63 0.0086 R IDKPILK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2211.2211.2.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 447 1203 1 1 1 414.2783 826.5421 2 826.5388 0.0032 1 31.05 0.0017 R KVGLIAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2360.2360.2.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 878 1310 1 1 1 471.2795 940.5445 2 940.5454 -0.0009 0 56.2 7.40E-06 R AVVGVVAGGGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2479.2479.2.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 2222 1748 1 1 1 440.5856 1318.7349 3 1318.7357 -0.0008 1 31.92 0.001 K GIVKDIIHDPGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2962.2962.3.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 3328 1412 1 1 1 844.9131 1687.8117 2 1687.8165 -0.0048 0 79.59 3.40E-08 R ASGNYATVISHNPETK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2591.2591.2.dta 22 1 RL8_HUMAN 60S ribosomal protein L8 OS=Homo sapiens GN=RPL8 PE=1 SV=2 214 28235 10 10 10 10 3485 1144 1 1 1 606.3114 1815.9124 3 1815.9115 0.0009 1 22.7 0.0074 R ASGNYATVISHNPETKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2294.2294.3.dta 23 1 ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 213 38837 5 5 4 4 2140 777 1 1 1 650.3297 1298.6448 2 1298.6466 -0.0019 1 49.15 8.20E-05 K SESPKEPEQLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1883.1883.2.dta 23 1 ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 213 38837 5 5 4 4 2141 774 1 1 1 433.8893 1298.6462 3 1298.6466 -0.0004 1 21.76 0.046 K SESPKEPEQLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1880.1880.3.dta 23 1 ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 213 38837 5 5 4 4 2625 702 1 1 1 479.9195 1436.7367 3 1436.7372 -0.0004 0 17.47 0.043 R EDSQRPGAHLTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1800.1800.3.dta 23 1 ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 213 38837 5 5 4 4 3333 539 1 1 1 847.852 1693.6894 2 1693.6928 -0.0034 0 120.4 9.10E-13 R NQGGYGGSSSSSSYGSGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1619.1619.2.dta 23 1 ROA1_HUMAN Heterogeneous nuclear ribonucleoprotein A1 OS=Homo sapiens GN=HNRNPA1 PE=1 SV=5 213 38837 5 5 4 4 3337 3151 1 1 1 850.3833 1698.752 2 1698.7526 -0.0006 0 74.47 1.10E-07 R GFAFVTFDDHDSVDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4490.4490.2.dta 23 RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 75 34375 2 2 2 2 2625 702 1 0 1 479.9195 1436.7367 3 1436.7372 -0.0004 0 17.47 0.043 R EDSQRPGAHLTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1800.1800.3.dta 23 RA1L2_HUMAN Heterogeneous nuclear ribonucleoprotein A1-like 2 OS=Homo sapiens GN=HNRNPA1L2 PE=2 SV=2 75 34375 2 2 2 2 3337 3151 1 0 1 850.3833 1698.752 2 1698.7526 -0.0006 0 74.47 1.10E-07 R GFAFVTFDDHDSVDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4490.4490.2.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 157 1982 1 1 1 351.2312 700.4479 2 700.4483 -0.0004 0 46.71 0.00017 R LASLGLK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3220.3220.2.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 387 1887 1 1 1 402.2346 802.4547 2 802.4549 -0.0002 0 31.91 0.0066 K VSTDLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3117.3117.2.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 891 5495 1 1 1 316.1637 945.4694 3 945.4702 -0.0008 0 40.64 0.001 K IVHSSMTR A Oxidation (M) 0.00000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.979.979.3.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 892 5493 1 1 1 473.7423 945.4701 2 945.4702 -0.0001 0 27.71 0.0052 K IVHSSMTR A Oxidation (M) 0.00000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.977.977.2.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 1279 2891 1 1 1 520.8085 1039.6025 2 1039.6026 -0.0001 0 40.33 0.00026 R EPLSLINVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4218.4218.2.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 1552 1970 1 1 1 559.8062 1117.5978 2 1117.5979 -0.0001 0 55.29 2.30E-05 R AIETTDIISR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3207.3207.2.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 1791 2508 1 1 1 598.8585 1195.7025 2 1195.7037 -0.0012 1 39.32 0.00031 R REPLSLINVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3807.3807.2.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 2130 1908 1 1 1 647.8033 1293.5921 2 1293.5911 0.001 0 51.87 3.30E-05 R TLGDTGFMPPDK I Oxidation (M) 0.000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3140.3140.2.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 3261 2057 1 1 1 555.6149 1663.8228 3 1663.824 -0.0012 1 28.08 0.0087 R TLGDTGFMPPDKITR S Oxidation (M) 0.000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3303.3303.3.dta 24 1 PGAM5_HUMAN "Serine/threonine-protein phosphatase PGAM5, mitochondrial OS=Homo sapiens GN=PGAM5 PE=1 SV=2" 203 32213 10 10 9 9 3699 2380 1 1 1 487.7372 1946.9197 4 1946.9221 -0.0024 1 15.35 0.047 R NVESGEEELASKLDHYK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3663.3663.4.dta 24 REV1_HUMAN DNA repair protein REV1 OS=Homo sapiens GN=REV1 PE=1 SV=1 47 139359 1 1 1 1 157 1982 1 0 1 351.2312 700.4479 2 700.4483 -0.0004 0 46.71 0.00017 K LASLGIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3220.3220.2.dta 25 1 ACTB_HUMAN "Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1" 195 42052 5 5 5 5 981 1083 1 1 1 488.7276 975.4406 2 975.441 -0.0004 0 55.6 9.80E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2225.2225.2.dta 25 1 ACTB_HUMAN "Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1" 195 42052 5 5 5 5 1603 1712 1 1 1 566.7664 1131.5182 2 1131.5197 -0.0015 0 56.21 8.70E-06 R GYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2922.2922.2.dta 25 1 ACTB_HUMAN "Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1" 195 42052 5 5 5 5 2361 608 1 1 1 677.8136 1353.6126 2 1353.6161 -0.0034 1 23.06 0.0069 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1695.1695.2.dta 25 1 ACTB_HUMAN "Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1" 195 42052 5 5 5 5 2780 1296 1 1 1 506.2391 1515.6956 3 1515.6954 0.0002 0 49.33 4.60E-05 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2463.2463.3.dta 25 1 ACTB_HUMAN "Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1" 195 42052 5 5 5 5 3443 3098 1 1 1 895.9485 1789.8824 2 1789.8846 -0.0022 0 81.85 4.80E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4433.4433.2.dta 25 POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=2 SV=3 149 122882 3 3 3 3 981 1083 1 0 1 488.7276 975.4406 2 975.441 -0.0004 0 55.6 9.80E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2225.2225.2.dta 25 POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=2 SV=3 149 122882 3 3 3 3 2780 1296 1 0 1 506.2391 1515.6956 3 1515.6954 0.0002 0 49.33 4.60E-05 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2463.2463.3.dta 25 POTEE_HUMAN POTE ankyrin domain family member E OS=Homo sapiens GN=POTEE PE=2 SV=3 149 122882 3 3 3 3 3443 3098 1 0 1 895.9485 1789.8824 2 1789.8846 -0.0022 0 81.85 4.80E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4433.4433.2.dta 25 ACTA_HUMAN "Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1" 125 42381 3 3 3 3 981 1083 1 0 1 488.7276 975.4406 2 975.441 -0.0004 0 55.6 9.80E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2225.2225.2.dta 25 ACTA_HUMAN "Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1" 125 42381 3 3 3 3 2361 608 1 0 1 677.8136 1353.6126 2 1353.6161 -0.0034 1 23.06 0.0069 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1695.1695.2.dta 25 ACTA_HUMAN "Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1" 125 42381 3 3 3 3 3443 3098 1 0 1 895.9485 1789.8824 2 1789.8846 -0.0022 0 81.85 4.80E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4433.4433.2.dta 25 ACTBM_HUMAN Putative beta-actin-like protein 3 OS=Homo sapiens GN=POTEKP PE=5 SV=1 112 42331 2 2 2 2 2780 1296 1 0 1 506.2391 1515.6956 3 1515.6954 0.0002 0 49.33 4.60E-05 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2463.2463.3.dta 25 ACTBM_HUMAN Putative beta-actin-like protein 3 OS=Homo sapiens GN=POTEKP PE=5 SV=1 112 42331 2 2 2 2 3443 3098 1 0 1 895.9485 1789.8824 2 1789.8846 -0.0022 0 81.85 4.80E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4433.4433.2.dta 25 POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 87 122858 2 2 2 2 981 1083 1 0 1 488.7276 975.4406 2 975.441 -0.0004 0 55.6 9.80E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2225.2225.2.dta 25 POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 87 122858 2 2 2 2 2780 1296 1 0 1 506.2391 1515.6956 3 1515.6954 0.0002 0 49.33 4.60E-05 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2463.2463.3.dta 25 ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens GN=ACTBL2 PE=1 SV=2 82 42318 1 1 1 1 3443 3098 1 0 1 895.9485 1789.8824 2 1789.8846 -0.0022 0 81.85 4.80E-08 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4433.4433.2.dta 26 1 CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 188 34131 4 4 4 4 1240 2088 1 1 1 514.7905 1027.5664 2 1027.5662 0.0002 0 58.16 9.90E-06 R SPEVLLGSAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3338.3338.2.dta 26 1 CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 188 34131 4 4 4 4 1764 1932 1 1 1 593.3123 1184.6101 2 1184.6077 0.0023 0 81.81 4.30E-08 K IGEGTYGVVYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3167.3167.2.dta 26 1 CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 188 34131 4 4 4 4 2276 3000 1 1 1 665.8455 1329.6764 2 1329.6776 -0.0012 0 55.35 2.60E-05 K NLDENGLDLLSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4331.4331.2.dta 26 1 CDK1_HUMAN Cyclin-dependent kinase 1 OS=Homo sapiens GN=CDK1 PE=1 SV=3 188 34131 4 4 4 4 2782 1661 1 1 1 758.8775 1515.7405 2 1515.7416 -0.0012 0 56.04 1.80E-05 R LESEEEGVPSTAIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2865.2865.2.dta 26 CDK2_HUMAN Cyclin-dependent kinase 2 OS=Homo sapiens GN=CDK2 PE=1 SV=2 82 34079 1 1 1 1 1764 1932 1 0 1 593.3123 1184.6101 2 1184.6077 0.0023 0 81.81 4.30E-08 K IGEGTYGVVYK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3167.3167.2.dta 27 1 VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 187 32060 6 6 6 6 12 5512 1 1 1 302.6922 603.3698 2 603.3704 -0.0006 1 29.28 0.0077 K SKLTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.998.998.2.dta 27 1 VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 187 32060 6 6 6 6 13 1447 1 0 0 303.6832 605.3518 2 605.3537 -0.0018 0 40.84 0.00063 R FGIAAK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2630.2630.2.dta 27 1 VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 187 32060 6 6 6 6 874 1705 1 1 1 470.735 939.4555 2 939.4563 -0.0008 0 32.93 0.0027 R NNFAVGYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2914.2914.2.dta 27 1 VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 187 32060 6 6 6 6 1182 3113 1 1 1 508.8026 1015.5907 2 1015.5914 -0.0007 0 51.7 3.20E-05 K LTLSALVDGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4450.4450.2.dta 27 1 VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 187 32060 6 6 6 6 3605 1313 1 1 1 954.3979 1906.7813 2 1906.7851 -0.0038 0 102.36 5.80E-11 K SCSGVEFSTSGSSNTDTGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2482.2482.2.dta 27 1 VDAC2_HUMAN Voltage-dependent anion-selective channel protein 2 OS=Homo sapiens GN=VDAC2 PE=1 SV=2 187 32060 6 6 6 6 4088 2476 1 1 1 701.7227 2102.1463 3 2102.1484 -0.0021 0 21.12 0.017 K VNNSSLIGVGYTQTLRPGVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3770.3770.3.dta 28 1 RACK1_HUMAN Receptor of activated protein C kinase 1 OS=Homo sapiens GN=RACK1 PE=1 SV=3 171 35511 4 4 3 3 2021 2828 1 1 1 632.8301 1263.6456 2 1263.6459 -0.0003 0 46.35 4.50E-05 R LWDLTTGTTTR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4152.4152.2.dta 28 1 RACK1_HUMAN Receptor of activated protein C kinase 1 OS=Homo sapiens GN=RACK1 PE=1 SV=3 171 35511 4 4 3 3 2181 2963 1 1 1 655.322 1308.6295 2 1308.631 -0.0015 0 63.61 1.10E-06 K DVLSVAFSSDNR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4292.4292.2.dta 28 1 RACK1_HUMAN Receptor of activated protein C kinase 1 OS=Homo sapiens GN=RACK1 PE=1 SV=3 171 35511 4 4 3 3 3439 2718 1 1 1 894.9998 1787.9851 2 1787.988 -0.0029 1 91.76 1.90E-09 K IIVDELKQEVISTSSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4038.4038.2.dta 28 1 RACK1_HUMAN Receptor of activated protein C kinase 1 OS=Homo sapiens GN=RACK1 PE=1 SV=3 171 35511 4 4 3 3 3440 2722 1 1 1 597.0031 1787.9873 3 1787.988 -0.0007 1 18.25 0.043 K IIVDELKQEVISTSSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4041.4041.3.dta 29 1 LEG3_HUMAN Galectin-3 OS=Homo sapiens GN=LGALS3 PE=1 SV=5 165 26193 8 8 7 7 162 595 1 1 1 352.2028 702.391 2 702.3912 -0.0002 0 27.84 0.029 K LNEISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1681.1681.2.dta 29 1 LEG3_HUMAN Galectin-3 OS=Homo sapiens GN=LGALS3 PE=1 SV=5 165 26193 8 8 7 7 489 556 1 1 1 417.2309 832.4472 2 832.4477 -0.0004 0 18.7 0.036 R VIVCNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1638.1638.2.dta 29 1 LEG3_HUMAN Galectin-3 OS=Homo sapiens GN=LGALS3 PE=1 SV=5 165 26193 8 8 7 7 601 2417 1 1 1 431.7423 861.4701 2 861.4708 -0.0008 0 37.2 0.0023 R IALDFQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3705.3705.2.dta 29 1 LEG3_HUMAN Galectin-3 OS=Homo sapiens GN=LGALS3 PE=1 SV=5 165 26193 8 8 7 7 1042 414 1 1 1 495.2808 988.547 2 988.5488 -0.0018 1 31.3 0.0066 R RVIVCNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1480.1480.2.dta 29 1 LEG3_HUMAN Galectin-3 OS=Homo sapiens GN=LGALS3 PE=1 SV=5 165 26193 8 8 7 7 2049 2082 1 1 1 637.3082 1272.6018 2 1272.6 0.0018 0 66.22 7.50E-07 R GNDVAFHFNPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3331.3331.2.dta 29 1 LEG3_HUMAN Galectin-3 OS=Homo sapiens GN=LGALS3 PE=1 SV=5 165 26193 8 8 7 7 2232 2350 1 1 1 662.8652 1323.7159 2 1323.7187 -0.0028 0 55.1 1.70E-05 K IQVLVEPDHFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3630.3630.2.dta 29 1 LEG3_HUMAN Galectin-3 OS=Homo sapiens GN=LGALS3 PE=1 SV=5 165 26193 8 8 7 7 2233 2347 1 1 1 442.2467 1323.7182 3 1323.7187 -0.0005 0 30.55 0.0047 K IQVLVEPDHFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3627.3627.3.dta 29 1 LEG3_HUMAN Galectin-3 OS=Homo sapiens GN=LGALS3 PE=1 SV=5 165 26193 8 8 7 7 3232 1670 1 1 1 550.621 1648.8411 3 1648.8434 -0.0023 0 38.17 0.00031 K VAVNDAHLLQYNHR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2875.2875.3.dta 30 1 RL10_HUMAN 60S ribosomal protein L10 OS=Homo sapiens GN=RPL10 PE=1 SV=4 142 25044 5 5 5 5 212 2531 1 1 1 360.7053 719.396 2 719.3966 -0.0006 0 32.15 0.0031 R IFDLGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3832.3832.2.dta 30 1 RL10_HUMAN 60S ribosomal protein L10 OS=Homo sapiens GN=RPL10 PE=1 SV=4 142 25044 5 5 5 5 259 1778 1 1 1 376.2156 750.4167 2 750.4177 -0.001 1 20.31 0.043 K FKFPGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2995.2995.2.dta 30 1 RL10_HUMAN 60S ribosomal protein L10 OS=Homo sapiens GN=RPL10 PE=1 SV=4 142 25044 5 5 5 5 1098 453 1 1 1 498.7152 995.4159 2 995.4164 -0.0005 0 38.61 0.00032 K MLSCAGADR L Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1523.1523.2.dta 30 1 RL10_HUMAN 60S ribosomal protein L10 OS=Homo sapiens GN=RPL10 PE=1 SV=4 142 25044 5 5 5 5 1540 1353 1 1 1 557.8043 1113.5941 2 1113.5965 -0.0024 1 34.51 0.0023 K RLIPDGCGVK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2525.2525.2.dta 30 1 RL10_HUMAN 60S ribosomal protein L10 OS=Homo sapiens GN=RPL10 PE=1 SV=4 142 25044 5 5 5 5 2833 3228 1 1 1 772.8326 1543.6506 2 1543.6501 0.0005 0 88.04 2.10E-09 K FNADEFEDMVAEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4572.4572.2.dta 30 RL10L_HUMAN 60S ribosomal protein L10-like OS=Homo sapiens GN=RPL10L PE=1 SV=3 54 24959 3 3 3 3 212 2531 1 0 1 360.7053 719.396 2 719.3966 -0.0006 0 32.15 0.0031 R IFDLGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3832.3832.2.dta 30 RL10L_HUMAN 60S ribosomal protein L10-like OS=Homo sapiens GN=RPL10L PE=1 SV=3 54 24959 3 3 3 3 259 1778 1 0 1 376.2156 750.4167 2 750.4177 -0.001 1 20.31 0.043 K FKFPGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2995.2995.2.dta 30 RL10L_HUMAN 60S ribosomal protein L10-like OS=Homo sapiens GN=RPL10L PE=1 SV=3 54 24959 3 3 3 3 1098 453 1 0 1 498.7152 995.4159 2 995.4164 -0.0005 0 38.61 0.00032 K MLSCAGADR L Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1523.1523.2.dta 31 1 IGKC_HUMAN Immunoglobulin kappa constant OS=Homo sapiens GN=IGKC PE=1 SV=2 142 11929 4 4 3 3 610 550 1 1 1 435.1821 868.3496 2 868.3497 -0.0002 1 20.09 0.011 K SFNRGEC - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1631.1631.2.dta 31 1 IGKC_HUMAN Immunoglobulin kappa constant OS=Homo sapiens GN=IGKC PE=1 SV=2 142 11929 4 4 3 3 3696 3871 1 1 1 973.5149 1945.0152 2 1945.0197 -0.0044 0 26.33 0.011 R TVAAPSVFIFPPSDEQLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5252.5252.2.dta 31 1 IGKC_HUMAN Immunoglobulin kappa constant OS=Homo sapiens GN=IGKC PE=1 SV=2 142 11929 4 4 3 3 3697 3668 1 1 1 973.5162 1945.0179 2 1945.0197 -0.0018 0 42.98 0.00022 R TVAAPSVFIFPPSDEQLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5036.5036.2.dta 31 1 IGKC_HUMAN Immunoglobulin kappa constant OS=Homo sapiens GN=IGKC PE=1 SV=2 142 11929 4 4 3 3 4253 1077 1 1 1 1068.4879 2134.9613 2 2134.9614 -0.0002 0 103.11 1.40E-10 K VDNALQSGNSQESVTEQDSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2218.2218.2.dta 31 IGK_HUMAN Immunoglobulin kappa light chain OS=Homo sapiens PE=1 SV=1 108 23650 2 2 2 2 610 550 1 0 1 435.1821 868.3496 2 868.3497 -0.0002 1 20.09 0.011 K SFNRGEC - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1631.1631.2.dta 31 IGK_HUMAN Immunoglobulin kappa light chain OS=Homo sapiens PE=1 SV=1 108 23650 2 2 2 2 4253 1077 1 0 1 1068.4879 2134.9613 2 2134.9614 -0.0002 0 103.11 1.40E-10 K VDNALQSGNSQESVTEQDSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2218.2218.2.dta 32 1 ATPG_HUMAN "ATP synthase subunit gamma, mitochondrial OS=Homo sapiens GN=ATP5C1 PE=1 SV=1" 133 33032 3 3 3 3 1480 1845 1 1 1 548.808 1095.6015 2 1095.6037 -0.0021 0 39.77 0.00064 K HLLIGVSSDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3070.3070.2.dta 32 1 ATPG_HUMAN "ATP synthase subunit gamma, mitochondrial OS=Homo sapiens GN=ATP5C1 PE=1 SV=1" 133 33032 3 3 3 3 2127 2740 1 1 1 646.8353 1291.656 2 1291.6561 -0.0001 0 62.06 4.80E-06 R THSDQFLVAFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4060.4060.2.dta 32 1 ATPG_HUMAN "ATP synthase subunit gamma, mitochondrial OS=Homo sapiens GN=ATP5C1 PE=1 SV=1" 133 33032 3 3 3 3 2237 3468 1 1 1 663.8676 1325.7207 2 1325.7231 -0.0024 0 71.55 3.80E-07 R IYGLGSLALYEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4826.4826.2.dta 33 1 RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens GN=RPS2 PE=1 SV=2 132 31590 6 6 6 6 342 2321 1 1 1 392.2577 782.5008 2 782.5014 -0.0007 0 27.32 0.0019 K LSIVPVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3598.3598.2.dta 33 1 RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens GN=RPS2 PE=1 SV=2 132 31590 6 6 6 6 566 1605 1 1 1 426.7263 851.4381 2 851.4389 -0.0008 0 43.78 0.00028 K ATFDAISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2803.2803.2.dta 33 1 RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens GN=RPS2 PE=1 SV=2 132 31590 6 6 6 6 1222 1632 1 1 1 513.3024 1024.5903 2 1024.5917 -0.0014 0 33.83 0.001 R GTGIVSAPVPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2833.2833.2.dta 33 1 RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens GN=RPS2 PE=1 SV=2 132 31590 6 6 6 6 1649 1941 1 1 1 570.2795 1138.5445 2 1138.5441 0.0004 0 50.09 5.00E-05 R GCTATLGNFAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3177.3177.2.dta 33 1 RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens GN=RPS2 PE=1 SV=2 132 31590 6 6 6 6 2477 3513 1 1 1 693.8517 1385.6888 2 1385.6867 0.0021 0 36.97 0.00034 K TYSYLTPDLWK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4873.4873.2.dta 33 1 RS2_HUMAN 40S ribosomal protein S2 OS=Homo sapiens GN=RPS2 PE=1 SV=2 132 31590 6 6 6 6 2673 2611 1 1 1 488.5767 1462.7082 3 1462.7092 -0.001 0 28.6 0.0092 K SPYQEFTDHLVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3922.3922.3.dta 34 1 RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens GN=RPL7A PE=1 SV=2 130 30148 6 6 6 6 280 60 1 1 1 380.7317 759.4489 2 759.449 -0.0001 1 33.02 0.0025 K AKELATK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1067.1067.2.dta 34 1 RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens GN=RPL7A PE=1 SV=2 130 30148 6 6 6 6 362 83 1 1 1 397.2137 792.4128 2 792.413 -0.0002 0 25.14 0.033 K YRPETK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1092.1092.2.dta 34 1 RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens GN=RPL7A PE=1 SV=2 130 30148 6 6 6 6 564 1047 1 1 1 426.271 850.5275 2 850.5276 -0.0001 0 25.09 0.0031 K VAPAPAVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2185.2185.2.dta 34 1 RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens GN=RPL7A PE=1 SV=2 130 30148 6 6 6 6 1844 2280 1 1 1 608.8197 1215.6249 2 1215.6248 0.0001 0 43.81 0.00027 K NFGIGQDIQPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3552.3552.2.dta 34 1 RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens GN=RPL7A PE=1 SV=2 130 30148 6 6 6 6 2312 2311 1 1 1 673.3691 1344.7237 2 1344.7249 -0.0012 0 66.58 8.30E-07 R AGVNTVTTLVENK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3587.3587.2.dta 34 1 RL7A_HUMAN 60S ribosomal protein L7a OS=Homo sapiens GN=RPL7A PE=1 SV=2 130 30148 6 6 6 6 2689 1933 1 1 1 491.9479 1472.822 3 1472.8199 0.0021 1 27.83 0.0029 R AGVNTVTTLVENKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3168.3168.3.dta 35 1 RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3 119 24579 5 5 5 5 260 452 1 1 1 376.2264 750.4382 2 750.4388 -0.0006 1 23.67 0.011 K TTFVKR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1522.1522.2.dta 35 1 RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3 119 24579 5 5 5 5 932 992 1 1 1 480.7424 959.4702 2 959.4712 -0.0011 0 29.2 0.011 R HLTGEFEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2124.2124.2.dta 35 1 RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3 119 24579 5 5 5 5 1171 1885 1 1 1 508.2924 1014.5703 2 1014.571 -0.0006 0 43.35 0.00038 K LVLVGDGGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3115.3115.2.dta 35 1 RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3 119 24579 5 5 5 5 1465 623 1 1 1 363.5291 1087.5655 3 1087.5662 -0.0007 1 46.24 0.00025 R HLTGEFEKK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1712.1712.3.dta 35 1 RAN_HUMAN GTP-binding nuclear protein Ran OS=Homo sapiens GN=RAN PE=1 SV=3 119 24579 5 5 5 5 2775 2684 1 1 1 758.3848 1514.7551 2 1514.7585 -0.0034 0 57.68 7.90E-06 R VCENIPIVLCGNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4001.4001.2.dta 36 1 RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens GN=RPL10A PE=1 SV=2 112 24987 8 8 7 7 94 667 1 1 1 333.6815 665.3485 2 665.3497 -0.0011 0 30.87 0.0074 R FSGTVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1761.1761.2.dta 36 1 RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens GN=RPL10A PE=1 SV=2 112 24987 8 8 7 7 406 1612 1 1 1 406.2551 810.4956 2 810.4963 -0.0007 0 23.29 0.008 R ILGPGLNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2811.2811.2.dta 36 1 RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens GN=RPL10A PE=1 SV=2 112 24987 8 8 7 7 727 65 1 1 1 452.7372 903.4599 2 903.4596 0.0003 0 26.97 0.015 K STMGKPQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1072.1072.2.dta 36 1 RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens GN=RPL10A PE=1 SV=2 112 24987 8 8 7 7 944 1892 1 1 1 483.7474 965.4802 2 965.4818 -0.0016 0 40.86 0.00071 R DTLYEAVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3122.3122.2.dta 36 1 RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens GN=RPL10A PE=1 SV=2 112 24987 8 8 7 7 1422 16 1 1 1 540.7987 1079.5829 2 1079.5836 -0.0007 1 25.76 0.018 R EVLHGNQRK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1018.1018.2.dta 36 1 RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens GN=RPL10A PE=1 SV=2 112 24987 8 8 7 7 2177 1724 1 1 1 654.8481 1307.6816 2 1307.6834 -0.0017 1 40.29 0.0008 K VSRDTLYEAVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2934.2934.2.dta 36 1 RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens GN=RPL10A PE=1 SV=2 112 24987 8 8 7 7 2178 1726 1 1 1 436.9013 1307.6821 3 1307.6834 -0.0013 1 26.18 0.02 K VSRDTLYEAVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2936.2936.3.dta 36 1 RL10A_HUMAN 60S ribosomal protein L10a OS=Homo sapiens GN=RPL10A PE=1 SV=2 112 24987 8 8 7 7 3580 2219 1 1 1 631.6139 1891.8198 3 1891.8193 0.0005 0 38.2 0.00031 K FSVCVLGDQQHCDEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3486.3486.3.dta 37 1 RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1 111 28834 8 8 8 8 27 5442 1 1 1 312.6947 623.3749 2 623.3755 -0.0006 0 22.32 0.015 R VLQHK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.920.920.2.dta 37 1 RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1 111 28834 8 8 8 8 239 613 1 1 0 366.2298 730.4451 2 730.4449 0.0002 1 28.28 0.0079 R RLSSLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1701.1701.2.dta 37 1 RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1 111 28834 8 8 8 8 336 5388 1 1 1 390.7455 779.4765 2 779.4766 -0.0001 1 36.26 0.00035 R VLQHKR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.857.857.2.dta 37 1 RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1 111 28834 8 8 8 8 540 619 1 1 1 422.2216 842.4286 2 842.4286 -0.0001 1 24.57 0.013 R TFYEKR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1708.1708.2.dta 37 1 RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1 111 28834 8 8 8 8 606 423 1 1 1 434.2436 866.4727 2 866.4723 0.0004 0 26.7 0.0099 K QGVLTHGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1490.1490.2.dta 37 1 RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1 111 28834 8 8 8 8 644 90 1 1 1 436.7512 871.4879 2 871.4875 0.0004 1 34.51 0.004 K RQEQIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1100.1100.2.dta 37 1 RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1 111 28834 8 8 8 8 1249 70 1 1 1 516.7429 1031.4713 2 1031.4719 -0.0006 0 27.6 0.0068 K GHSCYRPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1078.1078.2.dta 37 1 RS6_HUMAN 40S ribosomal protein S6 OS=Homo sapiens GN=RPS6 PE=1 SV=1 111 28834 8 8 8 8 2081 2510 1 1 1 642.8439 1283.6732 2 1283.6722 0.001 0 39.36 0.00042 K DIPGLTDTTVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3809.3809.2.dta 38 1 RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 106 24110 3 3 3 3 2211 2556 1 1 0 658.8318 1315.649 2 1315.6521 -0.003 0 52.15 5.20E-05 K LQIWDTAGQER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3860.3860.2.dta 38 1 RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 106 24110 3 3 3 3 3130 2765 1 1 1 541.2737 1620.7992 3 1620.7995 -0.0003 1 48.83 8.90E-05 K TGENVEDAFLEAAKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4086.4086.3.dta 38 1 RAB14_HUMAN Ras-related protein Rab-14 OS=Homo sapiens GN=RAB14 PE=1 SV=4 106 24110 3 3 3 3 5347 2117 1 1 1 788.3936 3149.5451 4 3149.549 -0.0039 0 46.14 9.50E-05 K IYQNIQDGSLDLNAAESGVQHKPSAPQGGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3370.3370.4.dta 38 2 RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 79 22891 2 2 2 2 2211 2556 1 0 0 658.8318 1315.649 2 1315.6521 -0.003 0 52.15 5.20E-05 K LQIWDTAGQER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3860.3860.2.dta 38 2 RAB1A_HUMAN Ras-related protein Rab-1A OS=Homo sapiens GN=RAB1A PE=1 SV=3 79 22891 2 2 2 2 3375 4085 1 0 1 862.9399 1723.8653 2 1723.8669 -0.0015 0 48.61 0.00011 K EFADSLGIPFLETSAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5476.5476.2.dta 38 RAB10_HUMAN Ras-related protein Rab-10 OS=Homo sapiens GN=RAB10 PE=1 SV=1 52 22755 1 1 1 1 2211 2556 1 0 0 658.8318 1315.649 2 1315.6521 -0.003 0 52.15 5.20E-05 K LQIWDTAGQER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3860.3860.2.dta 39 1 MOB2_HUMAN MOB kinase activator 2 OS=Homo sapiens GN=MOB2 PE=1 SV=1 105 27251 3 3 2 2 1841 535 1 1 1 608.3211 1214.6277 2 1214.6295 -0.0018 1 51.16 7.00E-05 R KAYLEPEHTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1614.1614.2.dta 39 1 MOB2_HUMAN MOB kinase activator 2 OS=Homo sapiens GN=MOB2 PE=1 SV=1 105 27251 3 3 2 2 1842 537 1 1 1 405.8832 1214.6279 3 1214.6295 -0.0016 1 31.67 0.0011 R KAYLEPEHTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1617.1617.3.dta 39 1 MOB2_HUMAN MOB kinase activator 2 OS=Homo sapiens GN=MOB2 PE=1 SV=1 105 27251 3 3 2 2 2019 2381 1 1 1 632.3265 1262.6384 2 1262.6394 -0.001 0 60.87 6.80E-06 K LVTDEDVFPTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3665.3665.2.dta 40 1 HCD2_HUMAN 3-hydroxyacyl-CoA dehydrogenase type-2 OS=Homo sapiens GN=HSD17B10 PE=1 SV=3 105 27134 1 1 1 1 4521 3164 1 1 1 1098.0853 2194.1561 2 2194.1593 -0.0032 0 104.74 1.20E-10 R LVGQGASAVLLDLPNSGGEAQAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4503.4503.2.dta 41 1 H1X_HUMAN Histone H1x OS=Homo sapiens GN=H1FX PE=1 SV=1 102 22474 2 2 2 2 1816 2504 1 1 1 604.3373 1206.6601 2 1206.6608 -0.0007 0 67.84 1.00E-06 K YSQLVVETIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3802.3802.2.dta 41 1 H1X_HUMAN Histone H1x OS=Homo sapiens GN=H1FX PE=1 SV=1 102 22474 2 2 2 2 2303 2638 1 1 1 671.3904 1340.7662 2 1340.7664 -0.0001 0 53.88 1.70E-05 K ALVQNDTLLQVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3951.3951.2.dta 42 1 RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1 100 29264 6 6 6 6 1567 1649 1 1 1 561.3184 1120.6222 2 1120.624 -0.0019 1 28.45 0.0079 K SVNELIYKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2852.2852.2.dta 42 1 RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1 100 29264 6 6 6 6 1738 2674 1 1 1 585.8454 1169.6762 2 1169.6768 -0.0005 0 65.24 1.30E-06 R IALTDNALIAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3990.3990.2.dta 42 1 RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1 100 29264 6 6 6 6 1778 2061 1 1 1 596.8027 1191.5908 2 1191.5924 -0.0016 0 29.2 0.0085 K AGNFYVPAEPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3308.3308.2.dta 42 1 RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1 100 29264 6 6 6 6 2023 4047 1 1 1 633.3197 1264.6249 2 1264.624 0.0008 0 30.92 0.0061 K EANNFLWPFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5437.5437.2.dta 42 1 RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1 100 29264 6 6 6 6 2379 712 1 1 1 680.8142 1359.6139 2 1359.6168 -0.0029 0 19.47 0.037 K TTHFVEGGDAGNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1811.1811.2.dta 42 1 RL7_HUMAN 60S ribosomal protein L7 OS=Homo sapiens GN=RPL7 PE=1 SV=1 100 29264 6 6 6 6 4138 957 1 1 1 529.7496 2114.9694 4 2114.973 -0.0035 1 23.75 0.015 K TTHFVEGGDAGNREDQINR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2085.2085.4.dta 43 1 RS4X_HUMAN "40S ribosomal protein S4, X isoform OS=Homo sapiens GN=RPS4X PE=1 SV=2" 95 29807 5 5 5 5 45 46 1 1 1 321.2082 640.4018 2 640.402 -0.0003 1 19.39 0.043 K RVAAPK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1051.1051.2.dta 43 1 RS4X_HUMAN "40S ribosomal protein S4, X isoform OS=Homo sapiens GN=RPS4X PE=1 SV=2" 95 29807 5 5 5 5 299 1312 1 1 1 386.7375 771.4605 2 771.4603 0.0002 0 28.95 0.017 R IGVITNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2481.2481.2.dta 43 1 RS4X_HUMAN "40S ribosomal protein S4, X isoform OS=Homo sapiens GN=RPS4X PE=1 SV=2" 95 29807 5 5 5 5 1081 3186 1 1 1 495.8024 989.5902 2 989.591 -0.0007 0 49.38 2.10E-05 R LSNIFVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4527.4527.2.dta 43 1 RS4X_HUMAN "40S ribosomal protein S4, X isoform OS=Homo sapiens GN=RPS4X PE=1 SV=2" 95 29807 5 5 5 5 1843 1228 1 1 1 608.3325 1214.6505 2 1214.652 -0.0015 0 41.4 0.00078 K GIPHLVTHDAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2387.2387.2.dta 43 1 RS4X_HUMAN "40S ribosomal protein S4, X isoform OS=Homo sapiens GN=RPS4X PE=1 SV=2" 95 29807 5 5 5 5 2050 4556 1 1 1 637.3698 1272.7251 2 1272.7264 -0.0013 0 35.39 0.0012 R ECLPLIIFLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5986.5986.2.dta 43 RS4Y1_HUMAN "40S ribosomal protein S4, Y isoform 1 OS=Homo sapiens GN=RPS4Y1 PE=1 SV=2" 40 29665 2 2 2 2 45 46 1 0 1 321.2082 640.4018 2 640.402 -0.0003 1 19.39 0.043 K RVAAPK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1051.1051.2.dta 43 RS4Y1_HUMAN "40S ribosomal protein S4, Y isoform 1 OS=Homo sapiens GN=RPS4Y1 PE=1 SV=2" 40 29665 2 2 2 2 1843 1228 1 0 1 608.3325 1214.6505 2 1214.652 -0.0015 0 41.4 0.00078 K GIPHLVTHDAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2387.2387.2.dta 44 1 RL13_HUMAN 60S ribosomal protein L13 OS=Homo sapiens GN=RPL13 PE=1 SV=4 91 24304 5 5 5 5 262 5476 1 1 1 376.7422 751.4699 2 751.4704 -0.0005 1 39.42 0.00024 R VAGIHKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.958.958.2.dta 44 1 RL13_HUMAN 60S ribosomal protein L13 OS=Homo sapiens GN=RPL13 PE=1 SV=4 91 24304 5 5 5 5 273 3199 1 1 1 379.7498 757.485 2 757.485 -0.0001 0 20.64 0.033 K LILFPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4541.4541.2.dta 44 1 RL13_HUMAN 60S ribosomal protein L13 OS=Homo sapiens GN=RPL13 PE=1 SV=4 91 24304 5 5 5 5 902 2996 1 1 1 475.7507 949.4869 2 949.4869 0 0 40.72 0.00062 R GFSLEELR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4327.4327.2.dta 44 1 RL13_HUMAN 60S ribosomal protein L13 OS=Homo sapiens GN=RPL13 PE=1 SV=4 91 24304 5 5 5 5 1957 1075 1 1 1 618.8258 1235.6371 2 1235.6397 -0.0027 1 26.72 0.012 R VITEEEKNFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2216.2216.2.dta 44 1 RL13_HUMAN 60S ribosomal protein L13 OS=Homo sapiens GN=RPL13 PE=1 SV=4 91 24304 5 5 5 5 2513 2087 1 1 1 699.8907 1397.7668 2 1397.7701 -0.0033 0 38.76 0.00063 K LATQLTGPVMPVR N Oxidation (M) 0.0000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3337.3337.2.dta 45 1 RAI3_HUMAN Retinoic acid-induced protein 3 OS=Homo sapiens GN=GPRC5A PE=1 SV=2 88 40624 2 2 2 2 433 637 1 1 1 412.6984 823.3822 2 823.3824 -0.0002 0 43.03 0.00028 K SYGVENR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1728.1728.2.dta 45 1 RAI3_HUMAN Retinoic acid-induced protein 3 OS=Homo sapiens GN=GPRC5A PE=1 SV=2 88 40624 2 2 2 2 2611 3176 1 1 1 717.3719 1432.7293 2 1432.731 -0.0017 0 62.99 1.20E-06 R TNVNVFSELSAPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4517.4517.2.dta 46 1 DPM1_HUMAN Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens GN=DPM1 PE=1 SV=1 87 29673 2 2 2 2 1751 3441 1 1 1 588.834 1175.6534 2 1175.655 -0.0016 0 52.4 2.00E-05 K LGGNEIVSFLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4798.4798.2.dta 46 1 DPM1_HUMAN Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens GN=DPM1 PE=1 SV=1 87 29673 2 2 2 2 3515 3708 1 1 1 925.9852 1849.9558 2 1849.9574 -0.0016 0 51.3 1.50E-05 R QLNYTIGEVPISFVDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5079.5079.2.dta 47 1 DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 86 31718 3 3 3 3 1105 2505 1 1 1 499.7686 997.5226 2 997.5233 -0.0007 0 23.72 0.014 R FAIYETVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3803.3803.2.dta 47 1 DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 86 31718 3 3 3 3 1817 732 1 1 1 605.3322 1208.6499 2 1208.6513 -0.0015 0 33.14 0.0025 K VHLQTQQEVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1833.1833.2.dta 47 1 DIC_HUMAN Mitochondrial dicarboxylate carrier OS=Homo sapiens GN=SLC25A10 PE=1 SV=2 86 31718 3 3 3 3 3349 2666 1 1 1 855.4272 1708.8399 2 1708.8454 -0.0055 0 66.17 6.90E-07 R GALVTVGQLSCYDQAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3981.3981.2.dta 48 1 SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens GN=SNRPA PE=1 SV=3 79 31259 3 3 3 3 600 1054 1 1 1 431.7293 861.4441 2 861.4444 -0.0002 0 39.91 0.00082 K TDSDIIAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2193.2193.2.dta 48 1 SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens GN=SNRPA PE=1 SV=3 79 31259 3 3 3 3 734 3096 1 1 1 455.2628 908.511 2 908.512 -0.001 0 20.76 0.035 R GQAFVIFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4431.4431.2.dta 48 1 SNRPA_HUMAN U1 small nuclear ribonucleoprotein A OS=Homo sapiens GN=SNRPA PE=1 SV=3 79 31259 3 3 3 3 1334 1082 1 1 1 524.2748 1046.5351 2 1046.5356 -0.0005 0 60.38 8.20E-06 K EVSSATNALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2224.2224.2.dta 48 RU2B_HUMAN U2 small nuclear ribonucleoprotein B~~ OS=Homo sapiens GN=SNRPB2 PE=1 SV=1 21 25470 1 1 1 1 734 3096 1 0 1 455.2628 908.511 2 908.512 -0.001 0 20.76 0.035 R GQAFVIFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4431.4431.2.dta 49 1 PSA4_HUMAN Proteasome subunit alpha type-4 OS=Homo sapiens GN=PSMA4 PE=1 SV=1 74 29750 3 3 3 3 147 5440 1 1 1 348.6748 695.3351 2 695.3351 0 1 19.23 0.029 R RYDSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.919.919.2.dta 49 1 PSA4_HUMAN Proteasome subunit alpha type-4 OS=Homo sapiens GN=PSMA4 PE=1 SV=1 74 29750 3 3 3 3 349 2452 1 1 1 393.7577 785.5008 2 785.5011 -0.0002 0 42.31 0.00019 K SALALAIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3743.3743.2.dta 49 1 PSA4_HUMAN Proteasome subunit alpha type-4 OS=Homo sapiens GN=PSMA4 PE=1 SV=1 74 29750 3 3 3 3 1872 3499 1 1 1 613.8185 1225.6224 2 1225.623 -0.0006 0 48.8 0.0001 K LLDEVFFSEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4858.4858.2.dta 50 1 RL15_HUMAN 60S ribosomal protein L15 OS=Homo sapiens GN=RPL15 PE=1 SV=2 72 24245 3 3 3 3 222 5403 1 1 1 362.745 723.4755 2 723.4755 0 1 32.04 0.00063 R KRPVPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.877.877.2.dta 50 1 RL15_HUMAN 60S ribosomal protein L15 OS=Homo sapiens GN=RPL15 PE=1 SV=2 72 24245 3 3 3 3 663 961 1 1 1 441.2514 880.4883 2 880.4879 0.0004 0 34.61 0.0013 R NTLQLHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2089.2089.2.dta 50 1 RL15_HUMAN 60S ribosomal protein L15 OS=Homo sapiens GN=RPL15 PE=1 SV=2 72 24245 3 3 3 3 1188 1307 1 1 1 509.7617 1017.5089 2 1017.5091 -0.0001 0 40.21 0.00093 R SLQSVAEER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2475.2475.2.dta 51 1 SFXN1_HUMAN Sideroflexin-1 OS=Homo sapiens GN=SFXN1 PE=1 SV=4 70 35881 2 2 2 2 659 1290 1 1 1 439.7637 877.5129 2 877.5134 -0.0005 0 21.14 0.018 K HVSPLIGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2456.2456.2.dta 51 1 SFXN1_HUMAN Sideroflexin-1 OS=Homo sapiens GN=SFXN1 PE=1 SV=4 70 35881 2 2 2 2 2752 2558 1 1 1 750.9037 1499.7928 2 1499.7943 -0.0015 0 66.86 1.20E-06 R NILLTNEQLESAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3862.3862.2.dta 52 1 HNRH1_HUMAN Heterogeneous nuclear ribonucleoprotein H OS=Homo sapiens GN=HNRNPH1 PE=1 SV=4 69 49484 1 1 1 1 3505 3442 1 1 1 921.4491 1840.8836 2 1840.8843 -0.0006 0 69.25 3.20E-07 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4799.4799.2.dta 53 1 MPCP_HUMAN "Phosphate carrier protein, mitochondrial OS=Homo sapiens GN=SLC25A3 PE=1 SV=2" 69 40525 2 2 2 2 1263 3734 1 1 1 518.7604 1035.5062 2 1035.5066 -0.0004 0 23.36 0.035 K FGFYEVFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5106.5106.2.dta 53 1 MPCP_HUMAN "Phosphate carrier protein, mitochondrial OS=Homo sapiens GN=SLC25A3 PE=1 SV=2" 69 40525 2 2 2 2 2411 1545 1 1 1 681.361 1360.7074 2 1360.7099 -0.0025 0 67.18 1.90E-06 R IQTQPGYANTLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2739.2739.2.dta 54 1 SRPRB_HUMAN Signal recognition particle receptor subunit beta OS=Homo sapiens GN=SRPRB PE=1 SV=3 68 29912 1 1 1 1 3437 1588 1 1 1 894.9498 1787.8851 2 1787.8901 -0.005 0 67.77 4.50E-07 R SAAPSTLDSSSTAPAQLGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2784.2784.2.dta 55 1 RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B~ OS=Homo sapiens GN=SNRPB PE=1 SV=2 67 24765 3 3 3 3 667 3797 1 1 1 441.8104 881.6062 2 881.6062 0 0 54.77 3.30E-06 R VLGLVLLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5175.5175.2.dta 55 1 RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B~ OS=Homo sapiens GN=SNRPB PE=1 SV=2 67 24765 3 3 3 3 1471 1086 1 1 1 546.2686 1090.5226 2 1090.5229 -0.0004 0 21.55 0.021 K MLQHIDYR M Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2228.2228.2.dta 55 1 RSMB_HUMAN Small nuclear ribonucleoprotein-associated proteins B and B~ OS=Homo sapiens GN=SNRPB PE=1 SV=2 67 24765 3 3 3 3 4497 1958 1 1 1 728.7026 2183.0861 3 2183.0892 -0.0032 1 19.87 0.015 R GENLVSMTVEGPPPKDTGIAR V Oxidation (M) 0.000000100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3193.3193.3.dta 56 1 TXTP_HUMAN "Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2" 63 34333 3 3 2 2 1954 3531 1 1 1 617.8555 1233.6964 2 1233.6969 -0.0005 0 34.93 0.0014 R GLSSLLYGSIPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4892.4892.2.dta 56 1 TXTP_HUMAN "Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2" 63 34333 3 3 2 2 2070 606 1 1 1 642.3211 1282.6277 2 1282.6306 -0.0029 0 39.03 0.00072 K FIHDQTSPNPK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1693.1693.2.dta 56 1 TXTP_HUMAN "Tricarboxylate transport protein, mitochondrial OS=Homo sapiens GN=SLC25A1 PE=1 SV=2" 63 34333 3 3 2 2 2071 605 1 1 1 428.5505 1282.6296 3 1282.6306 -0.001 0 27.96 0.0094 K FIHDQTSPNPK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1692.1692.3.dta 57 1 RT07_HUMAN "28S ribosomal protein S7, mitochondrial OS=Homo sapiens GN=MRPS7 PE=1 SV=2" 62 28230 1 1 1 1 3408 1639 1 1 1 583.6393 1747.8962 3 1747.8992 -0.003 1 61.94 1.60E-06 R KPVEELTEEEKYVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2841.2841.3.dta 58 1 SPIN4_HUMAN Spindlin-4 OS=Homo sapiens GN=SPIN4 PE=1 SV=1 61 28699 3 3 3 3 422 1893 1 1 1 408.745 815.4755 2 815.4752 0.0002 0 25.28 0.025 R LADSLIGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3123.3123.2.dta 58 1 SPIN4_HUMAN Spindlin-4 OS=Homo sapiens GN=SPIN4 PE=1 SV=1 61 28699 3 3 3 3 1684 3484 1 1 1 576.8527 1151.6909 2 1151.6914 -0.0005 0 38.52 0.00014 R VLALEILPER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4842.4842.2.dta 58 1 SPIN4_HUMAN Spindlin-4 OS=Homo sapiens GN=SPIN4 PE=1 SV=1 61 28699 3 3 3 3 3339 3330 1 1 1 568.3452 1702.0138 3 1702.0141 -0.0003 1 29.69 0.0011 R VLALEILPERVPTPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4678.4678.3.dta 59 1 HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens GN=HNRNPK PE=1 SV=1 61 51230 2 2 2 2 3433 1562 1 1 1 890.9013 1779.7881 2 1779.7911 -0.0031 0 32.37 0.0014 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2755.2755.2.dta 59 1 HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens GN=HNRNPK PE=1 SV=1 61 51230 2 2 2 2 3664 3173 1 1 1 959.0193 1916.024 2 1916.0255 -0.0015 0 45.99 9.40E-05 R GSYGDLGGPIITTQVTIPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4513.4513.2.dta 60 1 RL19_HUMAN 60S ribosomal protein L19 OS=Homo sapiens GN=RPL19 PE=1 SV=1 60 23565 2 2 2 2 798 5513 1 1 1 462.2746 922.5346 2 922.5349 -0.0003 0 33.49 0.0017 R KPVTVHSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.999.999.2.dta 60 1 RL19_HUMAN 60S ribosomal protein L19 OS=Homo sapiens GN=RPL19 PE=1 SV=1 60 23565 2 2 2 2 1023 1057 1 1 1 493.7671 985.5196 2 985.5192 0.0004 0 45.68 0.00018 K LLADQAEAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2196.2196.2.dta 61 1 ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens GN=ARPC2 PE=1 SV=1 55 34426 2 2 2 2 1243 2459 1 1 1 515.3132 1028.6119 2 1028.6117 0.0002 0 19.49 0.031 R IIEETLALK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3751.3751.2.dta 61 1 ARPC2_HUMAN Actin-related protein 2/3 complex subunit 2 OS=Homo sapiens GN=ARPC2 PE=1 SV=1 55 34426 2 2 2 2 2229 1827 1 1 1 662.3481 1322.6817 2 1322.683 -0.0013 0 54.22 2.80E-05 K ELQAHGADELLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3050.3050.2.dta 62 1 MOB1A_HUMAN MOB kinase activator 1A OS=Homo sapiens GN=MOB1A PE=1 SV=4 50 25235 1 1 1 1 2066 3622 1 1 1 641.8663 1281.718 2 1281.718 0 0 50.29 3.30E-05 R ELAPLQELIEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4989.4989.2.dta 63 1 H2B1B_HUMAN Histone H2B type 1-B OS=Homo sapiens GN=HIST1H2BB PE=1 SV=2 50 13942 2 2 2 2 720 34 1 1 1 451.2538 900.493 2 900.493 0.0001 1 35.69 0.0019 R LAHYNKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1038.1038.2.dta 63 1 H2B1B_HUMAN Histone H2B type 1-B OS=Homo sapiens GN=HIST1H2BB PE=1 SV=2 50 13942 2 2 2 2 911 2911 1 1 1 477.3049 952.5952 2 952.5957 -0.0005 0 31.13 0.00096 R LLLPGELAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4238.4238.2.dta 63 H2B2C_HUMAN Putative histone H2B type 2-C OS=Homo sapiens GN=HIST2H2BC PE=5 SV=3 36 21971 1 1 1 1 720 34 1 0 1 451.2538 900.493 2 900.493 0.0001 1 35.69 0.0019 R LAHYNKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1038.1038.2.dta 63 H2B1A_HUMAN Histone H2B type 1-A OS=Homo sapiens GN=HIST1H2BA PE=1 SV=3 31 14159 1 1 1 1 911 2911 1 0 1 477.3049 952.5952 2 952.5957 -0.0005 0 31.13 0.00096 R LLLPGELAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4238.4238.2.dta 64 1 C1QBP_HUMAN "Complement component 1 Q subcomponent-binding protein, mitochondrial OS=Homo sapiens GN=C1QBP PE=1 SV=1" 49 31742 1 1 1 1 4824 3690 1 1 1 1144.0867 2286.1588 2 2286.1631 -0.0043 0 49.29 5.70E-05 K VEEQEPELTSTPNFVVEVIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5059.5059.2.dta 65 1 MLF2_HUMAN Myeloid leukemia factor 2 OS=Homo sapiens GN=MLF2 PE=1 SV=1 48 28186 1 1 1 1 1041 68 1 1 1 495.2597 988.5049 2 988.505 -0.0001 1 47.59 0.00016 R RLESSGAGGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1075.1075.2.dta 66 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 46 18296 1 1 1 1 3436 2790 1 1 1 894.4677 1786.9208 2 1786.92 0.0007 0 46 0.00017 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4110.4110.2.dta 67 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 45 71184 1 1 1 1 3105 4043 1 1 1 805.4028 1608.791 2 1608.7923 -0.0013 0 45.22 9.70E-05 R DLYEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5432.5432.2.dta 68 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 43 39125 6 6 1 1 4543 3599 1 1 1 737.7047 2210.0923 3 2210.0862 0.0061 1 19.6 0.021 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4966.4966.3.dta 68 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 43 39125 6 6 1 1 4552 4526 1 1 1 737.7053 2210.0941 3 2210.0862 0.0079 1 18.91 0.024 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5955.5955.3.dta 68 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 43 39125 6 6 1 1 4553 4027 1 1 1 737.7054 2210.0943 3 2210.0862 0.0081 1 22.27 0.011 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5416.5416.3.dta 68 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 43 39125 6 6 1 1 4554 3884 1 1 1 737.7054 2210.0943 3 2210.0862 0.0081 1 21.17 0.022 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5267.5267.3.dta 68 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 43 39125 6 6 1 1 4560 4851 1 1 1 737.7056 2210.0951 3 2210.0862 0.0088 1 24.97 0.019 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6330.6330.3.dta 68 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 43 39125 6 6 1 1 4565 4160 1 1 1 737.7058 2210.0954 3 2210.0862 0.0092 1 17.89 0.035 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5554.5554.3.dta 69 1 HNRPL_HUMAN Heterogeneous nuclear ribonucleoprotein L OS=Homo sapiens GN=HNRNPL PE=1 SV=2 43 64720 1 1 1 1 1805 277 1 1 1 602.7807 1203.5468 2 1203.548 -0.0011 0 42.69 0.0002 K ISRPGDSDDSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1305.1305.2.dta 70 1 STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 41 145728 5 5 1 1 582 2105 1 1 1 428.766 855.5174 2 855.5178 -0.0003 0 22.21 0.022 K EAALIALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3357.3357.2.dta 70 1 STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 41 145728 5 5 1 1 583 2767 1 1 1 428.766 855.5174 2 855.5178 -0.0003 0 22.77 0.019 K EAALIALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4088.4088.2.dta 70 1 STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 41 145728 5 5 1 1 584 2266 1 1 1 428.766 855.5175 2 855.5178 -0.0003 0 23.94 0.015 K EAALIALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3538.3538.2.dta 70 1 STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 41 145728 5 5 1 1 585 2603 2 1 1 428.7661 855.5177 2 855.5178 -0.0001 0 22.71 0.02 K EAALIALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3913.3913.2.dta 70 1 STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 41 145728 5 5 1 1 588 1940 2 1 1 428.7673 855.5201 2 855.5178 0.0024 0 21.43 0.026 K EAALIALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3176.3176.2.dta 71 1 KV401_HUMAN Immunoglobulin kappa variable 4-1 OS=Homo sapiens GN=IGKV4-1 PE=1 SV=1 39 13486 1 1 1 1 1571 3465 1 1 1 561.8185 1121.6225 2 1121.6233 -0.0008 0 38.72 0.00023 K LLIYWASTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4822.4822.2.dta 72 1 ROA2_HUMAN Heterogeneous nuclear ribonucleoproteins A2/B1 OS=Homo sapiens GN=HNRNPA2B1 PE=1 SV=2 36 37464 1 1 1 1 2453 1786 1 1 1 689.3165 1376.6184 2 1376.6222 -0.0038 0 36.24 0.00099 R GGGGNFGPGPGSNFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3004.3004.2.dta 73 1 CPSF2_HUMAN Cleavage and polyadenylation specificity factor subunit 2 OS=Homo sapiens GN=CPSF2 PE=1 SV=2 36 89286 1 1 1 1 647 1035 1 1 1 437.2566 872.4986 2 872.4967 0.0019 0 35.76 0.0025 K ITEIELR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2172.2172.2.dta 74 1 ROA0_HUMAN Heterogeneous nuclear ribonucleoprotein A0 OS=Homo sapiens GN=HNRNPA0 PE=1 SV=1 35 30993 1 1 1 1 1646 5406 1 1 1 569.783 1137.5515 2 1137.5527 -0.0012 0 34.63 0.0026 R EDSARPGAHAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.880.880.2.dta 75 1 FILA_HUMAN Filaggrin OS=Homo sapiens GN=FLG PE=1 SV=3 33 435036 3 3 1 1 307 1284 1 1 1 389.1889 776.3632 2 776.3678 -0.0046 0 25.45 0.021 R HPGSSHR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2450.2450.2.dta 75 1 FILA_HUMAN Filaggrin OS=Homo sapiens GN=FLG PE=1 SV=3 33 435036 3 3 1 1 308 1446 1 1 1 389.1897 776.3649 2 776.3678 -0.0029 0 23.96 0.03 R HPGSSHR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2629.2629.2.dta 75 1 FILA_HUMAN Filaggrin OS=Homo sapiens GN=FLG PE=1 SV=3 33 435036 3 3 1 1 309 1124 1 1 1 389.1902 776.3658 2 776.3678 -0.002 0 25.62 0.02 R HPGSSHR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2271.2271.2.dta 76 1 LRMP_HUMAN Lymphoid-restricted membrane protein OS=Homo sapiens GN=LRMP PE=1 SV=3 32 62767 4 4 1 1 581 2938 1 1 1 428.766 855.5174 2 855.5178 -0.0004 0 19.41 0.042 R VTIASLPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4267.4267.2.dta 76 1 LRMP_HUMAN Lymphoid-restricted membrane protein OS=Homo sapiens GN=LRMP PE=1 SV=3 32 62767 4 4 1 1 584 2266 2 0 1 428.766 855.5175 2 855.5178 -0.0003 0 18.67 0.05 R VTIASLPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3538.3538.2.dta 76 1 LRMP_HUMAN Lymphoid-restricted membrane protein OS=Homo sapiens GN=LRMP PE=1 SV=3 32 62767 4 4 1 1 585 2603 1 0 1 428.7661 855.5177 2 855.5178 -0.0001 0 24.83 0.012 R VTIASLPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3913.3913.2.dta 76 1 LRMP_HUMAN Lymphoid-restricted membrane protein OS=Homo sapiens GN=LRMP PE=1 SV=3 32 62767 4 4 1 1 588 1940 1 0 1 428.7673 855.5201 2 855.5178 0.0023 0 23.35 0.017 R VTIASLPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3176.3176.2.dta 77 1 ARHG2_HUMAN Rho guanine nucleotide exchange factor 2 OS=Homo sapiens GN=ARHGEF2 PE=1 SV=4 31 112386 1 1 1 1 1701 2689 1 1 1 579.8401 1157.6656 2 1157.6656 0 0 31.08 0.0051 R QDLTTALGLVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4007.4007.2.dta 78 1 CPSF5_HUMAN Cleavage and polyadenylation specificity factor subunit 5 OS=Homo sapiens GN=NUDT21 PE=1 SV=1 30 26268 1 1 1 1 1547 3285 1 1 1 559.3337 1116.6528 2 1116.6543 -0.0015 0 30.49 0.0024 K LFLVQLQEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4630.4630.2.dta 79 1 RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 29 157537 2 2 1 1 757 2292 1 1 1 457.2458 912.477 2 912.4851 -0.0081 0 24.13 0.026 R AVMATHGVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3566.3566.2.dta 79 1 RPC1_HUMAN DNA-directed RNA polymerase III subunit RPC1 OS=Homo sapiens GN=POLR3A PE=1 SV=2 29 157537 2 2 1 1 758 3414 1 1 1 457.2458 912.4771 2 912.4851 -0.008 0 25.75 0.015 R AVMATHGVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4769.4769.2.dta 80 1 SHRM3_HUMAN Protein Shroom3 OS=Homo sapiens GN=SHROOM3 PE=1 SV=2 29 218321 1 1 1 1 850 592 1 1 1 466.7431 931.4717 2 931.4723 -0.0006 1 28.76 0.012 R SSPATADKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1678.1678.2.dta 81 1 PKP2_HUMAN Plakophilin-2 OS=Homo sapiens GN=PKP2 PE=1 SV=2 27 97868 1 1 1 1 1595 18 1 1 1 565.3191 1128.6236 2 1128.6138 0.0098 0 27.31 0.019 R NLSLQNEIAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1020.1020.2.dta 82 1 MAGB1_HUMAN Melanoma-associated antigen B1 OS=Homo sapiens GN=MAGEB1 PE=1 SV=2 27 39184 1 1 1 1 691 5417 1 1 1 449.2432 896.4719 2 896.4716 0.0003 0 27.04 0.0068 K VAHATAAEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.893.893.2.dta 83 1 RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens GN=DLC1 PE=1 SV=4 26 172196 1 1 1 1 393 664 1 1 1 402.714 803.4134 2 803.4137 -0.0004 0 26.37 0.027 R QEVSSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1758.1758.2.dta 84 1 CBPC4_HUMAN Cytosolic carboxypeptidase 4 OS=Homo sapiens GN=AGBL1 PE=1 SV=2 26 121915 1 1 1 1 1967 3736 1 1 1 620.848 1239.6814 2 1239.6836 -0.0022 0 26.09 0.011 R HRPYQVITAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5108.5108.2.dta 85 1 DAPLE_HUMAN Protein Daple OS=Homo sapiens GN=CCDC88C PE=1 SV=3 26 229231 1 1 1 1 951 466 1 1 1 485.7433 969.4721 2 969.4628 0.0093 0 25.79 0.014 K GSSEQLHGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1538.1538.2.dta 86 1 TT39B_HUMAN Tetratricopeptide repeat protein 39B OS=Homo sapiens GN=TTC39B PE=1 SV=4 26 77876 1 1 1 1 1806 2889 1 1 1 602.8197 1203.6249 2 1203.6216 0.0032 1 25.79 0.029 - MDAVLACRLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4216.4216.2.dta 87 1 DPP10_HUMAN Inactive dipeptidyl peptidase 10 OS=Homo sapiens GN=DPP10 PE=1 SV=2 25 91401 1 1 1 1 238 759 1 1 1 366.2181 730.4217 2 730.4225 -0.0008 0 25.25 0.031 R LGSVEVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1863.1863.2.dta 88 1 FSCB_HUMAN Fibrous sheath CABYR-binding protein OS=Homo sapiens GN=FSCB PE=2 SV=3 25 87903 1 1 1 1 962 1166 1 1 1 485.7565 969.4984 2 969.4992 -0.0008 1 24.95 0.019 K SSSPKATHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2319.2319.2.dta 89 1 PO3F1_HUMAN "POU domain, class 3, transcription factor 1 OS=Homo sapiens GN=POU3F1 PE=2 SV=3" 25 45696 2 2 1 1 474 4904 1 1 1 416.7424 831.4703 2 831.4702 0.0001 0 22.88 0.038 R TSIEVGVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6390.6390.2.dta 89 1 PO3F1_HUMAN "POU domain, class 3, transcription factor 1 OS=Homo sapiens GN=POU3F1 PE=2 SV=3" 25 45696 2 2 1 1 476 4354 1 1 1 416.7424 831.4703 2 831.4702 0.0001 0 23.49 0.042 R TSIEVGVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5762.5762.2.dta 90 1 MBNL3_HUMAN Muscleblind-like protein 3 OS=Homo sapiens GN=MBNL3 PE=1 SV=2 25 39361 1 1 1 1 1146 1533 1 1 1 503.7507 1005.4869 2 1005.4913 -0.0045 1 24.7 0.029 R SDKLEVCR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2725.2725.2.dta 91 1 ZN562_HUMAN Zinc finger protein 562 OS=Homo sapiens GN=ZNF562 PE=2 SV=2 24 49843 1 1 1 1 840 25 1 1 1 465.2435 928.4724 2 928.4726 -0.0003 0 24.18 0.026 R SSTLTQHR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1028.1028.2.dta 92 1 PANK1_HUMAN Pantothenate kinase 1 OS=Homo sapiens GN=PANK1 PE=1 SV=2 24 65153 1 1 1 1 577 1922 1 1 1 428.7422 855.4698 2 855.4715 -0.0017 0 24.16 0.012 K GNLHFIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3156.3156.2.dta 93 1 CC129_HUMAN Coiled-coil domain-containing protein 129 OS=Homo sapiens GN=CCDC129 PE=2 SV=2 24 117211 1 1 1 1 421 1019 1 1 1 408.74 815.4655 2 815.4613 0.0042 1 24.09 0.029 R ASKQNIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2154.2154.2.dta 94 1 K2C8_HUMAN "Keratin, type II cytoskeletal 8 OS=Homo sapiens GN=KRT8 PE=1 SV=7" 24 53671 1 1 1 1 613 1068 1 1 1 435.7194 869.4242 2 869.4243 -0.0001 0 23.94 0.012 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2208.2208.2.dta 95 1 F110A_HUMAN Protein FAM110A OS=Homo sapiens GN=FAM110A PE=1 SV=1 24 31594 1 1 1 1 795 684 1 1 1 461.2353 920.456 2 920.4563 -0.0003 1 23.74 0.035 R SKSDLSER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1780.1780.2.dta 96 1 CRIM1_HUMAN Cysteine-rich motor neuron 1 protein OS=Homo sapiens GN=CRIM1 PE=1 SV=1 24 121073 1 1 1 1 778 701 1 1 1 459.7354 917.4563 2 917.4567 -0.0004 0 23.57 0.047 R VQVDSSQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1799.1799.2.dta 97 1 GLCTK_HUMAN Glycerate kinase OS=Homo sapiens GN=GLYCTK PE=1 SV=1 23 55503 1 1 1 1 380 1618 1 1 1 400.7403 799.466 2 799.4664 -0.0004 1 23.44 0.041 R VGAELRR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2817.2817.2.dta 98 1 TECR_HUMAN Very-long-chain enoyl-CoA reductase OS=Homo sapiens GN=TECR PE=1 SV=1 22 36410 1 1 1 1 1748 1344 1 1 1 392.2148 1173.6225 3 1173.6241 -0.0016 1 22.09 0.037 K SLKDEDVLQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2515.2515.3.dta 99 1 SRRM4_HUMAN Serine/arginine repetitive matrix protein 4 OS=Homo sapiens GN=SRRM4 PE=1 SV=2 22 68974 1 1 1 1 1322 515 1 1 1 523.3024 1044.5903 2 1044.5927 -0.0024 1 21.55 0.047 K KSSLVPSTAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1592.1592.2.dta 100 1 BIN3_HUMAN Bridging integrator 3 OS=Homo sapiens GN=BIN3 PE=1 SV=1 21 29703 1 1 1 1 801 2492 1 1 1 462.7319 923.4492 2 923.4575 -0.0083 0 21 0.027 - MSWIPFK I Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3788.3788.2.dta 101 1 PHLB1_HUMAN Pleckstrin homology-like domain family B member 1 OS=Homo sapiens GN=PHLDB1 PE=1 SV=1 21 152038 1 1 1 1 1990 984 1 1 1 625.316 1248.6174 2 1248.6107 0.0067 1 20.75 0.045 K WMKSMIPAGGR A Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2115.2115.2.dta 102 1 MPP10_HUMAN U3 small nucleolar ribonucleoprotein protein MPP10 OS=Homo sapiens GN=MPHOSPH10 PE=1 SV=2 21 78930 1 1 1 1 305 5504 1 1 1 388.2372 774.4598 2 774.4599 -0.0002 1 20.57 0.034 K QLTKTGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.989.989.2.dta 103 1 LRC71_HUMAN Leucine-rich repeat-containing protein 71 OS=Homo sapiens GN=LRRC71 PE=2 SV=1 20 62243 1 1 1 1 288 3560 1 1 1 382.2393 762.464 2 762.464 0 0 19.98 0.032 R ILGVFSK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4923.4923.2.dta 104 1 DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens GN=DENND4C PE=1 SV=2 20 188563 1 1 1 1 790 2324 1 1 1 459.7556 917.4967 2 917.493 0.0037 1 19.97 0.045 K SSPAVSRSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3601.3601.2.dta 105 1 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 20 228701 1 1 1 1 1754 3028 1 1 1 589.3317 1176.6489 2 1176.6503 -0.0014 0 19.81 0.044 R LLGLGVTDFSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4361.4361.2.dta 106 1 MIC19_HUMAN MICOS complex subunit MIC19 OS=Homo sapiens GN=CHCHD3 PE=1 SV=1 19 26421 1 1 1 1 2942 1807 1 1 1 788.3616 1574.7087 2 1574.71 -0.0013 0 18.58 0.046 R YSGAYGASVSDEELK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.3027.3027.2.dta 107 1 F135B_HUMAN Protein FAM135B OS=Homo sapiens GN=FAM135B PE=2 SV=2 16 157041 1 1 1 1 1467 941 1 1 1 363.8524 1088.5355 3 1088.5284 0.0071 0 16.27 0.042 R DVAGAPMVSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2067.2067.3.dta 108 1 MKRN2_HUMAN Probable E3 ubiquitin-protein ligase makorin-2 OS=Homo sapiens GN=MKRN2 PE=1 SV=2 16 48278 1 1 1 1 5386 2856 1 1 1 1162.8573 3485.5501 3 3485.5351 0.0149 1 15.88 0.039 R ESRHVPNNEDVDMTELGDLFMHLSGVESSEP - Oxidation (M) 0.0000000000001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.4181.4181.3.dta 109 1 DPYL1_HUMAN Dihydropyrimidinase-related protein 1 OS=Homo sapiens GN=CRMP1 PE=1 SV=1 15 62487 1 1 1 1 4778 4520 1 1 1 757.0476 2268.121 3 2268.1056 0.0154 1 14.69 0.042 K AVATGKMDENQFVAVTSTNAAK I Oxidation (M) 0.0000001000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.5948.5948.3.dta 110 1 STAR9_HUMAN StAR-related lipid transfer protein 9 OS=Homo sapiens GN=STARD9 PE=1 SV=3 15 521840 1 1 1 1 395 1465 1 1 1 403.2677 804.5209 2 804.5221 -0.0012 0 14.64 0.034 R LLPPPLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.2650.2650.2.dta 111 1 ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=1 SV=3 14 76512 1 1 1 1 2575 141 1 1 1 474.2012 1419.5819 3 1419.5871 -0.0052 1 14.22 0.042 R AVREGMCDSDHK R Oxidation (M) 0.000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.1155.1155.3.dta 112 1 PASD1_HUMAN Circadian clock protein PASD1 OS=Homo sapiens GN=PASD1 PE=1 SV=1 14 88286 1 1 1 1 4111 4789 1 1 1 1055.035 2108.0555 2 2108.0385 0.017 1 13.88 0.05 K EPEEEQQKQQLQEQPLK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#1-5.6259.6259.2.dta