Header -------------------------------------------------------- Search title orb_190624_AE-MF-7_#2-1.raw Timestamp 2019-06-28T04:32:32Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/mascotdata/data/20190628/F081297.dat Peak list data path D:\data\oda\190624_AE-MF-7\orb_190624_AE-MF-7_#2-1.raw Peak list format Mascot generic Search type MIS Mascot version 2.6.0 Database SwissProt Fasta file SwissProt_2017_05.fasta Total sequences 554515 Total residues 198509421 Sequences after taxonomy filter 20202 Number of queries 5350 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter . . . . . . . . . . . . . . . . Homo sapiens (human) Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 11 1495 4 1 0 300.6945 599.3744 2 599.3755 -0.0011 0 29.36 0.013 R LAQLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2653.2653.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 12 1100 1 1 0 300.6949 599.3753 2 599.3755 -0.0001 0 28.07 0.017 R LAQLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2214.2214.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 25 28 1 1 1 305.6745 609.3344 2 609.3347 -0.0002 0 19.84 0.03 R QHGIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1032.1032.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 66 547 1 1 1 319.6789 637.3432 2 637.3435 -0.0003 0 26.11 0.019 R AVTGYK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1599.1599.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 109 1129 1 1 1 330.6873 659.36 2 659.3602 -0.0003 0 38.21 0.0032 R DLGVTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2246.2246.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 110 900 1 1 1 330.7 659.3854 2 659.3854 0 0 27.21 0.016 K LLSAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1992.1992.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 112 576 1 1 1 331.1976 660.3806 2 660.3806 0 0 25.12 0.032 K LLNSSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1632.1632.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 115 1272 1 1 1 332.7105 663.4064 2 663.4068 -0.0004 1 26.92 0.0088 R KLTFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2405.2405.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 155 1219 1 1 1 342.2319 682.4493 2 682.449 0.0003 1 38.01 0.00036 K KGLIPR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2346.2346.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 170 1123 1 1 1 343.7133 685.4121 2 685.4122 -0.0001 0 24.82 0.025 R INLAQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2239.2239.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 179 1022 1 1 0 344.7031 687.3916 2 687.3915 0.0001 0 24.78 0.047 K LLSAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2127.2127.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 184 473 1 1 1 346.6733 691.3321 2 691.3323 -0.0002 0 37.27 0.0023 R VAEMSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1517.1517.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 251 581 1 1 0 364.7424 727.4703 2 727.4704 -0.0002 1 20.87 0.038 R LAQLRK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1637.1637.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 253 1137 2 1 1 365.2162 728.4179 2 728.4181 -0.0002 0 28.07 0.017 K LQEALR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2255.2255.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 269 2090 3 1 1 372.2242 742.4338 2 742.4337 0 0 24.31 0.033 R DVQLIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3314.3314.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 335 486 1 1 1 387.2062 772.3979 2 772.398 -0.0001 0 24.46 0.02 R HYLQGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1532.1532.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 347 2668 1 1 1 390.224 778.4334 2 778.4337 -0.0003 0 46.54 0.00019 R LSFSGLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3954.3954.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 407 2819 1 1 1 401.2632 800.5119 2 800.512 -0.0001 0 33 0.0017 K TISLVIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4115.4115.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 493 1 1 1 0 414.6869 827.3592 2 827.3596 -0.0003 1 22.36 0.012 R KYSCDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1002.1002.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 495 1857 1 1 1 414.7506 827.4867 2 827.4865 0.0002 0 32.6 0.0031 R VAQLLER W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3054.3054.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 521 753 1 1 1 418.2206 834.4267 2 834.4269 -0.0002 0 33.82 0.0049 K MSAAQALK K Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1828.1828.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 565 1765 1 1 1 422.2377 842.4609 2 842.461 -0.0001 0 47 0.00018 R ANELQLR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2952.2952.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 567 1486 2 1 1 422.7297 843.4448 2 843.445 -0.0002 0 32.68 0.0046 R ELEQLGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2643.2643.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 584 1972 1 1 1 425.7362 849.4579 2 849.4596 -0.0017 0 42.23 0.00044 R LDLQYAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3182.3182.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 626 265 1 1 1 431.2555 860.4964 2 860.4967 -0.0004 1 32.01 0.0039 R TGKVTVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1292.1292.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 704 2777 1 1 1 447.7281 893.4416 2 893.4429 -0.0013 0 32.31 0.0046 R LCFEGLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4073.4073.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 746 1494 1 1 1 451.2581 900.5016 2 900.5029 -0.0013 0 43.91 0.00057 K LAAIGEATR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2652.2652.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 748 3477 1 1 1 451.2895 900.5644 2 900.5644 0 0 56.67 3.90E-06 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4802.4802.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 749 351 1 1 1 451.7198 901.4251 2 901.4253 -0.0002 0 26.38 0.012 K ELQNAGDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1385.1385.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 751 2243 1 1 1 451.7508 901.487 2 901.4869 0.0001 0 28.86 0.01 K GLVEDTLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3484.3484.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 752 1711 1 1 1 451.7509 901.4873 2 901.4869 0.0004 0 44.22 0.00045 R LTVDEAVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2892.2892.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 780 1189 1 1 1 304.199 909.5753 3 909.576 -0.0007 0 20.4 0.0091 K AVVQLKPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2313.2313.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 781 1183 1 1 1 455.7953 909.5761 2 909.576 0.0002 0 44.42 3.60E-05 K AVVQLKPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2306.2306.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 798 2305 1 1 1 458.267 914.5195 2 914.5185 0.001 0 56.95 2.10E-05 K GLLSAEVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3552.3552.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 799 3327 1 1 1 458.274 914.5335 2 914.5338 -0.0003 0 32.28 0.0031 K LLLWSQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4643.4643.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 804 1854 1 1 0 458.7586 915.5027 2 915.5025 0.0002 0 39.23 0.0011 K LTVEEAVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3050.3050.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 809 1748 1 1 0 459.7555 917.4964 2 917.4971 -0.0006 0 32.95 0.0021 R VPVDVAYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2933.2933.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 816 2947 1 1 1 461.2738 920.5331 2 920.5331 0 0 21.14 0.04 K LSIYNALK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4247.4247.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 883 2257 1 1 1 470.2521 938.4896 2 938.4895 0.0001 0 30.95 0.0066 R LSVYQAMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3499.3499.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 906 510 1 1 1 472.7435 943.4725 2 943.4723 0.0002 0 28.2 0.0061 K ELAQEQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1558.1558.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 907 141 1 1 1 315.5099 943.508 3 943.5087 -0.0006 1 36.2 0.0025 R VKAEAEAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1157.1157.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 908 136 1 1 1 472.7614 943.5083 2 943.5087 -0.0003 1 59.02 1.20E-05 R VKAEAEAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1152.1152.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 924 2366 1 1 1 317.5304 949.5694 3 949.5709 -0.0014 0 15.61 0.027 K LHVAILER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3619.3619.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 925 2351 1 1 1 475.7922 949.5698 2 949.5709 -0.0011 0 37.07 0.0002 K LHVAILER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3603.3603.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 942 821 1 1 1 479.2595 956.5044 2 956.5039 0.0005 0 54.27 2.00E-05 R AQAEQAALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1904.1904.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 944 297 1 1 1 479.7567 957.4989 2 957.4991 -0.0002 1 39.96 0.00083 K ARIEAENR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1327.1327.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 945 1120 1 1 1 479.7712 957.5279 2 957.5284 -0.0004 0 32.39 0.006 R LYVHEAVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2236.2236.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 946 1125 1 1 1 320.1833 957.5279 3 957.5284 -0.0004 0 26.65 0.022 R LYVHEAVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2242.2242.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 956 1648 1 1 1 480.2615 958.5085 2 958.5083 0.0001 0 39.9 0.00086 R LQLEATER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2822.2822.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 964 853 1 1 1 481.7427 961.4709 2 961.4716 -0.0007 0 32.02 0.0065 R SAEAELQSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1939.1939.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 998 2378 1 1 1 488.2587 974.5028 2 974.5033 -0.0004 0 37.81 0.0016 K DLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3633.3633.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1024 2460 1 1 1 492.2919 982.5693 2 982.5712 -0.0019 0 54.59 8.70E-06 R LFNAIIHR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3724.3724.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1025 2469 1 1 1 328.5308 982.5706 3 982.5712 -0.0006 0 30.47 0.0017 R LFNAIIHR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3734.3734.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1030 1333 1 1 1 492.7592 983.5038 2 983.5036 0.0001 0 33.63 0.0026 R VPDVQDGVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2473.2473.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1055 2743 1 1 1 495.279 988.5435 2 988.5441 -0.0006 0 37.86 0.00076 R SELELTLGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4035.4035.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1090 856 1 1 1 500.2721 998.5296 2 998.5298 -0.0001 0 29.12 0.0022 K AHAFAVQQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1943.1943.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1095 1865 1 1 1 500.766 999.5175 2 999.5172 0.0003 0 44.38 8.20E-05 R VPLDVACAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3063.3063.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1097 478 1 1 1 500.7801 999.5456 2 999.5461 -0.0005 1 29.89 0.0083 R LRQAEVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1523.1523.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1098 485 1 1 1 334.1893 999.546 3 999.5461 -0.0001 1 23.3 0.037 R LRQAEVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1530.1530.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1106 1350 1 1 1 501.7651 1001.5156 2 1001.5141 0.0014 0 40.5 0.001 R QAEVELASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2492.2492.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1120 1509 1 1 1 503.2549 1004.4952 2 1004.496 -0.0008 0 28.93 0.0047 R LVASMEEAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2668.2668.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1132 867 1 1 1 504.777 1007.5395 2 1007.54 -0.0005 1 27.95 0.0076 K LRDVGAYSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1955.1955.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1139 3718 1 1 1 505.7869 1009.5592 2 1009.5596 -0.0004 0 28.6 0.0065 R AIYEVLFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5054.5054.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1155 1163 1 1 1 508.2803 1014.546 2 1014.5458 0.0002 0 81.18 6.60E-08 R LSVAAQEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2284.2284.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1175 2753 1 1 1 510.7952 1019.5759 2 1019.5764 -0.0005 0 62.56 2.10E-06 K LSVYAALQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4046.4046.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1176 685 1 1 1 511.2523 1020.4901 2 1020.491 -0.0009 0 50.53 7.70E-05 R LVASMEEAR R Oxidation (M) 0.000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1753.1753.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1186 2667 1 1 1 512.2897 1022.5648 2 1022.5648 0 0 46.81 0.00011 R SLSAIYLEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3953.3953.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1217 2885 1 1 1 515.2817 1028.5489 2 1028.5502 -0.0013 0 61.85 4.50E-06 K AELELELGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4184.4184.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1223 1139 1 1 1 515.3059 1028.5973 2 1028.5978 -0.0006 1 29.28 0.0043 R RLTVNEAVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2257.2257.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1229 1266 1 1 1 344.2012 1029.5817 3 1029.5818 -0.0002 1 30.56 0.0058 R LTVDEAVRK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2398.2398.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1230 1267 1 1 1 515.7982 1029.5818 2 1029.5818 -0.0001 1 39.96 0.00067 R LTVDEAVRK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2399.2399.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1231 1208 1 1 1 516.2902 1030.5659 2 1030.5658 0.0001 0 64.56 3.50E-06 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2334.2334.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1233 897 1 1 1 517.2581 1032.5017 2 1032.5022 -0.0005 0 50.35 7.70E-05 K MQAVQEATR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1988.1988.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1261 2916 1 1 1 521.7977 1041.5809 2 1041.5818 -0.0009 0 48.89 8.10E-05 R ALQALEELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4215.4215.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1262 2215 1 1 1 521.7983 1041.582 2 1041.5818 0.0002 0 51.22 4.00E-05 R LAAEQELIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3453.3453.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1300 1666 1 1 1 523.7853 1045.5561 2 1045.5556 0.0005 0 27.12 0.0036 R VPVDVAYQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2842.2842.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1320 3939 1 1 1 525.8039 1049.5932 2 1049.5943 -0.0011 0 44.54 0.00017 K LISLFQAMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5282.5282.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1324 1905 1 1 1 526.7637 1051.5129 2 1051.5121 0.0009 0 41.31 0.00022 R MVEGYQGLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3107.3107.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1339 1877 1 1 1 353.2046 1056.592 3 1056.5927 -0.0007 1 33.45 0.0036 R LRIEEEIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3076.3076.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1340 1873 1 1 1 529.3035 1056.5925 2 1056.5927 -0.0002 1 25.54 0.019 R LRIEEEIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3072.3072.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1346 1532 1 1 1 530.2758 1058.537 2 1058.5356 0.0013 0 53.44 2.90E-05 R GTQGAEEVLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2693.2693.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1349 441 1 1 1 530.2927 1058.5708 2 1058.572 -0.0012 1 54.37 4.20E-05 R LKAEATEAAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1482.1482.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1350 444 1 1 1 353.8645 1058.5717 3 1058.572 -0.0003 1 49.19 0.00011 R LKAEATEAAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1485.1485.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1377 849 1 1 1 533.7267 1065.4388 2 1065.4397 -0.0009 0 41.76 0.00013 R GCLDEETSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1935.1935.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1380 278 1 1 1 356.1928 1065.5567 3 1065.5567 0 0 32.59 0.0014 R QLAEAHAQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1306.1306.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1381 3301 1 1 1 533.8014 1065.5882 2 1065.5892 -0.001 0 42.51 0.00028 K LISLFQAMK K Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4617.4617.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1383 983 1 1 1 534.2562 1066.4978 2 1066.4978 0 1 31.29 0.0031 R GAYRDCLGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2084.2084.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1412 3535 1 1 1 537.3088 1072.603 2 1072.6029 0.0001 0 49.58 7.90E-05 K SLLAWQSLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4863.4863.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1427 1675 1 1 1 539.7618 1077.5091 2 1077.5091 0.0001 0 44.24 0.00016 R LAEDEAFQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2852.2852.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1436 1785 1 1 1 360.8606 1079.5599 3 1079.5611 -0.0012 1 36.14 0.0016 K ISYKDALDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2974.2974.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1437 1783 1 1 1 540.7873 1079.56 2 1079.5611 -0.0011 1 67.88 1.10E-06 K ISYKDALDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2972.2972.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1476 674 1 1 1 545.7718 1089.5291 2 1089.5302 -0.001 0 66.77 2.00E-06 R QSSEAEIQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1740.1740.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1478 2834 1 1 1 545.7941 1089.5737 2 1089.574 -0.0003 0 43.8 0.00015 R AEMEVLLASK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4130.4130.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1491 1651 1 1 1 546.793 1091.5715 2 1091.5724 -0.0009 0 36.45 0.0021 K GLVGPELHDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2825.2825.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1497 1094 1 1 1 547.7607 1093.5068 2 1093.5074 -0.0006 0 32.49 0.0029 R SMVEEGTGLR L Oxidation (M) 0.0100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2207.2207.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1502 508 1 1 1 549.2599 1096.5052 2 1096.505 0.0002 0 29.82 0.0054 R HHTAAFEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1556.1556.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1503 513 1 1 1 366.5092 1096.5056 3 1096.505 0.0006 0 39.31 0.00061 R HHTAAFEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1562.1562.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1506 2368 1 1 1 549.7372 1097.4598 2 1097.46 -0.0002 0 41.35 0.00011 K AFCGFEDPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3622.3622.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1512 2196 1 1 1 550.7883 1099.5621 2 1099.5622 -0.0001 0 72.58 4.10E-07 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3432.3432.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1517 2593 1 1 1 550.8008 1099.5871 2 1099.5873 -0.0002 0 54 3.80E-05 R QLLEEELAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3872.3872.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1522 523 1 1 1 551.2857 1100.5569 2 1100.5574 -0.0006 0 61.47 5.50E-06 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1573.1573.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1564 1397 1 1 1 555.8102 1109.6059 2 1109.608 -0.0021 0 38.13 0.00069 K AQLEPVASPAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2544.2544.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1575 585 1 1 1 557.3092 1112.6039 2 1112.605 -0.0012 1 39.47 0.00073 R RAQAEQAALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1642.1642.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1586 1743 1 1 1 558.3357 1114.6568 2 1114.6597 -0.0029 1 24.01 0.016 R LKTEAEIALK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2927.2927.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1603 694 1 1 1 559.793 1117.5714 2 1117.5727 -0.0013 1 59.65 1.10E-05 R SAEAELQSKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1763.1763.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1605 702 1 1 1 373.5316 1117.573 3 1117.5727 0.0003 1 25.45 0.026 R SAEAELQSKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1772.1772.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1606 3053 1 1 1 559.7968 1117.5791 2 1117.5801 -0.001 0 40.25 0.00076 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4356.4356.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1608 1702 1 1 1 560.2764 1118.5383 2 1118.539 -0.0007 0 45.61 0.00021 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2882.2882.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1620 1599 1 1 1 561.342 1120.6695 2 1120.6717 -0.0021 1 32.85 0.00083 K GLILKDHGIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2766.2766.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1621 1598 1 1 1 374.5639 1120.6698 3 1120.6717 -0.0019 1 31.03 0.0013 K GLILKDHGIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2765.2765.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1645 1307 1 1 1 564.8088 1127.6031 2 1127.6047 -0.0016 1 44.13 0.00028 R QRELEQLGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2444.2444.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1646 1320 1 1 1 376.8753 1127.6042 3 1127.6047 -0.0005 1 31.74 0.0048 R QRELEQLGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2458.2458.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1660 2213 1 1 1 566.7397 1131.4649 2 1131.4655 -0.0005 0 45.3 3.00E-05 R GYFSEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3450.3450.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1666 1847 1 1 1 378.5376 1132.5909 3 1132.591 -0.0001 1 29.99 0.01 R CISELKDIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3043.3043.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1672 1912 1 1 1 567.7946 1133.5747 2 1133.575 -0.0004 0 22.91 0.045 K QITMEELVR S Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3115.3115.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1705 1026 1 1 1 572.3039 1142.5932 2 1142.5931 0.0001 0 49.47 0.00011 R LQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2132.2132.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1706 727 1 1 1 572.309 1142.6034 2 1142.6044 -0.001 1 46.27 0.00022 K IKELQNAGDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1799.1799.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1725 1692 1 1 1 574.7374 1147.4602 2 1147.4604 -0.0002 0 20.01 0.01 R GYFSEEMNR V Oxidation (M) 0.000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2870.2870.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1744 2282 1 1 1 576.2822 1150.5498 2 1150.5506 -0.0008 0 42.54 0.0004 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3527.3527.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1772 2092 1 1 1 386.5558 1156.6456 3 1156.6451 0.0005 1 21.85 0.03 K AALEEVERLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3316.3316.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1781 1699 1 1 1 386.8872 1157.6398 3 1157.6404 -0.0006 1 22.32 0.05 R QKGLVEDTLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2878.2878.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1783 1117 1 1 1 580.3064 1158.5982 2 1158.5993 -0.0011 1 44.82 0.00032 R DVAEVDTVRR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2233.2233.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1784 2339 1 1 0 580.737 1159.4594 2 1159.4604 -0.001 0 31.91 0.0011 R GYFDEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3589.3589.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1785 994 1 1 1 580.7803 1159.546 2 1159.5469 -0.0009 0 52.46 3.00E-05 R SDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2096.2096.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1795 1243 1 1 1 582.3054 1162.5963 2 1162.5982 -0.0019 1 45.46 0.00021 R AQFEQLKDGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2373.2373.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1802 4060 1 1 1 582.7977 1163.5808 2 1163.5822 -0.0014 0 20.92 0.047 R LTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5406.5406.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1803 3338 1 1 1 582.7982 1163.5818 2 1163.5822 -0.0005 0 52.8 3.80E-05 R LTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4655.4655.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1805 4586 1 1 1 582.7985 1163.5824 2 1163.5822 0.0001 0 21.75 0.022 R LTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5986.5986.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1806 3107 1 1 1 582.8345 1163.6544 2 1163.655 -0.0006 0 45.04 0.00012 R QTLSIYQALK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4414.4414.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1831 1130 1 1 1 584.7588 1167.5031 2 1167.5044 -0.0013 0 36.91 0.00039 R SYVDPSTDER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2247.2247.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1843 2675 1 1 1 585.8215 1169.6284 2 1169.6292 -0.0008 0 30.93 0.004 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3962.3962.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1854 3040 1 1 1 586.3323 1170.6501 2 1170.6496 0.0006 0 48.61 0.00013 R QVEEEILALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4343.4343.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1856 2397 1 1 1 586.7428 1171.471 2 1171.4717 -0.0006 0 39.16 0.00014 R CDNFTSSWR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3654.3654.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1871 876 1 1 1 587.8119 1173.6093 2 1173.6102 -0.0008 1 42.07 0.00059 R IRSNAEDTLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1965.1965.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1873 1550 1 1 1 588.2711 1174.5277 2 1174.5288 -0.0012 0 34.54 0.001 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2713.2713.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1880 1820 1 1 0 588.7343 1175.4541 2 1175.4553 -0.0012 0 36.87 0.00021 R GYFDEEMNR V Oxidation (M) 0.000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3013.3013.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1898 1091 1 1 1 590.2871 1178.5597 2 1178.5601 -0.0005 1 32.82 0.0038 R DLDKADSMIR L Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2204.2204.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1913 1901 1 1 1 395.2085 1182.6036 3 1182.6033 0.0002 0 29.56 0.0047 R AGLVGPEFHEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3103.3103.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1937 3297 1 1 1 595.8421 1189.6697 2 1189.6707 -0.001 0 42.21 0.00022 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4613.4613.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1954 1417 1 1 1 397.8752 1190.6038 3 1190.6043 -0.0005 1 31.04 0.008 R FRELAEEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2566.2566.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 1957 3345 1 1 1 596.3254 1190.6362 2 1190.6369 -0.0007 0 54.58 2.10E-05 R LPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4662.4662.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2021 977 1 1 1 601.3196 1200.6247 2 1200.6251 -0.0004 0 28.58 0.0047 K EGVVGPELHHK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2077.2077.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2037 2512 1 1 1 603.3165 1204.6184 2 1204.6187 -0.0003 0 50.75 1.90E-05 R EGLTSIEEVTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3782.3782.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2063 147 1 1 1 403.8825 1208.6256 3 1208.6261 -0.0005 1 33.59 0.002 R RLEEQAAQHK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1164.1164.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2065 85 1 1 1 605.7994 1209.5842 2 1209.585 -0.0008 1 40.29 0.00058 R RQHEAEEGVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1094.1094.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2066 84 1 1 1 404.2022 1209.5847 3 1209.585 -0.0003 1 36.09 0.0015 R RQHEAEEGVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1093.1093.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2096 1946 1 1 1 608.309 1214.6035 2 1214.6044 -0.0009 0 47.06 0.00013 R GLHQSIEEFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3153.3153.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2097 1952 1 1 1 405.8755 1214.6048 3 1214.6044 0.0004 0 16.48 0.049 R GLHQSIEEFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3159.3159.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2100 1446 1 1 1 608.3191 1214.6236 2 1214.6255 -0.0019 0 43.32 0.00022 R RPELEDSTLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2598.2598.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2124 1248 1 1 1 407.5627 1219.6664 3 1219.6673 -0.0009 1 58.72 5.90E-06 R KGLVGPELHDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2378.2378.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2149 453 1 1 1 613.2986 1224.5827 2 1224.5847 -0.002 1 49.96 6.80E-05 R HGERDVEVER W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1495.1495.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2171 1722 1 1 1 614.338 1226.6614 2 1226.6619 -0.0005 0 53.35 3.40E-05 R QLQLAQEAAQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2904.2904.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2186 927 1 1 1 616.3173 1230.6201 2 1230.6204 -0.0003 1 59.36 1.20E-05 R SKEQAELEAAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2022.2022.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2187 930 1 1 1 411.2141 1230.6203 3 1230.6204 -0.0001 1 29.94 0.01 R SKEQAELEAAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2025.2025.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2202 1365 1 1 1 617.8114 1233.6083 2 1233.6102 -0.0019 1 29.88 0.0078 R LAEDEAFQRR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2508.2508.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2243 1775 1 1 1 621.8432 1241.6718 2 1241.6728 -0.0009 0 55.49 2.50E-05 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2963.2963.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2246 3003 1 1 1 622.3353 1242.656 2 1242.6568 -0.0008 0 46.11 0.0002 R SIQEELQQLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4304.4304.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2353 48 1 1 1 636.293 1270.5715 2 1270.5724 -0.0009 1 61.15 2.60E-06 R HGEKVEECQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1054.1054.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2361 1705 1 1 1 424.8861 1271.6365 3 1271.6371 -0.0006 1 28.02 0.011 R EDVRHYLQGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2885.2885.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2448 3507 1 1 1 642.8618 1283.709 2 1283.7085 0.0005 0 42.31 0.00035 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4832.4832.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2452 1204 1 1 1 643.3242 1284.6338 2 1284.635 -0.0012 1 52.22 1.30E-05 R AVTGYKDPYSGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2329.2329.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2454 316 1 1 1 643.333 1284.6515 2 1284.6534 -0.002 1 44.56 0.00021 K AQQLREEQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1347.1347.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2455 317 1 1 1 429.225 1284.6533 3 1284.6534 -0.0001 1 22.25 0.039 K AQQLREEQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1348.1348.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2469 646 1 1 1 643.8256 1285.6366 2 1285.6374 -0.0009 1 26.7 0.016 R QLAEEDAARQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1709.1709.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2472 2594 1 1 1 643.8458 1285.6771 2 1285.6779 -0.0008 0 50.74 4.40E-05 R WQAVLAQTDVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3873.3873.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2478 2467 1 1 1 644.3483 1286.6821 2 1286.683 -0.0009 0 67.43 1.60E-06 K AQVEQELTTLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3732.3732.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2521 1730 1 1 1 648.8067 1295.5989 2 1295.5994 -0.0005 0 58.63 3.40E-06 K GGELVYTDSEAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2913.2913.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2558 2262 1 1 1 650.3196 1298.6247 2 1298.6255 -0.0008 0 37.05 0.00041 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3505.3505.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2565 3308 1 1 1 650.3846 1298.7547 2 1298.7558 -0.0011 0 58.25 5.60E-06 K VTLVQTLEIQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4624.4624.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2567 1624 1 1 1 650.8276 1299.6406 2 1299.6419 -0.0013 0 64.16 3.00E-06 R QLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2795.2795.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2627 1031 1 1 1 655.3459 1308.6773 2 1308.6786 -0.0012 1 43.7 0.00038 K QAEEIGEKLHR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2137.2137.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2628 1019 1 1 1 437.2336 1308.6788 3 1308.6786 0.0003 1 26.08 0.0071 K QAEEIGEKLHR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2124.2124.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2682 2781 1 1 1 660.3436 1318.6727 2 1318.6769 -0.0042 0 71.27 6.80E-07 K LEQLFQDEVAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4077.4077.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2690 2914 1 1 1 660.8484 1319.6822 2 1319.6833 -0.0011 1 36.34 0.0022 R RLTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4213.4213.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2696 3186 1 1 1 661.8322 1321.6499 2 1321.6514 -0.0015 0 61.76 5.60E-06 R SQVEEELFSVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4495.4495.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2712 2037 1 1 1 443.2079 1326.6018 3 1326.6027 -0.0009 1 21.08 0.037 K AFCGFEDPRTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3255.3255.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2715 2669 1 1 1 664.3824 1326.7502 2 1326.7507 -0.0005 1 42.34 0.00025 R RQVEEEILALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3955.3955.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2725 1179 1 1 1 665.8389 1329.6633 2 1329.6636 -0.0003 1 37.88 0.00087 K SLAAEEEAARQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2302.2302.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2737 3833 1 1 1 667.887 1333.7594 2 1333.7605 -0.0011 0 75.52 9.10E-08 R IISLETYNLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5172.5172.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2818 1483 1 1 1 675.7806 1349.5467 2 1349.5484 -0.0017 0 50.67 8.60E-06 R DSQDAGGFGPEDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2639.2639.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2855 1999 1 1 1 678.8771 1355.7396 2 1355.7408 -0.0012 1 48.24 6.80E-05 R LAEVEAALEKQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3212.3212.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2857 3071 1 1 1 679.3502 1356.6859 2 1356.6885 -0.0026 0 45.46 9.10E-05 R QEQALLEEIER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4376.4376.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2859 2526 1 1 1 679.369 1356.7235 2 1356.7248 -0.0014 1 35.46 0.0024 R ERLAEVEAALEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3797.3797.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2865 293 1 1 1 679.8517 1357.6889 2 1357.6949 -0.006 1 47.35 0.00017 R LKQSAEEQAQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1323.1323.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2866 294 1 1 1 453.5704 1357.6894 3 1357.6949 -0.0056 1 41.62 0.00063 R LKQSAEEQAQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1324.1324.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2887 2493 1 1 1 683.335 1364.6554 2 1364.6572 -0.0018 0 53.8 3.40E-05 R QEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3760.3760.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2914 1433 1 1 1 686.856 1371.6975 2 1371.6994 -0.0019 1 54.7 2.70E-05 R ELAEQELEKQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2584.2584.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2938 1369 1 1 1 460.9099 1379.708 3 1379.7092 -0.0012 1 50.18 6.80E-05 K SHRVPLDVACAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2513.2513.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2953 1504 1 1 1 692.3875 1382.7604 2 1382.763 -0.0026 1 72.79 2.40E-07 R QLQLAQEAAQKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2663.2663.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2954 1497 1 1 1 461.9277 1382.7614 3 1382.763 -0.0016 1 22.72 0.025 R QLQLAQEAAQKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2655.2655.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2958 1860 1 1 1 462.2477 1383.7214 3 1383.7218 -0.0005 1 33.37 0.0029 R QRGGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3057.3057.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2959 1471 1 1 1 462.2557 1383.7454 3 1383.747 -0.0016 1 30.52 0.0024 K AQAEVEGLGKGVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2626.2626.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2960 1479 1 1 1 692.8803 1383.7461 2 1383.747 -0.0009 1 77.41 1.30E-07 K AQAEVEGLGKGVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2635.2635.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 2974 775 1 1 1 694.3489 1386.6832 2 1386.6851 -0.0019 1 48.23 0.0001 R ARSDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1853.1853.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3022 1793 1 1 1 699.9006 1397.7867 2 1397.7878 -0.0011 1 61.66 2.70E-06 R LKAEAELLQQQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2983.2983.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3023 1801 1 1 1 466.9367 1397.7882 3 1397.7878 0.0004 1 36.46 0.00082 R LKAEAELLQQQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2992.2992.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3043 1987 1 1 1 468.9098 1403.7075 3 1403.7078 -0.0003 1 23.58 0.014 R QLEMSAEAERLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3198.3198.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3046 3063 1 1 1 702.8866 1403.7586 2 1403.7595 -0.0008 1 39.81 0.00044 R GRLPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4367.4367.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3047 2350 1 1 1 702.8872 1403.7599 2 1403.762 -0.0021 1 59.71 4.10E-06 K TTVKDLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3602.3602.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3057 1470 1 1 1 705.8698 1409.725 2 1409.7263 -0.0013 0 52.24 3.90E-05 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2625.2625.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3058 1476 1 1 1 470.9158 1409.7255 3 1409.7263 -0.0008 0 56.68 1.40E-05 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2632.2632.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3063 1570 1 1 1 706.8951 1411.7756 2 1411.7783 -0.0027 1 52.52 2.60E-05 R LRLQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2734.2734.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3064 1576 1 1 1 471.5997 1411.7774 3 1411.7783 -0.0009 1 24.62 0.016 R LRLQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2740.2740.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3071 1682 1 1 1 472.2525 1413.7357 3 1413.7364 -0.0008 1 17.55 0.024 R GLHQSIEEFRAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2859.2859.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3080 2733 1 1 1 708.8452 1415.6758 2 1415.678 -0.0022 0 57.77 9.40E-06 R LEDLLQDAQDEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4024.4024.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3110 2407 1 1 1 714.3953 1426.776 2 1426.7779 -0.002 1 61.01 5.50E-06 K AAAGKAELELELGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3665.3665.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3111 2408 1 1 1 476.6001 1426.7786 3 1426.7779 0.0006 1 28.52 0.0021 K AAAGKAELELELGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3666.3666.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3117 2666 1 1 1 714.9005 1427.7864 2 1427.7871 -0.0008 0 80.11 3.10E-08 K IIITVVEEQEQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3952.3952.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3178 2559 1 1 1 721.4216 1440.8286 2 1440.83 -0.0014 1 65.17 9.40E-07 R VLAEKLAAIGEATR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3834.3834.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3188 324 1 1 1 722.8595 1443.7044 2 1443.7066 -0.0021 1 59.12 9.00E-06 R LRAETEQGEQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1356.1356.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3189 332 1 1 1 482.2426 1443.7059 3 1443.7066 -0.0007 1 49.82 7.70E-05 R LRAETEQGEQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1364.1364.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3190 3726 1 1 1 723.4088 1444.803 2 1444.8038 -0.0008 0 64.26 1.70E-06 K LQNVQIALDYLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5062.5062.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3213 2553 1 1 1 726.3693 1450.724 2 1450.7238 0.0001 1 34.27 0.0026 R DCLGRLDLQYAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3827.3827.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3236 3125 1 1 1 730.8901 1459.7657 2 1459.7671 -0.0014 0 69.59 7.80E-07 R SLESLHSFVAAATK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4432.4432.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3241 2816 1 1 1 731.3714 1460.7282 2 1460.7293 -0.0011 0 82.3 2.70E-08 R SQVMDEATALQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4112.4112.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3250 2334 1 1 1 733.8556 1465.6966 2 1465.6983 -0.0017 1 28.86 0.002 R SEFERLECLQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3584.3584.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3251 2342 1 1 1 489.5732 1465.6976 3 1465.6983 -0.0007 1 17.99 0.044 R SEFERLECLQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3593.3593.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3273 2379 1 1 1 739.3691 1476.7237 2 1476.7242 -0.0005 0 77.62 1.60E-07 R SQVMDEATALQLR E Oxidation (M) 0.0001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3634.3634.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3291 1809 1 1 1 743.8596 1485.7046 2 1485.7059 -0.0013 0 44.94 0.0002 R QQEELLAEENQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3000.3000.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3366 2113 1 1 1 755.8552 1509.6958 2 1509.6947 0.0011 0 43.44 0.00018 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3339.3339.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3390 2943 1 1 1 759.9111 1517.8076 2 1517.8089 -0.0013 1 73.92 1.20E-07 K AKLEQLFQDEVAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4243.4243.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3391 2868 1 1 1 506.947 1517.8192 3 1517.8202 -0.001 1 21.38 0.017 R LLFNDVQTLKDGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4166.4166.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3415 3962 1 1 1 764.872 1527.7295 2 1527.7318 -0.0023 0 79.96 3.90E-08 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5305.5305.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3427 3022 1 1 1 766.4438 1530.8731 2 1530.877 -0.0038 0 37.94 0.00036 K VLALPEPSPAAPTLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4324.4324.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3460 3087 1 1 1 769.9295 1537.8445 2 1537.8464 -0.002 0 85.75 9.40E-09 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4394.4394.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3461 3102 1 1 1 513.6227 1537.8462 3 1537.8464 -0.0002 0 41.61 0.00024 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4409.4409.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3481 2157 1 1 1 772.4247 1542.8348 2 1542.8365 -0.0017 1 76.71 1.00E-07 R QKAQVEQELTTLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3388.3388.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3482 2145 1 1 1 515.286 1542.836 3 1542.8365 -0.0005 1 50.93 4.00E-05 R QKAQVEQELTTLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3375.3375.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3508 4124 1 1 1 778.9164 1555.8183 2 1555.8205 -0.0022 0 42.07 0.00011 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5470.5470.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3509 2864 1 1 1 778.9169 1555.8193 2 1555.8205 -0.0012 0 84.25 1.50E-08 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4162.4162.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3510 4319 1 1 1 778.9172 1555.8198 2 1555.8205 -0.0007 0 65.51 2.00E-06 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5674.5674.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3511 2878 1 1 1 519.6142 1555.8208 3 1555.8205 0.0002 0 44.53 0.00019 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4177.4177.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3512 3500 2 1 1 778.9178 1555.8211 2 1555.8205 0.0006 0 28.19 0.011 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4825.4825.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3513 4618 1 1 1 778.9185 1555.8224 2 1555.8205 0.0018 0 42.53 0.0001 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6030.6030.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3514 4446 1 1 1 778.9188 1555.8231 2 1555.8205 0.0026 0 55.82 5.80E-06 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5815.5815.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3523 960 1 1 1 779.876 1557.7374 2 1557.7383 -0.0008 1 46.01 0.00013 R AAEEAEEARVQAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2058.2058.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3527 2284 1 1 1 780.9274 1559.8403 2 1559.842 -0.0017 1 43.21 0.00029 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3529.3529.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3528 2287 1 1 1 520.9543 1559.8412 3 1559.842 -0.0008 1 36.7 0.0013 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3533.3533.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3562 3573 1 1 1 783.9454 1565.8763 2 1565.8777 -0.0014 0 115.5 8.20E-12 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4902.4902.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3563 3575 1 1 1 522.9662 1565.8769 3 1565.8777 -0.0008 0 49.88 3.00E-05 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4904.4904.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3571 1704 1 1 1 785.4199 1568.8253 2 1568.827 -0.0017 1 77.21 1.30E-07 R LRQLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2884.2884.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3572 1713 1 1 1 523.9497 1568.8273 3 1568.827 0.0003 1 31.08 0.0016 R LRQLAEEDLAQQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2894.2894.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3576 3557 1 1 1 785.9063 1569.7981 2 1569.7998 -0.0018 0 61.78 1.80E-06 R DDGTGQLLLPLSDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4886.4886.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3634 2172 1 1 1 796.904 1591.7934 2 1591.7954 -0.0019 1 74.55 2.70E-07 R ARQEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3405.3405.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3635 2170 1 1 1 531.6058 1591.7957 3 1591.7954 0.0003 1 44.45 0.00027 R ARQEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3403.3403.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3693 2845 1 1 1 807.4402 1612.8659 2 1612.8672 -0.0013 0 76 1.20E-07 R LLDAQLSTGGIVDPSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4142.4142.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3697 3482 1 1 1 807.9559 1613.8973 2 1613.8988 -0.0015 1 58.19 4.20E-06 R SELELTLGKLEQVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4807.4807.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3698 3478 1 1 1 538.9732 1613.8978 3 1613.8988 -0.001 1 40.39 0.00025 R SELELTLGKLEQVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4803.4803.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3751 2409 1 1 1 821.4614 1640.9083 2 1640.9097 -0.0014 1 52.1 1.90E-05 K IIITVVEEQEQKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3667.3667.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3752 2406 1 1 1 547.977 1640.9091 3 1640.9097 -0.0006 1 21.1 0.024 K IIITVVEEQEQKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3664.3664.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3756 1489 1 1 1 548.2756 1641.8051 3 1641.807 -0.0019 1 34.6 0.00057 R RQQEELLAEENQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2646.2646.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3787 3805 1 1 1 827.4264 1652.8382 2 1652.841 -0.0028 0 89.16 8.70E-09 R DPYTGQSVSLFQALK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5143.5143.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3810 3472 1 1 1 831.4451 1660.8757 2 1660.8784 -0.0027 0 90.24 5.50E-09 K GIYQSLEGAVQAGQLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4797.4797.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3823 1827 1 1 1 833.9039 1665.7933 2 1665.7958 -0.0025 1 62.41 3.80E-06 R RYASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3020.3020.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3827 2822 1 1 1 834.4453 1666.8761 2 1666.8777 -0.0017 0 37.5 0.00076 K EAQAVPATLPELEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4118.4118.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3864 3119 1 1 1 844.9557 1687.8969 2 1687.8992 -0.0023 1 45.42 0.00017 R EGLTSIEEVTKNLQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4426.4426.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3881 1749 1 1 1 849.9533 1697.8921 2 1697.8948 -0.0027 1 100.96 4.50E-10 R IAEQQKAQAEVEGLGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2934.2934.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3882 1747 1 1 1 566.9716 1697.8928 3 1697.8948 -0.0019 1 44.22 0.00021 R IAEQQKAQAEVEGLGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2932.2932.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3897 2654 1 1 1 854.9166 1707.8186 2 1707.8203 -0.0017 0 63.9 2.40E-06 R LLDPEDVDVPQPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3938.3938.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3958 3187 1 1 1 576.3072 1725.8997 3 1725.901 -0.0012 1 27.74 0.0039 R RDDGTGQLLLPLSDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4496.4496.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 3969 3807 1 1 1 864.9545 1727.8945 2 1727.895 -0.0005 0 65.52 1.70E-06 R CITDPQTGLCLLPLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5145.5145.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4046 1957 1 1 1 877.9304 1753.8462 2 1753.8483 -0.0021 0 108.81 7.40E-11 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3165.3165.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4068 2681 1 1 1 588.6444 1762.9114 3 1762.9142 -0.0028 1 19.26 0.045 R ETFEKTPVEVPVGGFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3968.3968.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4069 2691 1 1 1 882.4648 1762.9151 2 1762.9142 0.001 1 46.68 0.00014 R ETFEKTPVEVPVGGFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3979.3979.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4082 3815 1 1 1 886.9299 1771.8452 2 1771.8451 0.0001 0 87.13 9.70E-09 R DPYSGSTISLFQAMQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5154.5154.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4095 2523 1 1 1 888.9775 1775.9405 2 1775.9417 -0.0012 0 69.52 6.00E-07 K AGVVGPELHEQLLSAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3794.3794.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4096 2521 1 1 1 592.9875 1775.9408 3 1775.9417 -0.0009 0 25.67 0.015 K AGVVGPELHEQLLSAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3792.3792.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4111 1924 1 1 1 891.8987 1781.7828 2 1781.7857 -0.0028 0 102.51 1.20E-10 K GYYSPYSVSGSGSTAGSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3128.3128.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4117 1562 1 1 1 892.4618 1782.909 2 1782.9112 -0.0021 0 99.29 7.20E-10 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2725.2725.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4118 1559 1 1 1 595.311 1782.9111 3 1782.9112 -0.0001 0 48.46 8.80E-05 R AALAHSEEVTASQVAATK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2722.2722.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4219 3489 1 1 1 904.9532 1807.8918 2 1807.8952 -0.0034 0 105.15 1.90E-10 K VQSGSESVIQEYVDLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4814.4814.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4220 3502 1 1 1 603.6384 1807.8935 3 1807.8952 -0.0018 0 38.01 0.001 K VQSGSESVIQEYVDLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4827.4827.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4282 3450 1 1 1 917.9489 1833.8832 2 1833.8857 -0.0025 0 101 5.60E-10 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4773.4773.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4283 3458 1 1 1 612.302 1833.8842 3 1833.8857 -0.0015 0 56.65 1.30E-05 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4782.4782.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4381 3227 1 1 1 628.6642 1882.9709 3 1882.9748 -0.0039 1 38.15 0.00026 R EQLRQEQALLEEIER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4538.4538.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4449 2625 1 1 1 957.9559 1913.8972 2 1913.9007 -0.0035 1 63.85 1.00E-06 K GGELVYTDSEARDVFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3907.3907.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4450 2632 1 1 1 638.9735 1913.8987 3 1913.9007 -0.002 1 35.52 0.0006 K GGELVYTDSEARDVFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3914.3914.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4472 3654 1 1 1 964.0181 1926.0216 2 1926.0244 -0.0028 0 70.52 4.00E-07 R CRPDQLTGLSLLPLSEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4987.4987.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4473 3649 1 1 1 643.0148 1926.0225 3 1926.0244 -0.0019 0 39.96 0.00045 R CRPDQLTGLSLLPLSEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4982.4982.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4486 3641 1 1 1 969.9935 1937.9724 2 1937.9768 -0.0044 0 85.25 1.60E-08 R TLLQGSGCLAGIYLEDTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4974.4974.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4505 976 1 1 1 650.3321 1947.9744 3 1947.9762 -0.0018 1 17.99 0.021 R TLARPGPEPAPATDERDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2076.2076.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4521 3784 1 1 1 980.4725 1958.9304 2 1958.9329 -0.0025 0 90.75 4.80E-09 R CVEDPETGLCLLPLTDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5122.5122.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4522 3789 1 1 1 653.9843 1958.9311 3 1958.9329 -0.0018 0 33.76 0.0024 R CVEDPETGLCLLPLTDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5127.5127.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4523 4353 1 1 1 980.4732 1958.9319 2 1958.9329 -0.0011 0 29.79 0.0016 R CVEDPETGLCLLPLTDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5710.5710.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4546 3385 1 1 1 657.0166 1968.028 3 1968.0275 0.0004 1 34.99 0.001 R ALQALEELRLQAEEAER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4705.4705.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4613 3298 1 1 1 662.6839 1985.0299 3 1985.0326 -0.0027 1 34.33 0.0018 R CITDPQTGLCLLPLKEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4614.4614.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4614 3311 1 1 1 993.5226 1985.0306 2 1985.0326 -0.0019 1 48 3.90E-05 R CITDPQTGLCLLPLKEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4627.4627.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4622 2538 1 1 1 994.4901 1986.9657 2 1986.968 -0.0024 0 102.81 2.30E-10 R LLEAQACTGGIIDPSTGER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3810.3810.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4633 3114 1 1 1 998.0516 1994.0887 2 1994.0909 -0.0022 0 124.99 7.10E-13 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4420.4420.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4732 1869 1 1 1 1020.4964 2038.9782 2 2038.9807 -0.0025 1 34.78 0.00062 K AEVVETTQVYTEEETRR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3067.3067.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4733 1856 1 1 1 680.6672 2038.9799 3 2038.9807 -0.0008 1 24.88 0.023 K AEVVETTQVYTEEETRR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3053.3053.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4754 2992 1 1 1 683.6914 2048.0524 3 2048.0538 -0.0014 0 50.98 3.70E-05 R LLEAQIATGGIIDPEESHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4293.4293.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4771 2138 1 1 1 686.044 2055.1102 3 2055.1113 -0.0011 1 35.93 0.0008 R LTVNEAVKEGVVGPELHHK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3367.3367.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4778 2973 1 1 1 687.0103 2058.0089 3 2058.013 -0.0041 1 24.63 0.0049 R AQAEAQQPTFDALRDELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4273.4273.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4779 2982 1 1 1 1030.0122 2058.0099 2 2058.013 -0.0031 1 38.24 0.00064 R AQAEAQQPTFDALRDELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4283.4283.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4792 1936 1 1 1 1035.473 2068.9315 2 2068.9338 -0.0023 0 88.59 3.90E-09 K AYSDPSTGEPATYGELQQR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3142.3142.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4816 1555 1 1 1 696.67 2086.9883 3 2086.9919 -0.0036 1 40.06 0.00031 R GYLNKDTHDQLSEPSEVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2718.2718.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4817 1573 1 1 1 1044.5021 2086.9896 2 2086.9919 -0.0023 1 52.35 1.20E-05 R GYLNKDTHDQLSEPSEVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2737.2737.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4825 2133 1 1 1 698.6899 2093.0478 3 2093.0501 -0.0023 1 26.82 0.0036 R SLQEEHVAVAQLREEAER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3362.3362.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4841 4152 1 1 1 1053.0494 2104.0843 2 2104.0841 0.0002 0 91.12 4.10E-09 R FLEVQYLTGGLIEPDTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5499.5499.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 4939 3337 1 1 1 732.7119 2195.1139 3 2195.1144 -0.0005 1 33.72 0.0021 R TLLQGSGCLAGIYLEDTKEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4654.4654.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 5014 3410 1 1 1 744.0401 2229.0985 3 2229.1021 -0.0036 1 29.45 0.0027 R CVEDPETGLCLLPLTDKAAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4730.4730.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 5015 3420 1 1 1 1115.5568 2229.099 2 2229.1021 -0.0031 1 71.21 4.40E-07 R CVEDPETGLCLLPLTDKAAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4740.4740.2.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 5021 2897 1 1 1 746.0956 2235.2651 3 2235.2699 -0.0048 1 42.16 6.10E-05 R LKAGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4196.4196.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 5040 3078 1 1 1 754.0879 2259.2418 3 2259.2474 -0.0055 1 44.51 8.10E-05 R LSAEAEKVLALPEPSPAAPTLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4384.4384.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 5097 2642 1 1 1 784.3987 2350.1742 3 2350.1764 -0.0022 1 37.21 0.00071 R LQLEETDHQKNLLDEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3925.3925.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 5138 2909 1 1 1 830.7488 2489.2245 3 2489.2261 -0.0016 1 55.17 1.60E-05 R AVTGYKDPYTGQQISLFQAMQK G Oxidation (M) 0.0000000000000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4208.4208.3.dta 1 1 PLEC_HUMAN Plectin OS=Homo sapiens GN=PLEC PE=1 SV=3 8104 533462 308 308 242 242 5145 2533 1 1 1 835.1055 2502.2946 3 2502.2965 -0.002 1 40.7 0.00028 R AHEEQLKEAQAVPATLPELEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3805.3805.3.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 125 934 3 0 1 336.2135 670.4125 2 670.4126 -0.0001 0 21.46 0.043 K LLAQAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2029.2029.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 179 1022 1 0 0 344.7031 687.3916 2 687.3915 0.0001 0 24.78 0.047 K LLSAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2127.2127.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 347 2668 2 0 1 390.224 778.4334 2 778.4337 -0.0003 0 33.34 0.0039 R VTFSGLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3954.3954.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 809 1748 1 0 0 459.7555 917.4964 2 917.4971 -0.0006 0 32.95 0.0021 R VPVDVAYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2933.2933.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 844 257 1 0 1 465.7594 929.5042 2 929.5043 -0.0001 1 47.99 0.00014 R RQEQTLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1284.1284.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 1582 2589 1 0 1 558.288 1114.5615 2 1114.5618 -0.0004 0 45.89 0.00016 R GLLEDVQEGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3867.3867.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 1635 2367 1 0 1 563.7993 1125.5841 2 1125.5819 0.0022 0 25.91 0.02 R GGEPQGPPFIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3620.3620.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 1685 3593 1 0 1 568.8554 1135.6963 2 1135.6965 -0.0002 0 55.84 2.60E-06 R APGSGLALLPLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4923.4923.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 1784 2339 1 0 0 580.737 1159.4594 2 1159.4604 -0.001 0 31.91 0.0011 R GYFDEEMNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3589.3589.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 1880 1820 1 0 0 588.7343 1175.4541 2 1175.4553 -0.0012 0 36.87 0.00021 R GYFDEEMNR V Oxidation (M) 0.000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3013.3013.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 2312 1641 1 0 1 630.3137 1258.6129 2 1258.6153 -0.0024 0 40.26 0.00059 R ELSEQLGQAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2814.2814.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 2470 2209 1 0 1 643.8328 1285.6511 2 1285.6514 -0.0003 0 29.78 0.0038 K LSELEPGTGDLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3446.3446.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 2653 3440 1 0 1 656.8818 1311.749 2 1311.7511 -0.0021 0 47.44 6.10E-05 R TTVPQLLASVQR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4762.4762.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 2731 1242 1 0 1 666.8528 1331.6911 2 1331.6932 -0.0021 1 58.11 1.30E-05 R VIEETEERLSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2372.2372.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 2734 1773 1 0 1 667.3682 1332.7219 2 1332.7249 -0.003 0 59.29 5.30E-06 R QALSTATATVSVGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2960.2960.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 2839 432 1 0 1 451.5565 1351.6475 3 1351.648 -0.0005 0 20.82 0.045 R AEAEAGSPRPDPR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1472.1472.3.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 3443 1976 1 0 1 768.389 1534.7634 2 1534.7661 -0.0027 1 56.59 8.80E-06 K TLQEVTEMDSVKR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3186.3186.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 3474 4141 1 0 1 771.9279 1541.8413 2 1541.8413 0 0 65.91 1.80E-06 R QVVSAVTALVEAAER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5488.5488.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 3492 1343 1 0 1 517.9274 1550.7603 3 1550.761 -0.0007 1 18.86 0.03 K TLQEVTEMDSVKR Y Oxidation (M) 0.0000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2484.2484.3.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 3702 4215 1 0 1 809.9308 1617.8471 2 1617.8515 -0.0044 0 71.94 1.80E-07 R AVPVWDVLASGYVSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5568.5568.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 3797 3182 1 0 1 827.9499 1653.8852 2 1653.8872 -0.002 0 61.69 3.20E-06 R LLDAQLATGGLVCPAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4490.4490.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 3840 3328 1 0 1 839.4465 1676.8785 2 1676.8807 -0.0022 0 69.58 6.20E-07 R YLEGTSCIAGVLVPAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4644.4644.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 4132 1603 1 0 1 596.6089 1786.805 3 1786.8081 -0.0031 0 56.79 9.50E-06 R EGQGEGETQEAAAAAAAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2770.2770.3.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 4133 1597 1 0 1 894.4099 1786.8053 2 1786.8081 -0.0029 0 109.34 5.50E-11 R EGQGEGETQEAAAAAAAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2764.2764.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 4385 3487 1 0 1 942.9976 1883.9807 2 1883.984 -0.0033 0 90.28 5.20E-09 R LSVEEAVAAGVVGGEIQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4812.4812.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 4386 3488 1 0 1 629.0012 1883.9818 3 1883.984 -0.0022 0 58.76 7.50E-06 R LSVEEAVAAGVVGGEIQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4813.4813.3.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 4432 3945 1 0 1 953.4614 1904.9082 2 1904.9125 -0.0043 0 64.08 2.60E-06 R CVPDPDTGLYMLQLAGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5288.5288.2.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 4632 2769 1 0 1 665.6873 1994.0399 3 1994.0433 -0.0033 0 43.74 0.00017 R QVSASELHTSGILGPETLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4064.4064.3.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 4902 1394 1 0 1 720.3389 2157.9948 3 2157.9998 -0.0051 1 70.01 4.70E-07 R SQREGQGEGETQEAAAAAAAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2540.2540.3.dta 1 2 EPIPL_HUMAN Epiplakin OS=Homo sapiens GN=EPPK1 PE=1 SV=2 995 557674 30 30 26 26 5133 3279 1 0 1 1232.0955 2462.1764 2 2462.1788 -0.0024 0 100.6 4.20E-10 R AVTGYTDPYTGQQISLFQAMQK G Oxidation (M) 0.0000000000000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4593.4593.2.dta 1 3 MACF1_HUMAN "Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4" 84 843033 3 3 3 3 804 1854 1 0 0 458.7586 915.5027 2 915.5025 0.0002 0 39.23 0.0011 R LTVEEAVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3050.3050.2.dta 1 3 MACF1_HUMAN "Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4" 84 843033 3 3 3 3 2253 2482 1 0 1 622.8455 1243.6765 2 1243.6772 -0.0007 0 35.23 0.0011 R LVLDTVNEVSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3748.3748.2.dta 1 3 MACF1_HUMAN "Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5 OS=Homo sapiens GN=MACF1 PE=1 SV=4" 84 843033 3 3 3 3 3573 4074 1 0 1 785.4429 1568.8713 2 1568.8774 -0.0061 0 47.99 5.20E-05 R VTLDPVQLESSLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5420.5420.2.dta 1 4 FR1L4_HUMAN Fer-1-like protein 4 OS=Homo sapiens GN=FER1L4 PE=2 SV=1 67 202166 3 3 2 2 567 1486 1 0 1 422.7297 843.4448 2 843.445 -0.0002 0 43.75 0.00036 R LEEQLGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2643.2643.2.dta 1 4 FR1L4_HUMAN Fer-1-like protein 4 OS=Homo sapiens GN=FER1L4 PE=2 SV=1 67 202166 3 3 2 2 1645 1307 3 0 1 564.8088 1127.6031 2 1127.6047 -0.0016 1 33.9 0.0029 R AGRLEEQLGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2444.2444.2.dta 1 4 FR1L4_HUMAN Fer-1-like protein 4 OS=Homo sapiens GN=FER1L4 PE=2 SV=1 67 202166 3 3 2 2 1646 1320 1 0 1 376.8753 1127.6042 3 1127.6047 -0.0005 1 31.74 0.0048 R AGRLEEQLGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2458.2458.3.dta 1 COR1B_HUMAN Coronin-1B OS=Homo sapiens GN=CORO1B PE=1 SV=1 44 54885 1 1 1 1 567 1486 1 0 1 422.7297 843.4448 2 843.445 -0.0002 0 43.75 0.00036 R LEEQLGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2643.2643.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 116 397 1 1 1 333.1846 664.3546 2 664.3544 0.0002 0 23.47 0.035 K AYVGQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1434.1434.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 213 1772 1 1 1 353.6921 705.3696 2 705.3697 -0.0001 0 35.35 0.0024 R SPFEVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2959.2959.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 281 916 1 1 1 374.672 747.3295 2 747.33 -0.0005 0 31.14 0.0029 R DWQSGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2009.2009.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 283 2568 1 1 1 375.7415 749.4684 2 749.4687 -0.0004 0 22.12 0.0061 R YTILIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3844.3844.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 287 1351 1 1 1 376.7005 751.3864 2 751.3865 0 0 26.84 0.0092 K FTVETR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2493.2493.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 296 803 1 1 0 378.7035 755.3924 2 755.3926 -0.0002 0 54.07 2.30E-05 R AGGPGLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1884.1884.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 364 810 1 1 1 393.709 785.4034 2 785.4032 0.0003 0 48.15 9.40E-05 K AEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1892.1892.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 421 2093 1 1 1 405.2207 808.4269 2 808.4265 0.0003 0 25.4 0.021 K YVICVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3317.3317.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 489 450 1 1 1 414.2403 826.466 2 826.4661 0 1 22.42 0.025 K ARGPGLEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1492.1492.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 511 452 1 1 0 416.7479 831.4812 2 831.4814 -0.0002 1 30.66 0.007 R VKESITR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1494.1494.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 674 891 1 1 1 438.2057 874.3968 2 874.3967 0.0001 0 39.13 0.00063 K CSGPGLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1982.1982.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 685 1858 1 1 1 441.7739 881.5332 2 881.5334 -0.0003 0 34.22 0.00059 K AGVAPLQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3055.3055.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 845 1345 1 1 1 465.7844 929.5542 2 929.5546 -0.0004 1 25.62 0.013 K IKVSGLGEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2486.2486.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 873 770 1 1 1 313.171 936.4911 3 936.4916 -0.0005 1 26.65 0.012 R VKETADFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1847.1847.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 875 766 1 1 1 469.2531 936.4916 2 936.4916 -0.0001 1 31.93 0.0036 R VKETADFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1843.1843.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 983 413 1 1 1 484.2637 966.5129 2 966.5134 -0.0006 0 35.31 0.0013 K VLPTHDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1452.1452.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1065 43 1 1 1 496.7269 991.4392 2 991.4393 -0.0001 0 21.85 0.024 K VGTECGNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1048.1048.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1126 1197 1 1 0 504.2672 1006.5199 2 1006.5196 0.0003 0 47.76 0.00012 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2322.2322.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1151 752 1 1 1 338.5295 1012.5665 3 1012.5665 0 1 52.61 2.10E-05 K VKAEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1827.1827.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1224 1353 1 1 1 515.7291 1029.4436 2 1029.4437 -0.0002 0 39.75 0.00014 K SSFTVDCSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2495.2495.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1429 302 1 1 1 540.2824 1078.5503 2 1078.552 -0.0017 0 58.37 3.90E-06 R VNVGAGSHPNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1332.1332.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1430 312 1 1 1 360.5246 1078.5519 3 1078.552 -0.0001 0 27.79 0.0051 R VNVGAGSHPNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1343.1343.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1449 2678 1 1 1 542.2714 1082.5282 2 1082.5284 -0.0003 0 42.15 0.00032 K SPFEVYVDK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3965.3965.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1456 3497 1 1 1 543.315 1084.6155 2 1084.6168 -0.0014 0 38.54 0.001 R LYSVSYLLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4822.4822.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1458 1045 1 1 1 543.793 1085.5715 2 1085.5717 -0.0002 0 32.98 0.00081 K VAQPTITDNK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2153.2153.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1469 2142 1 1 1 544.7858 1087.5571 2 1087.5583 -0.0012 0 39.71 0.001 R TPCEEILVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3372.3372.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1509 1531 1 1 1 550.2913 1098.568 2 1098.5669 0.001 0 27.08 0.016 K GTVEPQLEAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2692.2692.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1678 955 1 1 0 568.3142 1134.6139 2 1134.6145 -0.0007 1 46.9 0.00016 K KIQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2053.2053.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1717 1360 1 1 1 573.3292 1144.6438 2 1144.6452 -0.0014 1 36.56 0.0013 K GAGSGELKVTVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2503.2503.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1745 1945 1 1 1 576.3185 1150.6224 2 1150.6234 -0.001 1 28.14 0.0076 K DKGEYTLVVK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3152.3152.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1755 2216 1 1 1 577.8192 1153.6238 2 1153.6244 -0.0007 0 37.43 0.00041 R NGHVGISFVPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3454.3454.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1756 2220 1 1 1 385.5488 1153.6245 3 1153.6244 0.0001 0 39.92 0.00061 R NGHVGISFVPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3458.3458.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1857 2189 1 1 0 586.7997 1171.5849 2 1171.5873 -0.0024 1 33.26 0.0027 K DLAEDAPWKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3424.3424.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1978 139 1 1 1 598.8166 1195.6186 2 1195.6197 -0.0011 1 49.24 7.70E-05 R VKVEPSHDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1155.1155.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 1979 137 1 1 1 399.547 1195.6192 3 1195.6197 -0.0005 1 45.41 0.00021 R VKVEPSHDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1153.1153.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2108 1982 1 1 1 609.2913 1216.568 2 1216.5693 -0.0013 0 38.59 0.00066 K CSGPGLSPGMVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3193.3193.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2148 1921 1 1 1 613.2879 1224.5613 2 1224.5622 -0.001 0 74.28 1.50E-07 R EATTEFSVDAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3125.3125.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2156 4142 1 1 1 613.8293 1225.644 2 1225.6455 -0.0015 0 16.18 0.03 R AWGPGLEGGVVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5489.5489.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2157 2703 1 1 1 613.8297 1225.6449 2 1225.6455 -0.0007 0 58.51 3.30E-06 R AWGPGLEGGVVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3992.3992.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2159 4322 1 1 1 613.8302 1225.6458 2 1225.6455 0.0003 0 23.46 0.025 R AWGPGLEGGVVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5678.5678.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2183 1739 1 1 1 615.7993 1229.584 2 1229.5863 -0.0024 0 32.03 0.0018 K AHVVPCFDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2923.2923.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2184 1740 1 1 1 410.8689 1229.5848 3 1229.5863 -0.0015 0 29.33 0.0018 K AHVVPCFDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2924.2924.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2381 494 1 1 1 638.8531 1275.6917 2 1275.6935 -0.0018 1 34.39 0.0025 K ETGEHLVHVKK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1540.1540.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2432 2437 1 1 1 642.3759 1282.7372 2 1282.7398 -0.0026 0 51.7 2.80E-05 K VTVLFAGQHIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3698.3698.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2500 2057 1 1 1 645.8262 1289.6378 2 1289.6404 -0.0026 0 48.99 7.60E-05 K YGGQPVPNFPSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3277.3277.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2508 2488 1 1 1 646.8635 1291.7124 2 1291.7136 -0.0012 1 55.6 6.10E-06 K GKLDVQFSGLTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3755.3755.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2509 2502 1 1 1 431.5786 1291.714 3 1291.7136 0.0004 1 25.88 0.0079 K GKLDVQFSGLTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3770.3770.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2884 1731 1 1 1 682.8559 1363.6972 2 1363.6984 -0.0011 1 53.75 4.00E-05 K VDVGKDQEFTVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2914.2914.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 2931 2373 1 1 1 690.3399 1378.6653 2 1378.667 -0.0017 0 37.73 0.00066 K YGGPYHIGGSPFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3627.3627.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3031 4537 1 1 1 700.8259 1399.6372 2 1399.6408 -0.0036 0 42.92 0.00021 K YGGDEIPFSPYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5925.5925.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3034 4355 1 1 1 700.8279 1399.6412 2 1399.6408 0.0004 0 22.39 0.023 K YGGDEIPFSPYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5712.5712.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3074 4229 1 1 1 708.3766 1414.7387 2 1414.7416 -0.0028 0 38.92 0.00022 R IANLQTDLSDGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5581.5581.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3075 2997 1 1 1 708.377 1414.7395 2 1414.7416 -0.0021 0 80.08 3.10E-08 R IANLQTDLSDGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4298.4298.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3076 4487 1 1 1 708.3782 1414.7418 2 1414.7416 0.0002 0 30.38 0.0015 R IANLQTDLSDGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5866.5866.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3087 2127 1 1 1 709.4036 1416.7926 2 1416.7936 -0.0011 1 61.69 2.90E-06 R RLTVSSLQESGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3355.3355.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3109 2490 1 1 1 713.879 1425.7434 2 1425.7463 -0.003 0 65.01 8.00E-07 R EAGAGGLAIAVEGPSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3757.3757.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3118 1855 1 1 1 715.3624 1428.7102 2 1428.711 -0.0008 0 82.12 3.70E-08 K AFGPGLQGGSAGSPAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3052.3052.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3131 2290 1 1 1 717.8638 1433.7131 2 1433.7151 -0.002 0 70.68 7.60E-07 R ANLPQSFQVDTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3536.3536.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3181 739 1 1 1 721.8527 1441.6908 2 1441.691 -0.0002 0 101.22 4.40E-10 R AGQSAAGAAPGGGVDTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1813.1813.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3205 1688 1 1 1 725.3552 1448.6959 2 1448.697 -0.0011 0 47.22 8.60E-05 R AYGPGIEPTGNMVK K Oxidation (M) 0.00000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2866.2866.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3211 1998 1 1 1 484.2573 1449.7501 3 1449.7511 -0.0009 0 32.77 0.0016 K AGNNMLLVGVHGPR T Oxidation (M) 0.00001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3210.3210.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3344 2826 1 1 1 750.8799 1499.7452 2 1499.7467 -0.0015 0 105.53 2.00E-10 K DAGEGGLSLAIEGPSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4123.4123.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3375 2375 1 1 1 758.3832 1514.7518 2 1514.7518 0 0 30.42 0.0061 K FADQHVPGSPFSVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3629.3629.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3433 3764 1 1 1 767.3881 1532.7617 2 1532.7623 -0.0006 0 57.94 4.90E-06 R AEAGVPAEFSIWTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5102.5102.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3434 3364 1 1 1 767.4106 1532.8066 2 1532.8086 -0.002 0 47.11 0.00013 K SPFSVAVSPSLDLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4682.4682.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3435 3744 1 1 1 767.4107 1532.8069 2 1532.8086 -0.0018 0 15.43 0.036 K SPFSVAVSPSLDLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5080.5080.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3436 4496 1 1 1 767.4114 1532.8083 2 1532.8086 -0.0003 0 16.05 0.031 K SPFSVAVSPSLDLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5877.5877.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3658 1914 1 1 1 801.8859 1601.7572 2 1601.7587 -0.0015 0 47.69 9.50E-05 K YNEQHVPGSPFTAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3117.3117.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3659 1918 1 1 1 534.9265 1601.7577 3 1601.7587 -0.0009 0 45.53 5.40E-05 K YNEQHVPGSPFTAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3122.3122.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3738 472 1 1 1 817.9333 1633.8521 2 1633.8536 -0.0015 0 66.08 8.30E-07 R VHGPGIQSGTTNKPNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1516.1516.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3739 468 1 1 1 545.6247 1633.8523 3 1633.8536 -0.0014 0 31.89 0.0011 R VHGPGIQSGTTNKPNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1512.1512.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3767 1963 1 1 1 549.6294 1645.8664 3 1645.8675 -0.0012 0 45 7.50E-05 K TGVAVNKPAEFTVDAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3172.3172.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3779 1684 1 1 1 826.9336 1651.8526 2 1651.8529 -0.0003 0 77.05 1.30E-07 K VTAQGPGLEPSGNIANK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2862.2862.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3844 1889 1 1 1 560.6065 1678.7977 3 1678.7985 -0.0008 1 25.2 0.0043 R SPFEVKVGTECGNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3089.3089.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 3883 1816 1 1 1 425.4846 1697.9095 4 1697.9101 -0.0006 0 15.38 0.038 R TGVELGKPTHFTVNAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3008.3008.4.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4019 3767 1 1 1 870.9649 1739.9153 2 1739.9168 -0.0015 0 36.34 0.00053 R VTYTPMAPGSYLISIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5105.5105.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4042 3554 1 1 1 584.2974 1749.8704 3 1749.8726 -0.0022 0 44.77 0.00018 R TFSVWYVPEVTGTHK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4883.4883.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4043 3562 1 1 1 875.9437 1749.8728 2 1749.8726 0.0001 0 32.09 0.00098 R TFSVWYVPEVTGTHK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4890.4890.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4052 2285 1 1 1 878.9207 1755.8268 2 1755.8315 -0.0048 1 85.6 9.40E-09 K SPFEVYVDKSQGDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3530.3530.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4053 2278 1 1 1 586.2842 1755.8307 3 1755.8315 -0.0008 1 38.66 0.00057 K SPFEVYVDKSQGDASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3523.3523.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4066 2082 1 1 1 882.4304 1762.8463 2 1762.8486 -0.0023 0 104.51 2.20E-10 R VANPSGNLTETYVQDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3305.3305.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4122 1955 1 1 1 595.6199 1783.838 3 1783.8377 0.0003 0 28.2 0.0032 R DVDIIDHHDNTYTVK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3163.3163.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4127 2688 1 1 1 892.9449 1783.8753 2 1783.8775 -0.0021 0 71.9 4.20E-07 R VQVQDNEGCPVEALVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3976.3976.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4162 572 1 1 1 895.4167 1788.8189 2 1788.8213 -0.0024 0 90.44 3.90E-09 K ATCAPQHGAPGPGPADASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1627.1627.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4163 555 1 1 1 597.2803 1788.8192 3 1788.8213 -0.0022 0 59.08 5.30E-06 K ATCAPQHGAPGPGPADASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1608.1608.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4235 1696 1 1 1 907.9824 1813.9502 2 1813.9534 -0.0032 1 83.36 1.60E-08 K VAQPTITDNKDGTVTVR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2875.2875.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4236 1693 1 1 1 605.6577 1813.9511 3 1813.9534 -0.0023 1 25.35 0.006 K VAQPTITDNKDGTVTVR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2872.2872.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4353 1886 1 1 1 934.4243 1866.8341 2 1866.8353 -0.0012 0 86.82 6.30E-09 R SPYTVTVGQACNPSACR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3086.3086.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4354 1899 1 1 1 623.2856 1866.8349 3 1866.8353 -0.0004 0 30.06 0.0032 R SPYTVTVGQACNPSACR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3100.3100.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4378 3273 1 1 1 941.4733 1880.932 2 1880.9342 -0.0022 0 43.47 8.40E-05 R VTYCPTEPGNYIINIK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4586.4586.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4436 3412 1 1 1 955.4622 1908.9099 2 1908.9105 -0.0006 0 66.78 5.50E-07 R EGPYSISVLYGDEEVPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4733.4733.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4483 3025 1 1 1 969.5115 1937.0084 2 1937.0106 -0.0022 0 68.93 3.40E-07 K DAGEGLLAVQITDPEGKPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4327.4327.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4484 3023 1 1 1 646.6768 1937.0086 3 1937.0106 -0.0019 0 52.96 2.20E-05 K DAGEGLLAVQITDPEGKPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4325.4325.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4773 1767 1 1 1 686.6481 2056.9226 3 2056.9272 -0.0047 0 42.06 0.00019 K THEAEIVEGENHTYCIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2954.2954.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4774 1782 1 1 1 1029.4687 2056.9229 2 2056.9272 -0.0043 0 69.71 3.20E-07 K THEAEIVEGENHTYCIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2970.2970.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 4944 2692 1 1 1 734.0458 2199.1157 3 2199.1172 -0.0015 0 45.61 5.60E-05 R LVSNHSLHETSSVFVDSLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3980.3980.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 5009 2724 1 1 1 741.3914 2221.1522 3 2221.1525 -0.0003 1 44.2 0.00015 K APLRVQVQDNEGCPVEALVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4014.4014.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 5076 2837 1 1 1 766.752 2297.2342 3 2297.2379 -0.0037 1 38.29 0.00034 R ANLPQSFQVDTSKAGVAPLQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4134.4134.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 5082 2596 1 1 1 771.704 2312.0901 3 2312.0921 -0.0019 0 58.04 7.40E-06 R SAGQGEVLVYVEDPAGHQEEAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3875.3875.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 5083 2592 1 1 1 1157.0529 2312.0912 2 2312.0921 -0.0009 0 61.12 3.60E-06 R SAGQGEVLVYVEDPAGHQEEAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3870.3870.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 5095 3785 1 1 1 1171.6143 2341.214 2 2341.2166 -0.0026 0 56.32 9.00E-06 K ASGPGLNTTGVPASLPVEFTIDAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5123.5123.2.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 5134 3341 1 1 1 823.0668 2466.1785 3 2466.1816 -0.0031 0 33.24 0.0024 K FNEEHIPDSPFVVPVASPSGDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4658.4658.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 5167 3069 1 1 1 848.7563 2543.247 3 2543.2504 -0.0034 0 46.59 0.00011 K GLVEPVDVVDNADGTQTVNYVPSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4374.4374.3.dta 2 1 FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 2876 283301 104 104 81 81 5229 3265 1 1 1 921.7852 2762.3336 3 2762.3334 0.0002 0 72.64 2.50E-07 K LQVEPAVDTSGVQCYGPGIEGQGVFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4578.4578.3.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 296 803 1 0 0 378.7035 755.3924 2 755.3926 -0.0002 0 54.07 2.30E-05 R AGGPGLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1884.1884.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 367 2491 1 0 1 394.2314 786.4483 2 786.4487 -0.0004 0 26.75 0.016 K GLEELVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3758.3758.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 511 452 1 0 0 416.7479 831.4812 2 831.4814 -0.0002 1 30.66 0.007 R VKESITR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1494.1494.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 623 1671 1 0 1 430.7347 859.4549 2 859.4552 -0.0003 0 35.69 0.0028 K VFGPGVER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2847.2847.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 715 903 1 0 1 449.2609 896.5072 2 896.508 -0.0007 0 32.66 0.0014 R VQAQGPGLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1995.1995.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 827 2569 1 0 1 463.2769 924.5393 2 924.5392 0 0 31.93 0.002 K AGLAPLEVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3845.3845.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 1023 1723 1 0 1 492.2853 982.5561 2 982.556 0.0001 0 51.62 2.20E-05 K IAGPGLGSGVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2905.2905.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 1037 656 1 0 1 493.2874 984.5602 2 984.5604 -0.0002 1 34.45 0.0014 K VKAEGPGLSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1720.1720.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 1126 1197 1 0 0 504.2672 1006.5199 2 1006.5196 0.0003 0 47.76 0.00012 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2322.2322.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 1556 3156 1 0 1 554.8052 1107.5958 2 1107.5965 -0.0007 0 34.53 0.0024 K IFFAGDTIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4464.4464.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 1678 955 1 0 0 568.3142 1134.6139 2 1134.6145 -0.0007 1 46.9 0.00016 K KIQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2053.2053.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 1857 2189 1 0 0 586.7997 1171.5849 2 1171.5873 -0.0024 1 33.26 0.0027 K DLAEDAPWKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3424.3424.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 2029 773 1 0 1 602.2924 1202.5703 2 1202.5714 -0.0011 0 71.25 4.10E-07 K VAVTEGCQPSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1850.1850.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 2275 2507 1 0 1 625.8163 1249.618 2 1249.619 -0.001 0 70.05 7.60E-07 K TGEEVGFVVDAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3776.3776.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 2370 1989 1 0 1 637.8406 1273.6666 2 1273.67 -0.0034 0 46.85 0.00013 K CLATGPGIASTVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3200.3200.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 2779 1690 1 0 1 672.3103 1342.6061 2 1342.6075 -0.0014 0 26.22 0.0067 R SSTETCYSAIPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2868.2868.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 3069 2430 1 0 1 707.3824 1412.7502 2 1412.7511 -0.0009 0 51.62 1.70E-05 R AGPGTLSVTIEGPSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3690.3690.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 3235 3822 1 0 1 730.8399 1459.6653 2 1459.6653 -0.0001 0 46.27 0.00012 R TFEMSDFIVDTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5160.5160.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 3393 3754 1 0 1 760.3793 1518.7441 2 1518.7467 -0.0026 0 52.23 4.60E-05 R GEAGVPAEFSIWTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5092.5092.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 3729 2975 1 0 1 814.9276 1627.8406 2 1627.8417 -0.0012 0 64.94 8.10E-07 R GAGIGGLGITVEGPSESK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4275.4275.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 3939 2824 1 0 1 574.9765 1721.9077 3 1721.9101 -0.0024 0 29.82 0.0016 K EAFTNKPNVFTVVTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4120.4120.3.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 4067 3515 1 0 1 882.4337 1762.8528 2 1762.856 -0.0032 0 95.89 1.90E-09 K SGCIVNNLAEFTVDPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4840.4840.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 4242 1979 1 0 1 908.476 1814.9374 2 1814.9374 -0.0001 1 42.24 0.00011 K TATPEIVDNKDGTVTVR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3189.3189.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 4429 2626 1 0 1 952.9398 1903.865 2 1903.8669 -0.0019 0 82.63 2.20E-08 K SPFVVQVGEACNPNACR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3908.3908.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 4751 3271 1 0 1 1023.5378 2045.061 2 2045.0641 -0.0031 0 117.38 9.90E-12 R LVSPGSANETSSILVESVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4584.4584.2.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 4861 2588 1 0 1 709.0455 2124.1146 3 2124.1175 -0.0029 1 25.88 0.011 R DAGEGLLAVQITDQEGKPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3866.3866.3.dta 2 2 FLNB_HUMAN Filamin-B OS=Homo sapiens GN=FLNB PE=1 SV=2 809 280157 27 27 27 27 5110 2411 1 0 1 796.3994 2386.1764 3 2386.1765 -0.0001 0 23.08 0.0095 R EATTDFTVDSRPLTQVGGDHIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3669.3669.3.dta 2 FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 110 293407 5 5 5 5 287 1351 1 0 1 376.7005 751.3864 2 751.3865 0 0 26.84 0.0092 R FTVETR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2493.2493.2.dta 2 FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 110 293407 5 5 5 5 1126 1197 1 0 0 504.2672 1006.5199 2 1006.5196 0.0003 0 47.76 0.00012 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2322.2322.2.dta 2 FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 110 293407 5 5 5 5 1678 955 1 0 0 568.3142 1134.6139 2 1134.6145 -0.0007 1 46.9 0.00016 K KIQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2053.2053.2.dta 2 FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 110 293407 5 5 5 5 1717 1360 1 0 1 573.3292 1144.6438 2 1144.6452 -0.0014 1 36.56 0.0013 K GAGSGELKVTVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2503.2503.2.dta 2 FLNC_HUMAN Filamin-C OS=Homo sapiens GN=FLNC PE=1 SV=3 110 293407 5 5 5 5 1857 2189 1 0 0 586.7997 1171.5849 2 1171.5873 -0.0024 1 33.26 0.0027 K DLAEDAPWKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3424.3424.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 22 919 1 1 0 305.1656 608.3167 2 608.317 -0.0003 0 26.62 0.017 K SFVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2013.2013.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 50 1276 1 1 0 315.6944 629.3743 2 629.3748 -0.0005 0 25.51 0.038 K LQLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2409.2409.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 52 1596 4 1 1 315.6996 629.3846 2 629.386 -0.0014 0 26.64 0.036 K ALSLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2763.2763.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 81 1386 1 1 1 324.6999 647.3852 2 647.3854 -0.0002 0 38.86 0.0008 K LSLSTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2532.2532.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 97 1751 1 1 1 328.7079 655.4013 2 655.4017 -0.0004 0 23.99 0.014 R GILTPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2936.2936.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 211 762 1 1 1 353.1893 704.364 2 704.3639 0.0001 0 28.77 0.019 R SMAVAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1838.1838.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 236 1296 1 1 1 360.7072 719.3999 2 719.4 0 0 25.05 0.015 K LMATLR N Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2432.2432.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 406 378 1 1 1 401.2451 800.4756 2 800.4756 0.0001 1 26.87 0.017 R VKANLEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1414.1414.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 501 1718 1 1 1 415.7348 829.455 2 829.4545 0.0005 0 32.87 0.0048 K GALALEEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2899.2899.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 529 1270 1 1 1 420.2077 838.4009 2 838.4007 0.0002 0 35.33 0.0022 R NCAAYLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2403.2403.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 628 15 1 1 1 431.7442 861.4738 2 861.4742 -0.0004 1 34.5 0.0043 R KLQAQMK D Oxidation (M) 0.0000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1017.1017.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 767 3099 1 1 1 454.7473 907.48 2 907.4803 -0.0003 0 23.28 0.036 K FVSELWK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4406.4406.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 823 2663 1 1 1 462.7504 923.4862 2 923.4865 -0.0003 0 38.84 0.00026 R VVFQEFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3948.3948.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 954 260 1 1 1 320.5099 958.5077 3 958.5083 -0.0006 1 29.55 0.011 K VNKDDIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1287.1287.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 955 256 1 1 1 480.2613 958.5081 2 958.5083 -0.0003 1 44.73 0.00028 K VNKDDIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1283.1283.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 971 514 1 1 1 482.2499 962.4853 2 962.4855 -0.0002 0 39.56 0.00093 R QQQLTAMK V Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1563.1563.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 992 2075 1 1 1 486.7713 971.5281 2 971.5287 -0.0006 0 22.01 0.05 R EQEVNILK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3297.3297.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1006 2175 1 1 1 489.7592 977.5039 2 977.5038 0.0001 0 44.33 0.0003 K QACVLMIK A Oxidation (M) 0.00000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3408.3408.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1042 1331 1 1 1 493.7848 985.555 2 985.5556 -0.0006 1 25.02 0.027 K GALALEEKR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2470.2470.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1092 3284 1 1 1 500.2846 998.5547 2 998.5549 -0.0002 0 33.88 0.0025 R GDLPFVVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4598.4598.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1117 864 1 1 1 502.7849 1003.5552 2 1003.555 0.0002 1 40.78 0.00058 R TELADKVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1952.1952.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1137 1112 1 1 1 337.5076 1009.5011 3 1009.5015 -0.0004 0 22.2 0.038 R CIIPNHEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2227.2227.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1168 2260 1 1 1 509.261 1016.5075 2 1016.5073 0.0002 0 55.96 2.50E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3503.3503.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1188 389 1 1 0 512.7438 1023.473 2 1023.4734 -0.0004 1 28.45 0.01 K NDNSSRFGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1425.1425.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1191 792 1 1 1 342.1819 1023.5237 3 1023.5237 0.0001 1 27.19 0.0057 K ATDKSFVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1872.1872.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1237 1297 1 1 1 517.7627 1033.5108 2 1033.5114 -0.0005 0 30.99 0.0071 K LQEMEGTVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2433.2433.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1247 1190 1 1 1 518.7868 1035.5591 2 1035.56 -0.001 1 36.22 0.0012 K VAAYDKLEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2314.2314.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1248 1191 1 1 1 346.1938 1035.5597 3 1035.56 -0.0003 1 32.51 0.0023 K VAAYDKLEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2315.2315.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1256 1852 1 1 1 347.2254 1038.6545 3 1038.655 -0.0005 0 49.15 1.20E-05 K VKPLLQVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3048.3048.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1257 1850 1 1 1 520.3348 1038.655 2 1038.655 0.0001 0 13.94 0.04 K VKPLLQVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3046.3046.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1425 277 1 1 1 539.2709 1076.5272 2 1076.5284 -0.0012 1 36.8 0.0022 R QSACNLEKK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1305.1305.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1488 2308 1 1 1 546.7822 1091.5499 2 1091.5499 0 0 34.58 0.0019 K FDQLLAEEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3555.3555.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1519 1508 1 1 1 550.8184 1099.6222 2 1099.6237 -0.0015 1 32.38 0.0042 R EQEVNILKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2667.2667.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1520 1515 1 1 1 367.5484 1099.6234 3 1099.6237 -0.0003 1 33.37 0.0033 R EQEVNILKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2675.2675.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1610 314 1 1 1 560.2995 1118.5844 2 1118.5866 -0.0022 1 28.51 0.014 K RQQQLTAMK V Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1345.1345.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1752 193 1 1 1 577.7844 1153.5542 2 1153.555 -0.0008 0 50.09 2.00E-05 K VMQEQGTHPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1215.1215.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1761 2776 1 1 1 578.3342 1154.6539 2 1154.656 -0.0021 1 43.24 0.00014 R RGDLPFVVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4072.4072.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1762 2768 1 1 1 385.8925 1154.6557 3 1154.656 -0.0003 1 42.32 0.00026 R RGDLPFVVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4063.4063.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1841 5327 1 1 1 390.8569 1169.5489 3 1169.5499 -0.001 0 31.76 0.0019 K VMQEQGTHPK F Oxidation (M) 0.0100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.973.973.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1842 5326 1 1 1 585.7819 1169.5493 2 1169.5499 -0.0006 0 47.61 9.10E-05 K VMQEQGTHPK F Oxidation (M) 0.0100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.972.972.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1968 2771 1 1 1 597.3113 1192.6081 2 1192.6088 -0.0006 0 47.47 4.60E-05 K ALELDSNLYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4066.4066.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1971 1875 1 1 1 597.8399 1193.6653 2 1193.6655 -0.0003 1 56.38 8.10E-06 K YKASITALEAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3074.3074.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 1972 1882 1 1 1 398.896 1193.6663 3 1193.6655 0.0007 1 26.18 0.0084 K YKASITALEAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3082.3082.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2040 2981 1 1 1 603.3244 1204.6343 2 1204.6339 0.0003 0 39.18 0.00099 K TDLLLEPYNK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4282.4282.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2104 1284 1 1 1 608.3373 1214.66 2 1214.6618 -0.0018 1 43.77 0.0004 R ASREEILAQAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2418.2418.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2122 2143 1 1 1 610.8287 1219.6429 2 1219.6448 -0.0019 1 61.45 6.30E-06 K KFDQLLAEEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3373.3373.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2123 2154 1 1 1 407.5556 1219.6449 3 1219.6448 0.0001 1 26.82 0.018 K KFDQLLAEEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3385.3385.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2138 2217 1 1 1 612.3223 1222.63 2 1222.6306 -0.0006 0 40.49 0.0011 R AGVLAHLEEER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3455.3455.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2139 2224 1 1 1 408.5507 1222.6303 3 1222.6306 -0.0002 0 43.56 0.00053 R AGVLAHLEEER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3463.3463.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2322 1687 1 1 1 631.3443 1260.674 2 1260.6748 -0.0007 1 41.37 0.00044 K VKLQEMEGTVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2865.2865.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2373 2813 1 1 1 637.8535 1273.6924 2 1273.6918 0.0006 0 54.55 2.60E-05 R YEILTPNSIPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4109.4109.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2385 924 1 1 1 639.3414 1276.6682 2 1276.6697 -0.0015 1 44.9 0.00026 K VKLQEMEGTVK S Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2018.2018.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2386 923 1 1 1 426.5637 1276.6693 3 1276.6697 -0.0003 1 30.6 0.0067 K VKLQEMEGTVK S Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2017.2017.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2442 2369 1 1 1 642.8611 1283.7076 2 1283.7085 -0.0009 0 59.64 6.70E-06 K VEAQLQELQVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3623.3623.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2513 2648 1 1 1 647.8157 1293.6169 2 1293.6176 -0.0007 0 59.28 2.80E-06 K ADFCIIHYAGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3932.3932.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2514 2655 1 1 1 432.2132 1293.6178 3 1293.6176 0.0002 0 22.11 0.016 K ADFCIIHYAGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3939.3939.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2600 3992 1 1 1 653.3362 1304.6579 2 1304.6612 -0.0033 0 19.77 0.014 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5337.5337.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2602 4292 1 1 1 653.3368 1304.659 2 1304.6612 -0.0022 0 30.51 0.0014 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5647.5647.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2603 3398 1 1 1 653.3368 1304.659 2 1304.6612 -0.0022 0 29.62 0.0017 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4719.4719.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2606 4656 1 1 1 653.3378 1304.661 2 1304.6612 -0.0002 0 17.38 0.024 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6084.6084.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2678 3306 1 1 1 659.8773 1317.7401 2 1317.7405 -0.0004 0 41.11 0.00028 K LDPHLVLDQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4622.4622.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2679 3307 1 1 1 440.2542 1317.7407 3 1317.7405 0.0002 0 35.22 0.0011 K LDPHLVLDQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4623.4623.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2858 2201 1 1 1 679.3569 1356.6993 2 1356.6997 -0.0004 1 22.54 0.05 K DVLLQVDDERR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3437.3437.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 2929 1766 1 1 1 689.3894 1376.7643 2 1376.7663 -0.0021 1 32.88 0.0023 R TVGQLYKEQLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2953.2953.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3038 1286 1 1 1 701.3636 1400.7127 2 1400.7147 -0.0019 1 46.1 0.00019 R EEILAQAKENEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2420.2420.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3065 2052 1 1 1 706.9081 1411.8016 2 1411.8035 -0.0018 1 74.21 1.30E-07 K KVEAQLQELQVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3272.3272.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3066 2061 1 1 1 471.6084 1411.8034 3 1411.8035 -0.0001 1 37.79 0.00059 K KVEAQLQELQVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3282.3282.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3168 1148 1 1 1 720.8563 1439.6981 2 1439.7004 -0.0023 1 37.17 0.0011 K DLEGLSQRHEEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2267.2267.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3275 2870 1 1 1 739.9024 1477.7903 2 1477.7929 -0.0026 0 38.62 0.00032 K VIQYLAYVASSHK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4168.4168.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3276 2860 1 1 1 493.605 1477.7932 3 1477.7929 0.0003 0 22.63 0.018 K VIQYLAYVASSHK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4158.4158.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3409 2798 1 1 1 508.9398 1523.7974 3 1523.7984 -0.0009 1 15.36 0.048 K TDLLLEPYNKYR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4094.4094.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3423 2299 1 1 1 765.8853 1529.756 2 1529.7573 -0.0013 0 71.95 4.00E-07 K IAQLEEQLDNETK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3546.3546.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3495 3300 1 1 1 776.8832 1551.7518 2 1551.7538 -0.002 0 62.69 1.80E-06 K ITDVIIGFQACCR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4616.4616.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3525 2479 1 1 1 779.9318 1557.849 2 1557.8515 -0.0025 1 35.2 0.0017 R QRYEILTPNSIPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3745.3745.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3578 3415 1 1 1 786.4299 1570.8453 2 1570.8468 -0.0014 0 78.59 8.60E-08 K VSHLLGINVTDFTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4736.4736.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3579 3411 1 1 1 524.6229 1570.8468 3 1570.8468 0 0 23.48 0.0076 K VSHLLGINVTDFTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4732.4732.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3592 2267 1 1 1 790.4249 1578.8353 2 1578.8365 -0.0012 1 42.65 0.0001 R AGVLAHLEEERDLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3510.3510.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3593 2245 1 1 1 527.2864 1578.8375 3 1578.8365 0.001 1 32.09 0.0036 R AGVLAHLEEERDLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3486.3486.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3629 826 1 1 1 796.3539 1590.6933 2 1590.6944 -0.001 0 60.79 1.80E-06 R NTDQASMPDNTAAQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1909.1909.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3700 3622 1 1 1 808.4117 1614.8088 2 1614.8109 -0.0021 0 44.51 0.00012 R IMGIPEEEQMGLLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4953.4953.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3736 3201 1 1 1 816.4094 1630.8043 2 1630.8058 -0.0015 0 42.02 0.00023 R IMGIPEEEQMGLLR V Oxidation (M) 0.00000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4510.4510.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3764 2029 1 1 1 823.9053 1645.796 2 1645.7981 -0.0021 1 80.07 7.20E-08 R ALEEAMEQKAELER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3245.3245.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3765 2027 1 1 1 549.6065 1645.7977 3 1645.7981 -0.0004 1 51.03 6.10E-05 R ALEEAMEQKAELER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3243.3243.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3786 2590 1 1 1 827.3956 1652.7766 2 1652.7781 -0.0015 0 99.17 6.90E-10 R IAEFTTNLTEEEEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3868.3868.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3813 1327 1 1 1 554.9377 1661.7912 3 1661.793 -0.0018 1 25.34 0.012 R ALEEAMEQKAELER L Oxidation (M) 0.00000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2466.2466.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3960 4228 1 1 1 576.3206 1725.94 3 1725.9413 -0.0013 0 21.8 0.024 R QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5580.5580.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3961 4205 1 1 1 863.9774 1725.9402 2 1725.9413 -0.0012 0 70.17 3.50E-07 R QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5557.5557.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3963 3844 1 1 1 864.4309 1726.8473 2 1726.8487 -0.0015 0 71.68 3.80E-07 K NLPIYSEEIVEMYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5184.5184.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3973 1784 1 1 1 865.4385 1728.8624 2 1728.8642 -0.0018 1 50.66 6.10E-05 K QTLENERGELANEVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2973.2973.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 3974 1774 1 1 1 577.2948 1728.8626 3 1728.8642 -0.0016 1 33.21 0.00077 K QTLENERGELANEVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2962.2962.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4001 2823 1 1 1 578.6396 1732.8971 3 1732.8995 -0.0024 1 38.76 0.00023 K AQTKEQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4119.4119.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4024 3423 1 1 1 872.428 1742.8415 2 1742.8436 -0.0021 0 74.15 1.80E-07 K NLPIYSEEIVEMYK G Oxidation (M) 0.00000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4744.4744.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4079 2433 1 1 1 590.6205 1768.8398 3 1768.8414 -0.0016 1 23.09 0.014 K KQELEEICHDLEAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3694.3694.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4240 2178 1 1 1 605.9733 1814.898 3 1814.901 -0.003 1 30.76 0.0057 K IAQLEEQLDNETKER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3412.3412.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4241 2181 1 1 1 908.4568 1814.899 2 1814.901 -0.0019 1 76.76 6.30E-08 K IAQLEEQLDNETKER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3415.3415.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4276 1364 1 1 1 610.9564 1829.8474 3 1829.8503 -0.0029 1 52.64 1.20E-05 R QLEEAEEEAQRANASR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2507.2507.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4277 1370 1 1 1 915.9314 1829.8482 2 1829.8503 -0.0021 1 49.45 5.50E-05 R QLEEAEEEAQRANASR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2514.2514.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4358 2279 1 1 1 934.9583 1867.9021 2 1867.9051 -0.003 1 90.7 3.10E-09 R IAEFTTNLTEEEEKSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3524.3524.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4359 2277 1 1 1 623.6419 1867.9039 3 1867.9051 -0.0012 1 16.55 0.032 R IAEFTTNLTEEEEKSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3522.3522.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4365 3278 1 1 1 935.4857 1868.9568 2 1868.9592 -0.0024 0 86.72 1.60E-08 K ANLQIDQINTDLNLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4592.4592.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4396 2208 1 1 1 944.9686 1887.9226 2 1887.9247 -0.0022 1 96.22 1.40E-09 K KLEEEQIILEDQNCK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3445.3445.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4397 2199 1 1 1 630.3152 1887.9239 3 1887.9247 -0.0008 1 47.63 7.40E-05 K KLEEEQIILEDQNCK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3435.3435.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4500 3727 1 1 1 649.3401 1944.9984 3 1945.0004 -0.002 0 40.47 0.00016 K LQVELDNVTGLLSQSDSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5063.5063.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4501 3719 1 1 1 973.5067 1944.9988 2 1945.0004 -0.0016 0 108.27 7.40E-11 K LQVELDNVTGLLSQSDSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5055.5055.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4636 2727 1 1 1 666.0068 1994.9985 3 1995.0021 -0.0036 1 57.49 4.10E-06 K HSQAVEELAEQLEQTKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4017.4017.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4639 2906 1 1 1 999.5327 1997.0508 2 1997.0541 -0.0034 1 85.77 1.20E-08 K KANLQIDQINTDLNLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4205.4205.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4640 2903 1 1 1 666.6913 1997.0522 3 1997.0541 -0.0019 1 43.95 0.00018 K KANLQIDQINTDLNLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4202.4202.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4695 4080 1 1 1 1009.5352 2017.0559 2 2017.0554 0.0005 0 110.61 4.30E-11 R IIGLDQVAGMSETALPGAFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5427.5427.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4722 3616 1 1 1 678.69 2033.0482 3 2033.0503 -0.0021 0 52.44 1.20E-05 R IIGLDQVAGMSETALPGAFK T Oxidation (M) 0.00000000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4946.4946.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4723 3612 1 1 1 1017.5319 2033.0493 2 2033.0503 -0.001 0 97.74 1.20E-09 R IIGLDQVAGMSETALPGAFK T Oxidation (M) 0.00000000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4942.4942.2.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4741 2089 1 1 1 681.6644 2041.9715 3 2041.9738 -0.0024 1 42.53 0.00028 K TLEEEAKTHEAQIQEMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3313.3313.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4776 1650 1 1 1 686.9956 2057.965 3 2057.9687 -0.0038 1 26.55 0.01 K TLEEEAKTHEAQIQEMR Q Oxidation (M) 0.00000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2824.2824.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4819 2071 1 1 1 696.9969 2087.969 3 2087.9719 -0.0029 1 47.38 6.90E-05 R QAQQERDELADEIANSSGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3293.3293.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 4949 2971 1 1 1 737.0132 2208.0177 3 2208.0216 -0.0038 1 21.94 0.02 R ELEDATETADAMNREVSSLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4270.4270.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 5033 3443 1 1 1 750.0578 2247.1516 3 2247.1594 -0.0078 1 20.14 0.026 K LQVELDNVTGLLSQSDSKSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4765.4765.3.dta 3 1 MYH9_HUMAN Myosin-9 OS=Homo sapiens GN=MYH9 PE=1 SV=4 2828 227646 116 116 80 80 5213 3294 1 1 1 905.1219 2712.3438 3 2712.3453 -0.0015 1 50.74 3.60E-05 R IAQLEEELEEEQGNTELINDRLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4609.4609.3.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 157 1661 1 0 1 342.6766 683.3387 2 683.3391 -0.0004 0 35.06 0.0014 R AGYAFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2836.2836.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 247 30 1 0 1 363.7347 725.4548 2 725.4548 0 1 29.31 0.0013 R VVKQPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1034.1034.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 342 1121 1 0 1 388.7062 775.3978 2 775.3977 0.0001 0 31.4 0.0067 K NPNYIR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2237.2237.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 345 360 1 0 1 389.7189 777.4233 2 777.4232 0.0001 0 20.83 0.05 R TTLSQTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1394.1394.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 438 216 1 0 1 408.7218 815.4291 2 815.429 0.0001 0 34.28 0.0042 R IQHYAGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1239.1239.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 525 1113 1 0 1 418.731 835.4475 2 835.4473 0.0002 0 39.07 0.0015 K ASVATLMK N Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2228.2228.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 869 2913 1 0 1 468.7554 935.4963 2 935.4964 -0.0001 0 23.07 0.026 K LEASELFK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4212.4212.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1089 2551 1 0 1 499.8159 997.6172 2 997.6172 0.0001 0 45.51 3.40E-05 K IIIAEVVNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3825.3825.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1110 5320 1 0 1 501.7732 1001.5319 2 1001.5328 -0.0009 1 25.84 0.03 R CIKPNDKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.965.965.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1188 389 1 0 0 512.7438 1023.473 2 1023.4734 -0.0004 1 28.45 0.01 R NDNSSRFGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1425.1425.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1393 2934 1 0 1 535.2873 1068.56 2 1068.5604 -0.0003 0 51.63 5.00E-05 K IYEFTLQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4234.4234.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1424 3403 1 0 1 538.8083 1075.6021 2 1075.6026 -0.0004 0 53.36 2.30E-05 R YLGLLENVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4724.4724.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1460 2468 1 0 1 543.8053 1085.596 2 1085.5968 -0.0008 0 30.25 0.0054 K SEVPLVDVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3733.3733.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1470 751 1 0 1 544.7958 1087.577 2 1087.5774 -0.0004 0 49.07 0.00017 K RPPTAGSQFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1826.1826.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1709 3394 1 0 1 572.3344 1142.6543 2 1142.6547 -0.0004 0 58.56 5.20E-06 R LEDLATLIQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4715.4715.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1807 1703 1 0 1 583.2686 1164.5226 2 1164.5233 -0.0008 0 21.8 0.028 R QAYEPCLER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2883.2883.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1887 1803 1 0 1 589.2833 1176.5521 2 1176.5524 -0.0003 0 50.23 5.50E-05 K VNGVDDAANFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2994.2994.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 1995 2486 2 0 1 599.3336 1196.6527 2 1196.6553 -0.0026 1 20.61 0.043 K KIYEFTLQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3753.3753.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 2495 2020 1 0 1 645.3456 1288.6767 2 1288.6775 -0.0008 0 39.54 0.001 K LGNIEFKPESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3235.3235.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 2716 996 1 0 1 664.8147 1327.6148 2 1327.6157 -0.0008 1 47.67 8.00E-05 K YRDQFTDQQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2098.2098.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 3639 2500 1 0 1 797.3763 1592.738 2 1592.7406 -0.0026 0 72.38 3.70E-07 R FLNDTSLPHSCFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3768.3768.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 3640 2498 1 0 1 531.9203 1592.739 3 1592.7406 -0.0015 0 29.08 0.008 R FLNDTSLPHSCFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3766.3766.3.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 3899 2555 1 0 1 855.4398 1708.865 2 1708.8672 -0.0022 1 67.83 1.10E-06 R SLPIYSPEKVEEYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3829.3829.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 3956 964 1 0 1 576.2739 1725.7998 3 1725.8005 -0.0008 0 25.53 0.0049 K LNQVCATHQHFESR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2063.2063.3.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 3978 4065 1 0 1 865.4954 1728.9763 2 1728.9774 -0.0011 0 105.14 6.90E-11 R IFLLTNNNLLLADQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5412.5412.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 4059 3239 1 0 1 881.4363 1760.8581 2 1760.8614 -0.0033 0 93.21 2.60E-09 K EICELTGIDQSVLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4550.4550.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 4102 2323 1 0 1 593.6415 1777.9026 3 1777.9046 -0.002 0 33.16 0.00078 K AAHIFNEALVCHQIR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3572.3572.3.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 4334 3963 1 0 1 929.4882 1856.9618 2 1856.9632 -0.0014 0 78.83 4.10E-08 K EQLLQSNPVLEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5306.5306.2.dta 3 2 MYO1B_HUMAN Unconventional myosin-Ib OS=Homo sapiens GN=MYO1B PE=1 SV=3 733 132928 29 29 27 27 4335 3979 1 0 1 619.9946 1856.9621 3 1856.9632 -0.0011 0 31.59 0.0011 K EQLLQSNPVLEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5324.5324.3.dta 3 3 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 91 122461 3 3 3 3 1188 389 1 0 0 512.7438 1023.473 2 1023.4734 -0.0004 1 28.45 0.01 R NDNSSRFGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1425.1425.2.dta 3 3 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 91 122461 3 3 3 3 1480 3801 1 0 1 545.8164 1089.6183 2 1089.6182 0.0001 0 28.17 0.0062 K YLGLLENLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5139.5139.2.dta 3 3 MYO1C_HUMAN Unconventional myosin-Ic OS=Homo sapiens GN=MYO1C PE=1 SV=4 91 122461 3 3 3 3 3891 3680 1 0 1 853.9454 1705.8763 2 1705.8774 -0.0011 0 72.72 1.50E-07 R DGTIDFTPGSELLITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5015.5015.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 50 1276 1 0 0 315.6944 629.3743 2 629.3748 -0.0005 0 25.51 0.038 K LQLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2409.2409.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 52 1596 4 0 1 315.6996 629.3846 2 629.386 -0.0014 0 26.64 0.036 K ALSLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2763.2763.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 236 1296 1 0 1 360.7072 719.3999 2 719.4 0 0 25.05 0.015 K LMATLR N Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2432.2432.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 529 1270 1 0 1 420.2077 838.4009 2 838.4007 0.0002 0 35.33 0.0022 R NCAAYLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2403.2403.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 628 15 1 0 1 431.7442 861.4738 2 861.4742 -0.0004 1 34.5 0.0043 R KLQAQMK D Oxidation (M) 0.0000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1017.1017.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 1137 1112 1 0 1 337.5076 1009.5011 3 1009.5015 -0.0004 0 22.2 0.038 R CIIPNHEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2227.2227.3.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 1168 2260 1 0 1 509.261 1016.5075 2 1016.5073 0.0002 0 55.96 2.50E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3503.3503.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 1188 389 1 0 0 512.7438 1023.473 2 1023.4734 -0.0004 1 28.45 0.01 K NDNSSRFGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1425.1425.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 1488 2308 1 0 1 546.7822 1091.5499 2 1091.5499 0 0 34.58 0.0019 K FDQLLAEEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3555.3555.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 2122 2143 1 0 1 610.8287 1219.6429 2 1219.6448 -0.0019 1 61.45 6.30E-06 K KFDQLLAEEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3373.3373.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 2123 2154 1 0 1 407.5556 1219.6449 3 1219.6448 0.0001 1 26.82 0.018 K KFDQLLAEEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3385.3385.3.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 2138 2217 1 0 1 612.3223 1222.63 2 1222.6306 -0.0006 0 40.49 0.0011 R AGVLAHLEEER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3455.3455.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 2139 2224 1 0 1 408.5507 1222.6303 3 1222.6306 -0.0002 0 43.56 0.00053 R AGVLAHLEEER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3463.3463.3.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 2513 2648 1 0 1 647.8157 1293.6169 2 1293.6176 -0.0007 0 59.28 2.80E-06 K ADFCIIHYAGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3932.3932.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 2514 2655 1 0 1 432.2132 1293.6178 3 1293.6176 0.0002 0 22.11 0.016 K ADFCIIHYAGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3939.3939.3.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 2678 3306 1 0 1 659.8773 1317.7401 2 1317.7405 -0.0004 0 41.11 0.00028 K LDPHLVLDQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4622.4622.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 2679 3307 1 0 1 440.2542 1317.7407 3 1317.7405 0.0002 0 35.22 0.0011 K LDPHLVLDQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4623.4623.3.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 3592 2267 1 0 1 790.4249 1578.8353 2 1578.8365 -0.0012 1 42.65 0.0001 R AGVLAHLEEERDLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3510.3510.2.dta 3 MYH10_HUMAN Myosin-10 OS=Homo sapiens GN=MYH10 PE=1 SV=3 324 229827 19 19 14 14 3593 2245 1 0 1 527.2864 1578.8375 3 1578.8365 0.001 1 32.09 0.0036 R AGVLAHLEEERDLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3486.3486.3.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 22 919 1 0 0 305.1656 608.3167 2 608.317 -0.0003 0 26.62 0.017 K SFVEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2013.2013.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 50 1276 1 0 0 315.6944 629.3743 2 629.3748 -0.0005 0 25.51 0.038 K LQLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2409.2409.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 52 1596 4 0 1 315.6996 629.3846 2 629.386 -0.0014 0 26.64 0.036 K ALSLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2763.2763.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 529 1270 1 0 1 420.2077 838.4009 2 838.4007 0.0002 0 35.33 0.0022 R NCAAYLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2403.2403.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 628 15 1 0 1 431.7442 861.4738 2 861.4742 -0.0004 1 34.5 0.0043 R KLQAQMK D Oxidation (M) 0.0000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1017.1017.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 971 514 1 0 1 482.2499 962.4853 2 962.4855 -0.0002 0 39.56 0.00093 R QQQLTAMK V Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1563.1563.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 1137 1112 1 0 1 337.5076 1009.5011 3 1009.5015 -0.0004 0 22.2 0.038 R CIIPNHEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2227.2227.3.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 1168 2260 1 0 1 509.261 1016.5075 2 1016.5073 0.0002 0 55.96 2.50E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3503.3503.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 1188 389 1 0 0 512.7438 1023.473 2 1023.4734 -0.0004 1 28.45 0.01 K NDNSSRFGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1425.1425.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 1191 792 1 0 1 342.1819 1023.5237 3 1023.5237 0.0001 1 27.19 0.0057 K ATDKSFVEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1872.1872.3.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 1488 2308 1 0 1 546.7822 1091.5499 2 1091.5499 0 0 34.58 0.0019 K FDQLLAEEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3555.3555.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 1610 314 1 0 1 560.2995 1118.5844 2 1118.5866 -0.0022 1 28.51 0.014 K RQQQLTAMK V Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1345.1345.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 2122 2143 1 0 1 610.8287 1219.6429 2 1219.6448 -0.0019 1 61.45 6.30E-06 R KFDQLLAEEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3373.3373.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 2123 2154 1 0 1 407.5556 1219.6449 3 1219.6448 0.0001 1 26.82 0.018 R KFDQLLAEEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3385.3385.3.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 3629 826 1 0 1 796.3539 1590.6933 2 1590.6944 -0.001 0 60.79 1.80E-06 R NTDQASMPDNTAAQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1909.1909.2.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 3960 4228 1 0 1 576.3206 1725.94 3 1725.9413 -0.0013 0 21.8 0.024 K QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5580.5580.3.dta 3 MYH11_HUMAN Myosin-11 OS=Homo sapiens GN=MYH11 PE=1 SV=3 291 228054 17 17 15 15 3961 4205 1 0 1 863.9774 1725.9402 2 1725.9413 -0.0012 0 70.17 3.50E-07 K QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5557.5557.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 22 919 1 0 0 305.1656 608.3167 2 608.317 -0.0003 0 26.62 0.017 K SFVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2013.2013.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 50 1276 1 0 0 315.6944 629.3743 2 629.3748 -0.0005 0 25.51 0.038 K LQLEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2409.2409.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 529 1270 1 0 1 420.2077 838.4009 2 838.4007 0.0002 0 35.33 0.0022 R NCAAYLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2403.2403.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 1168 2260 1 0 1 509.261 1016.5075 2 1016.5073 0.0002 0 55.96 2.50E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3503.3503.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 1188 389 1 0 0 512.7438 1023.473 2 1023.4734 -0.0004 1 28.45 0.01 K NDNSSRFGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1425.1425.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 1191 792 1 0 1 342.1819 1023.5237 3 1023.5237 0.0001 1 27.19 0.0057 K ATDKSFVEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1872.1872.3.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 1488 2308 1 0 1 546.7822 1091.5499 2 1091.5499 0 0 34.58 0.0019 K FDQLLAEEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3555.3555.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 2122 2143 1 0 1 610.8287 1219.6429 2 1219.6448 -0.0019 1 61.45 6.30E-06 R KFDQLLAEEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3373.3373.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 2123 2154 1 0 1 407.5556 1219.6449 3 1219.6448 0.0001 1 26.82 0.018 R KFDQLLAEEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3385.3385.3.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 2600 3992 1 0 1 653.3362 1304.6579 2 1304.6612 -0.0033 0 19.77 0.014 K EQADFALEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5337.5337.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 2602 4292 1 0 1 653.3368 1304.659 2 1304.6612 -0.0022 0 30.51 0.0014 K EQADFALEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5647.5647.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 2603 3398 1 0 1 653.3368 1304.659 2 1304.6612 -0.0022 0 29.62 0.0017 K EQADFALEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4719.4719.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 2606 4656 1 0 1 653.3378 1304.661 2 1304.6612 -0.0002 0 17.38 0.024 K EQADFALEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6084.6084.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 3960 4228 1 0 1 576.3206 1725.94 3 1725.9413 -0.0013 0 21.8 0.024 R QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5580.5580.3.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 3961 4205 1 0 1 863.9774 1725.9402 2 1725.9413 -0.0012 0 70.17 3.50E-07 R QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5557.5557.2.dta 3 MYH14_HUMAN Myosin-14 OS=Homo sapiens GN=MYH14 PE=1 SV=2 271 228701 16 16 11 11 4001 2823 1 0 1 578.6396 1732.8971 3 1732.8995 -0.0024 1 38.76 0.00023 K AQTKEQADFALEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4119.4119.3.dta 3 MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens GN=MYO1A PE=2 SV=1 130 119238 3 3 2 2 1424 3403 1 0 1 538.8083 1075.6021 2 1075.6026 -0.0004 0 53.36 2.30E-05 R YLGLLENVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4724.4724.2.dta 3 MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens GN=MYO1A PE=2 SV=1 130 119238 3 3 2 2 4334 3963 1 0 1 929.4882 1856.9618 2 1856.9632 -0.0014 0 78.83 4.10E-08 K EQLLQSNPVLEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5306.5306.2.dta 3 MYO1A_HUMAN Unconventional myosin-Ia OS=Homo sapiens GN=MYO1A PE=2 SV=1 130 119238 3 3 2 2 4335 3979 1 0 1 619.9946 1856.9621 3 1856.9632 -0.0011 0 31.59 0.0011 K EQLLQSNPVLEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5324.5324.3.dta 3 MYH4_HUMAN Myosin-4 OS=Homo sapiens GN=MYH4 PE=2 SV=2 64 223902 3 3 3 3 1168 2260 1 0 1 509.261 1016.5075 2 1016.5073 0.0002 0 55.96 2.50E-05 R CNGVLEGIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3503.3503.2.dta 3 MYH4_HUMAN Myosin-4 OS=Homo sapiens GN=MYH4 PE=2 SV=2 64 223902 3 3 3 3 1188 389 1 0 0 512.7438 1023.473 2 1023.4734 -0.0004 1 28.45 0.01 R NDNSSRFGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1425.1425.2.dta 3 MYH4_HUMAN Myosin-4 OS=Homo sapiens GN=MYH4 PE=2 SV=2 64 223902 3 3 3 3 3583 2958 2 0 1 787.9038 1573.7931 2 1573.7882 0.0049 1 22.54 0.039 R RANLMQAEVEELR A Oxidation (M) 0.0000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4258.4258.2.dta 3 MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens GN=MYO1D PE=1 SV=2 32 116927 2 2 2 2 1110 5320 1 0 1 501.7732 1001.5319 2 1001.5328 -0.0009 1 25.84 0.03 R CIKPNDKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.965.965.2.dta 3 MYO1D_HUMAN Unconventional myosin-Id OS=Homo sapiens GN=MYO1D PE=1 SV=2 32 116927 2 2 2 2 1188 389 1 0 0 512.7438 1023.473 2 1023.4734 -0.0004 1 28.45 0.01 R NDNSSRFGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1425.1425.2.dta 3 MYH15_HUMAN Myosin-15 OS=Homo sapiens GN=MYH15 PE=1 SV=5 28 225904 1 1 1 1 1188 389 1 0 0 512.7438 1023.473 2 1023.4734 -0.0004 1 28.45 0.01 R NDNSSRFGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1425.1425.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 104 1220 2 1 1 330.1849 658.3553 2 658.3551 0.0002 0 25.29 0.028 K AWVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2347.2347.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 152 74 1 1 1 341.6851 681.3557 2 681.3558 -0.0001 0 25.7 0.02 K HQEIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1082.1082.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 178 1173 1 1 1 344.6974 687.3802 2 687.3803 -0.0001 0 22.6 0.048 R IDALEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2295.2295.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 203 102 1 1 1 351.6837 701.3529 2 701.353 -0.0001 0 24.93 0.017 R HASLMK R Oxidation (M) 0.000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1112.1112.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 260 331 1 1 1 365.7267 729.4388 2 729.4385 0.0004 1 28.84 0.014 R LKDINK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1363.1363.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 263 172 1 1 1 370.1958 738.377 2 738.3773 -0.0002 0 28.9 0.0073 R NALHER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1192.1192.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 369 544 3 1 1 394.2552 786.4959 2 786.4963 -0.0004 1 22.1 0.019 R IKAVTQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1596.1596.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 370 220 1 1 1 394.2555 786.4965 2 786.4963 0.0002 1 22.09 0.019 R IKAVTQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1244.1244.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 426 5318 1 1 1 405.7325 809.4505 2 809.4508 -0.0003 1 31.73 0.0035 R KHQEIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.963.963.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 639 140 1 1 1 434.7352 867.4559 2 867.4562 -0.0003 1 15.97 0.047 R KHEGLER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1156.1156.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 744 754 1 1 1 451.246 900.4775 2 900.4777 -0.0003 1 34.55 0.0032 R RNEVLDR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1829.1829.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 757 798 1 1 1 453.211 904.4074 2 904.4072 0.0002 0 32.88 0.0026 K ALCAEADR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1878.1878.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 792 561 1 1 1 457.7618 913.5091 2 913.5094 -0.0002 1 37.7 0.0011 R RQQVLDR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1615.1615.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 796 667 1 1 1 305.8273 914.4601 3 914.461 -0.0009 0 21.72 0.016 R LNHQEFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1733.1733.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 834 1362 1 1 1 464.232 926.4494 2 926.4498 -0.0003 1 32.56 0.0028 K KFDDFQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2505.2505.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 850 226 1 1 1 466.7272 931.4398 2 931.4399 -0.0001 1 35.25 0.0017 K KHEDFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1250.1250.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 917 1928 1 1 1 473.7635 945.5125 2 945.5131 -0.0006 0 40.08 0.00049 K LTVLSEER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3133.3133.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 934 5338 1 1 1 318.8418 953.5036 3 953.5042 -0.0007 1 55.62 1.40E-05 R AKLNESHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.987.987.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 935 5334 1 1 1 477.7593 953.5041 2 953.5042 -0.0002 1 48.04 7.80E-05 R AKLNESHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.983.983.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1058 2125 1 1 1 495.7718 989.529 2 989.5294 -0.0004 0 63.97 4.60E-06 K LFGAAEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3353.3353.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1071 1791 1 1 1 331.8619 992.5638 3 992.5655 -0.0017 1 21.53 0.026 R FKELSTLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2980.2980.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1072 1788 1 1 1 497.2898 992.565 2 992.5655 -0.0004 1 38.49 0.00035 R FKELSTLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2977.2977.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1154 2106 1 1 1 508.2802 1014.5459 2 1014.5458 0.0001 0 45.8 0.00023 R DLTGVQNLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3332.3332.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1170 1891 1 1 1 509.7742 1017.5339 2 1017.5342 -0.0003 0 36.91 0.0022 R GLVSSDELAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3092.3092.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1258 711 1 1 1 520.7595 1039.5045 2 1039.5047 -0.0002 0 53.63 2.90E-05 K LGDSHDLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1782.1782.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1259 723 1 1 1 347.5088 1039.5046 3 1039.5047 0 0 23.31 0.016 K LGDSHDLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1795.1795.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1431 2595 1 1 1 540.2979 1078.5812 2 1078.5811 0 0 21.76 0.041 R QGFVPAAYVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3874.3874.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1457 3668 1 1 1 543.3193 1084.6241 2 1084.624 0.0001 0 60.06 5.30E-06 R DLASVQALLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5003.5003.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1515 1560 1 1 1 550.7955 1099.5764 2 1099.5774 -0.001 0 37.52 0.002 K LLEAQSHFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2723.2723.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1516 1558 1 1 1 367.533 1099.5772 3 1099.5774 -0.0002 0 27.25 0.016 K LLEAQSHFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2720.2720.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1551 2083 1 1 1 554.7847 1107.5548 2 1107.556 -0.0012 0 41.67 0.00012 K LLVGSEDYGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3306.3306.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1554 2817 1 1 1 554.7977 1107.5809 2 1107.5812 -0.0003 0 45.77 0.00016 K ITALDEFATK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4113.4113.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1571 3796 1 1 1 556.8369 1111.6592 2 1111.6601 -0.0009 0 42.17 0.00013 K DLIGVQNLLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5134.5134.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1609 3596 1 1 1 560.297 1118.5794 2 1118.5794 0.0001 0 38.08 0.0015 R MNEVISLWK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4926.4926.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1676 3347 1 1 1 568.2944 1134.5742 2 1134.5743 -0.0001 0 42.15 0.00038 R MNEVISLWK K Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4664.4664.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1751 2316 1 1 1 577.7694 1153.5243 2 1153.5251 -0.0008 0 86.95 7.70E-09 K SSEEIESAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3564.3564.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1769 2436 1 1 1 579.3083 1156.6021 2 1156.6029 -0.0008 0 24.13 0.022 R LAQFVEHWK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3697.3697.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1809 2275 1 1 1 583.2961 1164.5776 2 1164.5775 0.0001 0 43.93 0.00018 K EELYQNLTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3519.3519.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1858 1168 1 1 1 586.8163 1171.6181 2 1171.6197 -0.0015 1 36.76 0.0016 R ELELQKEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2289.2289.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1866 2886 1 1 1 587.3087 1172.6029 2 1172.6037 -0.0008 0 62.4 4.90E-06 K DVTGAEALLER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4185.4185.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 1909 4052 1 1 1 591.8239 1181.6332 2 1181.6332 -0.0001 0 43.95 0.00024 K VEDLFLTFAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5398.5398.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2034 3383 1 1 1 602.8423 1203.6701 2 1203.6711 -0.0009 0 55.89 1.30E-05 R DLSSVQTLLTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4703.4703.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2092 2333 1 1 1 607.871 1213.7274 2 1213.7281 -0.0008 1 37.38 0.00044 K LLEATELKGIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3583.3583.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2101 578 1 1 1 608.3192 1214.6239 2 1214.6255 -0.0016 1 45.17 0.00016 R EKEPIAASTNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1634.1634.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2107 2440 1 1 1 608.8251 1215.6357 2 1215.636 -0.0003 0 64.86 3.50E-06 R WSQLLANSAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3702.3702.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2302 2177 1 1 1 629.3426 1256.6706 2 1256.6724 -0.0018 1 40.15 0.00084 K QKLDILDQER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3410.3410.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2324 639 1 1 1 631.7968 1261.5791 2 1261.5799 -0.0009 0 35.62 0.0013 R EANQQQQFNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1702.1702.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2505 438 1 1 1 646.3058 1290.5971 2 1290.5986 -0.0015 1 77.9 9.60E-08 R GACAGSEDAVKAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1478.1478.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2554 3068 1 1 1 649.3945 1296.7745 2 1296.7765 -0.002 1 55.17 4.10E-06 R GKDLIGVQNLLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4373.4373.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2555 3079 1 1 1 433.266 1296.7761 3 1296.7765 -0.0005 1 30.27 0.0014 R GKDLIGVQNLLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4385.4385.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2575 1676 1 1 1 651.8301 1301.6457 2 1301.6463 -0.0006 0 87.95 1.10E-08 K VLETAEDIQER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2853.2853.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2583 3097 1 1 1 652.3377 1302.6609 2 1302.6602 0.0007 0 57.53 1.70E-05 R GVIDMGNSLIER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4404.4404.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2638 3717 1 1 1 655.8708 1309.727 2 1309.7282 -0.0012 1 79.74 4.40E-08 R KVEDLFLTFAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5053.5053.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2681 2370 1 1 1 660.3341 1318.6537 2 1318.6551 -0.0014 0 48.6 6.20E-05 R GVIDMGNSLIER G Oxidation (M) 0.000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3624.3624.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2701 1352 1 1 1 662.8514 1323.6883 2 1323.6895 -0.0012 0 61.54 5.30E-06 R SQLLGSAHEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2494.2494.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 2702 1359 1 1 1 442.2371 1323.6894 3 1323.6895 -0.0001 0 26.56 0.017 R SQLLGSAHEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2502.2502.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3005 2270 1 1 1 697.3566 1392.6986 2 1392.6997 -0.0012 0 63.81 3.70E-06 K LGESQTLQQFSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3514.3514.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3127 3923 1 1 1 717.3427 1432.6709 2 1432.6722 -0.0013 0 65.85 6.70E-07 R DVDEIEAWISEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5266.5266.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3204 2380 1 1 1 725.3458 1448.6771 2 1448.6783 -0.0012 1 64.4 2.70E-06 R DSDELKSWVNEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3635.3635.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3226 1462 1 1 1 729.8796 1457.7446 2 1457.7474 -0.0028 1 45.39 0.00021 K VLETAEDIQERR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2616.2616.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3332 1544 1 1 1 748.375 1494.7354 2 1494.7361 -0.0007 0 49 8.60E-05 R MQHNLEQQIQAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2706.2706.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3333 1543 1 1 1 499.2524 1494.7355 3 1494.7361 -0.0006 0 22.22 0.016 R MQHNLEQQIQAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2705.2705.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3346 3270 1 1 1 751.3669 1500.7193 2 1500.7208 -0.0015 0 68.35 5.90E-07 R EANELQQWINEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4583.4583.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3367 1403 1 1 1 504.5844 1510.7313 3 1510.731 0.0003 0 38.24 0.00039 R MQHNLEQQIQAR N Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2550.2550.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3384 3287 1 1 1 759.3765 1516.7384 2 1516.7409 -0.0025 1 51.87 4.70E-05 R DAEELEKWIQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4602.4602.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3425 744 1 1 1 511.2622 1530.7647 3 1530.7651 -0.0004 1 36.33 0.0011 K LREANQQQQFNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1818.1818.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3506 1445 1 1 1 519.6021 1555.7845 3 1555.7855 -0.001 0 75.57 2.10E-07 K HQALQAEIAGHEPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2597.2597.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3609 2993 1 1 1 793.9172 1585.8199 2 1585.8212 -0.0013 1 69.95 7.90E-07 K REELITNWEQIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4294.4294.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3614 1707 1 1 1 794.3784 1586.7423 2 1586.7437 -0.0014 0 80.63 2.80E-08 K HQAFEAELSANQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2887.2887.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3615 1706 1 1 1 529.9216 1586.7429 3 1586.7437 -0.0008 0 44.44 7.30E-05 K HQAFEAELSANQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2886.2886.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3616 3882 1 1 1 794.3871 1586.7597 2 1586.7617 -0.0019 0 63.83 1.60E-06 R ELPTAFDYVEFTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5224.5224.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3671 2011 1 1 1 535.9545 1604.8418 3 1604.8409 0.0008 0 31.05 0.0015 K LIQEQHPEEELIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3225.3225.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3681 1480 1 1 1 536.9213 1607.742 3 1607.744 -0.0021 0 44.86 6.20E-05 K HQAFEAELHANADR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2636.2636.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3734 4017 1 1 1 815.9507 1629.8869 2 1629.8879 -0.0009 0 70.63 4.50E-07 R LAALADQWQFLVQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5362.5362.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3737 1763 1 1 1 545.2684 1632.7835 3 1632.7856 -0.0021 0 71.17 2.20E-07 K HQLLEADISAHEDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2949.2949.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3917 1848 1 1 1 571.9682 1712.8828 3 1712.8846 -0.0018 1 38.03 0.00084 K LIDVNHYAKDEVAAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3044.3044.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3940 1271 1 1 1 575.2874 1722.8402 3 1722.8424 -0.0022 0 40.79 0.00033 R LIQSHPESAEDLQEK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2404.2404.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 3941 1280 1 1 1 862.4277 1722.8408 2 1722.8424 -0.0016 0 69.71 7.30E-07 R LIQSHPESAEDLQEK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2414.2414.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4011 1177 1 1 1 869.4171 1736.8197 2 1736.8217 -0.002 1 42.87 9.50E-05 K TATDEAYKDPSNLQGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2299.2299.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4012 1167 1 1 1 579.9473 1736.82 3 1736.8217 -0.0017 1 38.37 0.00046 K TATDEAYKDPSNLQGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2288.2288.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4026 1404 1 1 1 582.6266 1744.8581 3 1744.8591 -0.001 1 57.72 1.20E-05 K LSDDNTIGKEEIQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2552.2552.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4027 1409 1 1 1 873.4367 1744.8589 2 1744.8591 -0.0003 1 88.84 9.40E-09 K LSDDNTIGKEEIQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2557.2557.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4035 1631 1 1 1 583.2845 1746.8318 3 1746.8325 -0.0007 1 24.34 0.026 R QFQDAGHFDAENIKK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2803.2803.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4192 3474 1 1 1 600.9682 1799.8828 3 1799.8842 -0.0015 1 35.37 0.00048 K GRELPTAFDYVEFTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4799.4799.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4323 2315 1 1 1 927.9379 1853.8612 2 1853.8643 -0.0031 1 89.19 4.30E-09 R ETENVKSSEEIESAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3563.3563.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4324 2314 1 1 1 618.9618 1853.8635 3 1853.8643 -0.0007 1 29.73 0.0016 R ETENVKSSEEIESAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3562.3562.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4339 2802 1 1 1 929.9775 1857.9405 2 1857.9432 -0.0027 1 94.36 2.30E-09 R DLAALGDKVNSLGETAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4098.4098.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4340 2807 1 1 1 620.3212 1857.9417 3 1857.9432 -0.0015 1 58.42 8.60E-06 R DLAALGDKVNSLGETAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4103.4103.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4506 3574 1 1 1 976.4699 1950.9253 2 1950.9283 -0.003 0 159.11 6.40E-16 R SSLSSAQADFNQLAELDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4903.4903.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4573 3019 1 1 1 991.0084 1980.0023 2 1980.0051 -0.0028 1 58.91 3.00E-06 K SLSAQEEKITALDEFATK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4320.4320.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4574 3017 1 1 1 661.0089 1980.0049 3 1980.0051 -0.0002 1 37.59 0.00041 K SLSAQEEKITALDEFATK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4319.4319.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4706 1325 1 1 1 675.6633 2023.9682 3 2023.9698 -0.0016 1 34.3 0.0018 K LQTASDESYKDPTNIQSK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2464.2464.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4721 1933 1 1 1 678.6755 2033.0046 3 2033.0065 -0.0019 1 22.29 0.019 K LQIASDENYKDPTNLQGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3138.3138.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 4842 2926 1 1 1 702.3709 2104.0909 3 2104.0913 -0.0004 1 31.58 0.0012 K LLVGSEDYGRDLTGVQNLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4225.4225.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 5037 3556 1 1 1 753.3835 2257.1286 3 2257.1325 -0.0039 0 65.48 1.50E-06 K EAALTSEEVGADLEQVEVLQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4885.4885.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 5038 3565 1 1 1 1129.5729 2257.1312 2 2257.1325 -0.0013 0 83.42 1.50E-08 K EAALTSEEVGADLEQVEVLQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4894.4894.2.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 5091 2599 1 1 1 776.7148 2327.1227 3 2327.1254 -0.0027 0 32.5 0.0017 K NQALNTDNYGHDLASVQALQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3878.3878.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 5120 2428 1 1 1 809.4249 2425.253 3 2425.2489 0.0041 1 30.03 0.0039 R ALSSEGKPYVTKEELYQNLTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3688.3688.3.dta 4 1 SPTN1_HUMAN "Spectrin alpha chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTAN1 PE=1 SV=3" 2812 285163 99 99 80 80 5185 2918 1 1 1 862.1028 2583.2865 3 2583.2888 -0.0023 1 37.82 0.00028 R ENLLEEQGSIALRQEQIDNQTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4217.4217.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 121 618 1 1 0 334.7078 667.401 2 667.4017 -0.0007 0 20.49 0.023 K LTGLHK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1678.1678.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 142 2131 4 1 1 339.2207 676.4268 2 676.4272 -0.0004 0 19.54 0.016 R IIYIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3359.3359.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 173 940 1 1 1 344.2054 686.3963 2 686.3963 0 0 35.85 0.0029 K ALAVEGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2036.2036.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 193 3350 1 1 1 349.6971 697.3797 2 697.3799 -0.0002 0 23.84 0.02 R FSLFGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4667.4667.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 233 2754 1 1 1 360.2259 718.4373 2 718.4377 -0.0004 0 37.94 0.00059 K ALQFLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4047.4047.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 241 1625 1 1 1 361.6952 721.3758 2 721.3759 -0.0001 0 27.56 0.013 R FSALER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2796.2796.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 253 1137 4 0 1 365.2162 728.4179 2 728.4181 -0.0002 0 27.14 0.021 K LEQLAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2255.2255.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 354 1018 1 1 1 391.7298 781.445 2 781.4446 0.0004 0 31.05 0.0029 K HNLLASK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2123.2123.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 396 129 1 1 1 399.7396 797.4646 2 797.4647 -0.0001 0 17.5 0.045 R TVEKPPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1143.1143.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 413 1172 1 1 1 402.2167 802.4189 2 802.4185 0.0004 0 37.87 0.0024 R LSGIEER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2294.2294.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 575 569 1 1 1 423.2635 844.5124 2 844.513 -0.0006 1 20.63 0.034 K RLTVQTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1624.1624.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 583 130 1 1 1 425.7261 849.4377 2 849.4378 -0.0002 1 27.63 0.02 R KLTGMER D Oxidation (M) 0.0000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1144.1144.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 617 2197 1 1 1 429.7501 857.4856 2 857.4858 -0.0002 0 24.92 0.029 R DLVAIEAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3433.3433.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 621 49 1 1 1 430.2533 858.492 2 858.4923 -0.0003 1 24.47 0.037 K KNQTLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1055.1055.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 765 2749 1 1 1 454.2294 906.4443 2 906.4447 -0.0004 0 34.17 0.0034 R IDDIFER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4042.4042.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 773 60 1 1 1 304.1663 909.477 3 909.478 -0.001 1 42.31 0.00039 R RLEEAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1066.1066.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 774 58 1 1 1 455.746 909.4775 2 909.478 -0.0005 1 47.2 0.00012 R RLEEAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1064.1064.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 784 1540 1 1 1 456.7849 911.5552 2 911.5553 -0.0001 0 54.36 6.20E-06 R VQAVVAVAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2702.2702.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 801 285 1 1 1 458.7354 915.4562 2 915.4562 0 1 34.52 0.0022 K RHEAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1314.1314.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 899 863 1 1 1 472.2407 942.4668 2 942.4671 -0.0003 0 21.48 0.035 K EIHQFNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1950.1950.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 977 138 1 1 1 482.7513 963.488 2 963.4886 -0.0006 0 38.3 0.0012 K EIQGHQPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1154.1154.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1053 607 1 1 1 495.2363 988.458 2 988.4574 0.0007 0 50.32 3.80E-05 R DTGNIGQER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1666.1666.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1156 2778 1 1 1 508.2917 1014.5688 2 1014.5709 -0.0022 0 64.27 3.30E-06 K LLEVLSGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4074.4074.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1160 1080 1 1 1 508.7775 1015.5404 2 1015.541 -0.0006 1 35.07 0.0029 R GRLSGIEER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2192.2192.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1219 224 1 1 1 515.2933 1028.572 2 1028.5727 -0.0007 1 31.65 0.005 R VRGVNASAQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1248.1248.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1315 1961 1 1 1 525.748 1049.4814 2 1049.4811 0.0003 0 45.46 5.50E-05 K SLLDACESR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3169.3169.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1410 292 1 1 1 537.2881 1072.5617 2 1072.5625 -0.0008 1 39.12 0.0013 K AQQDKLNTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1322.1322.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1411 295 1 1 1 358.5282 1072.5629 3 1072.5625 0.0004 1 38.81 0.00094 K AQQDKLNTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1325.1325.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1507 339 1 1 1 549.7987 1097.5829 2 1097.5829 0 0 34.59 0.0017 R QIEAQEKPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1372.1372.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1561 2799 1 1 1 555.2954 1108.5763 2 1108.5764 -0.0002 0 43.89 0.00019 R ITDLYTDLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4095.4095.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1587 3653 1 1 1 558.3364 1114.6582 2 1114.6598 -0.0016 0 27.72 0.0053 K DLTSVNILLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4986.4986.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1642 1099 1 1 1 564.279 1126.5434 2 1126.5441 -0.0006 0 29.04 0.0081 R IHCLENVDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2213.2213.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1663 2193 1 1 1 566.8257 1131.6368 2 1131.64 -0.0032 1 28.84 0.0042 K ALQFLKEQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3428.3428.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1927 3800 1 1 1 593.8556 1185.6966 2 1185.6969 -0.0002 0 70.74 2.70E-07 R LTTLELLEVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5138.5138.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 1935 1133 1 1 1 595.2934 1188.5722 2 1188.5735 -0.0012 0 58.17 1.20E-05 R LVSDGNINSDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2250.2250.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2030 1354 1 1 1 602.3015 1202.5885 2 1202.5891 -0.0007 0 54.77 3.10E-05 R DQNTVETLQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2496.2496.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2045 1615 1 1 1 603.798 1205.5815 2 1205.5822 -0.0007 1 22.82 0.032 K SLLDACESRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2784.2784.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2106 2936 1 1 1 608.8103 1215.6061 2 1215.607 -0.001 0 35.02 0.0027 R DGMAFNALIHK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4236.4236.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2164 2554 1 1 1 613.8637 1225.7129 2 1225.7142 -0.0014 1 26.49 0.0054 R ELALRNELIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3828.3828.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2194 1472 1 1 1 616.8033 1231.592 2 1231.5932 -0.0012 0 27.09 0.0029 R EIGQSVDEVEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2627.2627.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2195 2398 1 1 1 616.8078 1231.601 2 1231.6019 -0.0009 0 16.61 0.028 R DGMAFNALIHK H Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3655.3655.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2237 2637 1 1 1 621.3533 1240.692 2 1240.6928 -0.0008 0 47.85 8.80E-05 R LILEVHQFSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3919.3919.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2238 2639 1 1 1 414.5715 1240.6927 3 1240.6928 -0.0001 0 21.46 0.038 R LILEVHQFSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3922.3922.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2287 2191 1 1 1 419.2187 1254.6343 3 1254.6357 -0.0013 0 50.52 6.00E-05 K HRPDLIDFDK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3426.3426.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2329 2979 1 1 1 632.35 1262.6854 2 1262.687 -0.0016 0 30.71 0.0049 K QALQDTLALYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4279.4279.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2383 3941 1 1 1 639.3218 1276.629 2 1276.6308 -0.0018 0 47.62 0.00015 K DALLLWCQMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5284.5284.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2511 3522 1 1 1 647.3188 1292.6231 2 1292.6257 -0.0026 0 41.37 0.00061 K DALLLWCQMK T Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4848.4848.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2522 2402 1 1 1 648.8095 1295.6045 2 1295.6067 -0.0023 0 50.54 1.80E-05 K EAVCEVALDYK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3659.3659.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2586 980 1 1 1 652.3661 1302.7176 2 1302.7183 -0.0007 1 24.05 0.013 R TVEKPPKFTEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2080.2080.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2633 850 1 1 1 655.8198 1309.625 2 1309.6262 -0.0012 0 57.55 9.50E-06 R ALVADSHPESER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1936.1936.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2634 848 1 1 1 437.5493 1309.6262 3 1309.6262 0 0 19.1 0.032 R ALVADSHPESER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1934.1934.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2777 3204 1 1 1 671.9052 1341.7959 2 1341.798 -0.0021 1 19.6 0.021 R LTTLELLEVRR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4514.4514.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2870 1502 1 1 1 680.821 1359.6275 2 1359.6306 -0.0031 0 33.52 0.0021 R ELEAENYHDIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2660.2660.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2897 1900 1 1 1 684.3859 1366.7573 2 1366.7568 0.0005 0 63.4 1.60E-06 K TALPAQSAATLPAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3102.3102.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2940 4056 1 1 1 691.3218 1380.629 2 1380.631 -0.002 0 74.91 1.70E-07 R DLDDFQSWLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5402.5402.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 2990 3848 1 1 1 695.8547 1389.6949 2 1389.6962 -0.0013 0 34.55 0.0032 K FMELLEPLNER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5188.5188.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3000 2522 1 1 1 696.3976 1390.7806 2 1390.782 -0.0014 1 74.64 1.40E-07 R KQALQDTLALYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3793.3793.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3050 3205 1 1 1 703.852 1405.6895 2 1405.6911 -0.0016 0 49.62 9.10E-05 K FMELLEPLNER K Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4515.4515.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3142 2631 1 1 1 719.3696 1436.7247 2 1436.726 -0.0012 1 31.86 0.0046 R ITDLYTDLRDGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3913.3913.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3143 2621 1 1 1 479.9156 1436.7251 3 1436.726 -0.0008 1 21.74 0.016 R ITDLYTDLRDGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3903.3903.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3215 3166 1 1 1 726.8542 1451.6938 2 1451.6966 -0.0028 0 65.74 6.90E-07 K MWEVLESTTQTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4475.4475.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3231 3834 1 1 1 730.3553 1458.696 2 1458.6991 -0.0031 0 76.38 1.50E-07 R DVEDEILWVGER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5173.5173.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3244 4287 1 1 1 731.4183 1460.8221 2 1460.8239 -0.0018 0 72.9 1.40E-07 K GNLEVLLFTIQSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5642.5642.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3351 3797 1 1 1 751.8593 1501.7041 2 1501.7049 -0.0008 0 62.94 2.20E-06 R EVDDLEQWIAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5135.5135.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3380 1195 1 1 1 758.8723 1515.73 2 1515.7317 -0.0018 1 80.09 6.30E-08 R ELEAENYHDIKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2319.2319.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3406 2728 1 1 1 762.8932 1523.7719 2 1523.7732 -0.0013 0 49.95 5.20E-05 R LQALDTGWNELHK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4018.4018.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3407 2723 1 1 1 508.9314 1523.7725 3 1523.7732 -0.0008 0 22.84 0.03 R LQALDTGWNELHK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4013.4013.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3517 3577 1 1 1 779.4037 1556.7928 2 1556.7947 -0.0018 0 72.07 2.20E-07 R EQWANLEQLSAIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4906.4906.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3611 3226 1 1 1 793.934 1585.8535 2 1585.8563 -0.0028 1 85.86 1.70E-08 R EIGQSVDEVEKLIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4537.4537.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3745 2880 1 1 1 546.934 1637.7801 3 1637.7798 0.0003 1 34.81 0.00058 K SAATWDERFSALER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4179.4179.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3896 3036 1 1 1 854.9004 1707.7862 2 1707.7886 -0.0024 0 84.94 1.10E-08 R TQETPSAQMEGFLNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4338.4338.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 3935 2510 1 1 1 861.4153 1720.8161 2 1720.8156 0.0006 0 57.99 1.10E-05 K LLDPEDISVDHPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3779.3779.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4049 2374 1 1 1 585.9797 1754.9174 3 1754.9203 -0.0029 0 17.32 0.024 K TAASGIPYHSEVPVSLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3628.3628.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4050 2382 1 1 1 878.4664 1754.9182 2 1754.9203 -0.0021 0 59.65 2.60E-06 K TAASGIPYHSEVPVSLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3637.3637.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4088 2087 1 1 1 887.9331 1773.8517 2 1773.8533 -0.0016 1 67.51 1.20E-06 K KHEAIETDIAAYEER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3310.3310.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4089 2084 1 1 1 592.2918 1773.8536 3 1773.8533 0.0003 1 31.79 0.001 K KHEAIETDIAAYEER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3307.3307.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4098 2604 1 1 1 889.4474 1776.8803 2 1776.8853 -0.005 0 122.13 4.10E-12 R SQNIVTDSSSLSAEAIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3884.3884.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4391 2443 1 1 1 944.4685 1886.9225 2 1886.9221 0.0004 0 109.93 4.90E-11 K EIEELQSQAQALSQEGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3705.3705.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4460 2574 1 1 1 961.9686 1921.9227 2 1921.9269 -0.0042 1 77.51 9.20E-08 R FQIQDISVETEDNKEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3850.3850.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4461 2567 1 1 1 641.6487 1921.9244 3 1921.9269 -0.0025 1 26.26 0.013 R FQIQDISVETEDNKEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3843.3843.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4507 1985 1 1 1 651.6436 1951.9088 3 1951.9098 -0.001 0 55.15 1.60E-05 K FATDGEGYKPCDPQVIR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3196.3196.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4638 2126 1 1 1 666.6793 1997.016 3 1997.0178 -0.0018 1 51.44 1.80E-05 K LPEELGRDQNTVETLQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3354.3354.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4699 3873 1 1 1 1011.5111 2021.0077 2 2021.0106 -0.0029 0 86.83 8.90E-09 R LVSQDNFGFDLPAVEAATK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5215.5215.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4700 3900 1 1 1 674.6766 2021.0079 3 2021.0106 -0.0027 0 78.5 8.10E-08 R LVSQDNFGFDLPAVEAATK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5242.5242.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4757 1974 1 1 1 684.335 2049.9832 3 2049.9855 -0.0023 0 20.36 0.013 K IVSSSDVGHDEYSTQSLVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3184.3184.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4758 1966 1 1 1 1025.9991 2049.9837 2 2049.9855 -0.0018 0 77.59 5.30E-08 K IVSSSDVGHDEYSTQSLVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3175.3175.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4759 1954 1 1 1 684.3358 2049.9856 3 2049.9855 0.0001 0 55.5 1.90E-05 K IVSSSDVGHDEYSTQSLVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3162.3162.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4781 2504 1 1 1 1030.0547 2058.0948 2 2058.0957 -0.0009 1 95 1.40E-09 R AQTLPTSVVTITSESSPGKR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3773.3773.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4820 4157 1 1 1 698.0159 2091.026 3 2091.0273 -0.0013 0 30.61 0.0023 R DASVAEAWLLGQEPYLSSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5504.5504.3.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4821 4147 1 1 1 1046.5208 2091.027 2 2091.0273 -0.0003 0 85.11 1.10E-08 R DASVAEAWLLGQEPYLSSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5494.5494.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4881 3207 1 1 1 1073.5425 2145.0704 2 2145.0736 -0.0032 0 112.75 2.70E-11 K VIESTQDLGNDLAGVMALQR K Oxidation (M) 0.00000000000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4517.4517.2.dta 5 1 SPTB2_HUMAN "Spectrin beta chain, non-erythrocytic 1 OS=Homo sapiens GN=SPTBN1 PE=1 SV=2" 2548 275237 92 92 76 76 4918 1629 1 1 1 727.0336 2178.0789 3 2178.0804 -0.0016 1 44.36 0.00023 K IVSSSDVGHDEYSTQSLVKK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2800.2800.3.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 104 1220 1 0 1 330.1849 658.3553 2 658.351 0.0043 1 28.33 0.014 R AGERAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2347.2347.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 173 940 1 0 1 344.2054 686.3963 2 686.3963 0 0 35.85 0.0029 K ALAVEGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2036.2036.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 233 2754 1 0 1 360.2259 718.4373 2 718.4377 -0.0004 0 37.94 0.00059 K ALQFLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4047.4047.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 396 129 1 0 1 399.7396 797.4646 2 797.4647 -0.0001 0 17.5 0.045 R TVEKPPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1143.1143.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 621 49 1 0 1 430.2533 858.492 2 858.4923 -0.0003 1 24.47 0.037 K KNQTLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1055.1055.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 1587 3653 1 0 1 558.3364 1114.6582 2 1114.6598 -0.0016 0 27.72 0.0053 K DLTSVNILLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4986.4986.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 1642 1099 1 0 1 564.279 1126.5434 2 1126.5441 -0.0006 0 29.04 0.0081 R IHCLENVDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2213.2213.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 2383 3941 1 0 1 639.3218 1276.629 2 1276.6308 -0.0018 0 47.62 0.00015 K DALLLWCQMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5284.5284.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 2511 3522 1 0 1 647.3188 1292.6231 2 1292.6257 -0.0026 0 41.37 0.00061 K DALLLWCQMK T Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4848.4848.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 2586 980 1 0 1 652.3661 1302.7176 2 1302.7183 -0.0007 1 24.05 0.013 R TVEKPPKFTEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2080.2080.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 3244 4287 1 0 1 731.4183 1460.8221 2 1460.8239 -0.0018 0 72.9 1.40E-07 K GNLEVLLFTIQSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5642.5642.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 4460 2574 1 0 1 961.9686 1921.9227 2 1921.9269 -0.0042 1 77.51 9.20E-08 R FQIQDISVETEDNKEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3850.3850.2.dta 5 SPTN2_HUMAN "Spectrin beta chain, non-erythrocytic 2 OS=Homo sapiens GN=SPTBN2 PE=1 SV=3" 251 272526 13 13 11 11 4461 2567 1 0 1 641.6487 1921.9244 3 1921.9269 -0.0025 1 26.26 0.013 R FQIQDISVETEDNKEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3843.3843.3.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 233 2754 1 0 1 360.2259 718.4373 2 718.4377 -0.0004 0 37.94 0.00059 K ALQFLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4047.4047.2.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 253 1137 4 0 1 365.2162 728.4179 2 728.4181 -0.0002 0 27.14 0.021 K LEQLAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2255.2255.2.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 396 129 1 0 1 399.7396 797.4646 2 797.4647 -0.0001 0 17.5 0.045 R TVEKPPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1143.1143.2.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 801 285 1 0 1 458.7354 915.4562 2 915.4562 0 1 34.52 0.0022 K RHEAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1314.1314.2.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 1642 1099 1 0 1 564.279 1126.5434 2 1126.5441 -0.0006 0 29.04 0.0081 R IHCLENVDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2213.2213.2.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 1663 2193 1 0 1 566.8257 1131.6368 2 1131.64 -0.0032 1 28.84 0.0042 K ALQFLKEQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3428.3428.2.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 2164 2554 1 0 1 613.8637 1225.7129 2 1225.7142 -0.0014 1 26.49 0.0054 R ELALRNELIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3828.3828.2.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 2287 2191 1 0 1 419.2187 1254.6343 3 1254.6357 -0.0013 0 50.52 6.00E-05 K HRPDLIDFDK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3426.3426.3.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 2383 3941 1 0 1 639.3218 1276.629 2 1276.6308 -0.0018 0 47.62 0.00015 K DALLLWCQMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5284.5284.2.dta 5 SPTB1_HUMAN "Spectrin beta chain, erythrocytic OS=Homo sapiens GN=SPTB PE=1 SV=5" 163 247171 10 10 9 9 2511 3522 1 0 1 647.3188 1292.6231 2 1292.6257 -0.0026 0 41.37 0.00061 K DALLLWCQMK T Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4848.4848.2.dta 5 SPTN4_HUMAN "Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2" 109 290005 5 5 4 4 173 940 1 0 1 344.2054 686.3963 2 686.3963 0 0 35.85 0.0029 K ALAVEGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2036.2036.2.dta 5 SPTN4_HUMAN "Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2" 109 290005 5 5 4 4 233 2754 1 0 1 360.2259 718.4373 2 718.4377 -0.0004 0 37.94 0.00059 K ALQFLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4047.4047.2.dta 5 SPTN4_HUMAN "Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2" 109 290005 5 5 4 4 1663 2193 1 0 1 566.8257 1131.6368 2 1131.64 -0.0032 1 28.84 0.0042 K ALQFLKEQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3428.3428.2.dta 5 SPTN4_HUMAN "Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2" 109 290005 5 5 4 4 2383 3941 1 0 1 639.3218 1276.629 2 1276.6308 -0.0018 0 47.62 0.00015 K DALLLWCQMK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5284.5284.2.dta 5 SPTN4_HUMAN "Spectrin beta chain, non-erythrocytic 4 OS=Homo sapiens GN=SPTBN4 PE=1 SV=2" 109 290005 5 5 4 4 2511 3522 1 0 1 647.3188 1292.6231 2 1292.6257 -0.0026 0 41.37 0.00061 K DALLLWCQMK T Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4848.4848.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 18 5278 1 1 1 301.697 601.3794 2 601.3799 -0.0005 1 31.27 0.0075 R VIKDK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.912.912.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 37 445 1 1 1 309.1717 616.3288 2 616.3293 -0.0005 0 36.29 0.0033 R GSGLGAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1486.1486.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 98 1406 1 1 1 328.708 655.4014 2 655.4017 -0.0003 0 18.6 0.047 K LPLGTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2554.2554.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 138 436 1 1 1 338.1745 674.3345 2 674.3347 -0.0002 0 26.17 0.031 K EGSGLGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1476.1476.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 151 250 1 1 1 341.6611 681.3076 2 681.3082 -0.0006 0 37.94 0.00056 R YGATDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1276.1276.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 257 648 1 1 1 365.7085 729.4024 2 729.4021 0.0003 0 44.27 0.00038 K GPGITGTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1712.1712.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 275 255 1 1 1 372.7219 743.4292 2 743.429 0.0003 1 40.76 0.0013 K KGALAER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1282.1282.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 306 320 1 1 1 380.209 758.4035 2 758.4035 0 0 25.32 0.036 K QTQLNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1352.1352.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 314 348 2 1 1 381.7165 761.4184 2 761.4184 0 1 31.95 0.0037 R RQFPSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1382.1382.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 587 1185 1 1 1 426.7054 851.3962 2 851.396 0.0002 0 53.61 1.90E-05 K CGVQNFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2308.2308.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 771 999 1 1 0 455.2484 908.4822 2 908.4828 -0.0006 0 43.51 0.00028 K QNLEIHR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2102.2102.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 814 2293 1 1 1 461.2551 920.4956 2 920.4967 -0.0011 0 29.01 0.0079 K TINVEFAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3539.3539.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1052 227 1 1 1 494.793 987.5714 2 987.5713 0.0002 1 47.11 9.00E-05 K TKTAQQIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1252.1252.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1082 1715 1 1 1 498.7359 995.4572 2 995.4568 0.0003 0 26.47 0.0096 R MLQAMGWK E 2 Oxidation (M) 0.10001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2896.2896.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1107 218 1 1 1 501.7698 1001.5251 2 1001.5254 -0.0003 1 36.19 0.0019 K DKQTQLNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1242.1242.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1129 844 1 1 1 504.7555 1007.4964 2 1007.4971 -0.0007 1 25.65 0.025 K CGVQNFKR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1929.1929.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1163 490 1 1 1 508.79 1015.5655 2 1015.5662 -0.0007 1 34.57 0.0019 K GTKGPGITGTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1536.1536.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1164 499 1 1 1 339.5295 1015.5668 3 1015.5662 0.0006 1 27.59 0.0056 K GTKGPGITGTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1546.1546.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1304 532 1 1 1 524.2878 1046.5611 2 1046.5621 -0.001 0 44.38 0.00025 R HQQLSGLHK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1583.1583.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1334 1264 1 1 1 528.7607 1055.5069 2 1055.507 0 0 25.11 0.016 R QHTSMDLPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2396.2396.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1372 568 1 1 1 533.2988 1064.5831 2 1064.5839 -0.0008 1 25.7 0.013 K QNLEIHRR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1623.1623.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1399 542 1 1 1 536.7579 1071.5012 2 1071.5019 -0.0007 0 29.09 0.0058 R QHTSMDLPK L Oxidation (M) 0.000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1594.1594.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1400 564 1 1 1 358.1745 1071.5017 3 1071.5019 -0.0002 0 28.33 0.0062 R QHTSMDLPK L Oxidation (M) 0.000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1618.1618.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1474 1395 1 1 1 545.7592 1089.5038 2 1089.5051 -0.0013 0 50.44 5.30E-05 R DGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2542.2542.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1729 2582 1 1 1 574.806 1147.5975 2 1147.5986 -0.0011 0 38.28 0.0013 K NSFQPISSLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3859.3859.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1903 504 1 1 1 590.8126 1179.6107 2 1179.6109 -0.0002 0 60.88 6.70E-06 R GQLQSHGVQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1552.1552.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1944 4787 1 1 1 596.2758 1190.5371 2 1190.539 -0.0019 0 19.78 0.035 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6285.6285.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1945 3935 1 1 1 596.2759 1190.5372 2 1190.539 -0.0018 0 36.34 0.00077 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5278.5278.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1946 4541 1 1 1 596.2761 1190.5377 2 1190.539 -0.0013 0 28.38 0.0048 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5931.5931.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1947 4729 1 1 1 596.2764 1190.5383 2 1190.539 -0.0007 0 27.3 0.0064 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6186.6186.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1948 4077 1 1 1 596.2764 1190.5383 2 1190.539 -0.0007 0 37.41 0.00063 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5424.5424.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1949 4427 1 1 1 596.2765 1190.5384 2 1190.539 -0.0006 0 33.65 0.0017 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5792.5792.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1950 2620 1 1 1 596.2766 1190.5387 2 1190.539 -0.0003 0 51.93 2.50E-05 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3902.3902.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1951 4222 1 1 1 596.2766 1190.5387 2 1190.539 -0.0003 0 42.35 0.00023 K INEDWLCNK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5575.5575.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1976 1780 1 1 1 598.7894 1195.5642 2 1195.5656 -0.0014 1 45.3 0.0002 K TMVTRFNEAQ - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2968.2968.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1982 4590 1 1 1 599.3318 1196.6491 2 1196.6513 -0.0022 0 27.79 0.0034 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5993.5993.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1983 4185 1 1 1 599.332 1196.6494 2 1196.6513 -0.002 0 34.01 0.002 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5535.5535.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1984 4819 1 1 1 599.3321 1196.6496 2 1196.6513 -0.0017 0 21.78 0.031 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6342.6342.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1985 3217 1 1 1 599.3321 1196.6496 2 1196.6513 -0.0017 0 39.37 0.00053 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4527.4527.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1986 3523 1 1 1 599.3322 1196.6498 2 1196.6513 -0.0016 0 37.06 0.00091 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4849.4849.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1987 4576 1 1 1 599.3323 1196.6501 2 1196.6513 -0.0012 0 28.17 0.007 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5972.5972.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1988 4449 1 1 1 599.3324 1196.6502 2 1196.6513 -0.0011 0 21.84 0.03 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5819.5819.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1989 4042 1 1 1 599.3324 1196.6502 2 1196.6513 -0.0011 0 28.4 0.0066 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5388.5388.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1990 3732 1 1 1 599.3325 1196.6505 2 1196.6513 -0.0009 0 37.17 0.00088 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5068.5068.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1991 3877 1 1 1 599.3325 1196.6505 2 1196.6513 -0.0009 0 34.48 0.0016 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5219.5219.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1992 2169 1 1 1 599.3326 1196.6506 2 1196.6513 -0.0007 0 78.98 6.80E-08 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3402.3402.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1993 4714 1 1 1 599.3328 1196.6511 2 1196.6513 -0.0002 0 29.29 0.0064 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6163.6163.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1994 4333 1 1 1 599.3328 1196.6511 2 1196.6513 -0.0002 0 27.9 0.0026 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5689.5689.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 1995 2486 1 0 1 599.3336 1196.6527 2 1196.6513 0.0013 0 33.04 0.0025 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3753.3753.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2081 1257 1 1 1 606.7871 1211.5597 2 1211.5605 -0.0008 1 35.11 0.0017 K TMVTRFNEAQ - Oxidation (M) 0.0100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2388.2388.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2192 303 1 1 1 616.7996 1231.5846 2 1231.5867 -0.0021 1 42.37 0.00025 K CGVPKSEAEQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1333.1333.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2193 304 1 1 1 411.536 1231.5862 3 1231.5867 -0.0005 1 44.52 0.00025 K CGVPKSEAEQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1334.1334.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2487 824 1 1 1 644.8206 1287.6266 2 1287.6281 -0.0016 0 22.91 0.037 K VSMHYSDPKPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1907.1907.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2489 820 1 1 1 430.2168 1287.6286 3 1287.6281 0.0004 0 23.35 0.024 K VSMHYSDPKPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1903.1903.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2501 1467 1 1 1 430.8871 1289.6393 3 1289.6398 -0.0004 1 30.37 0.0014 K TAQQIAKDMER W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2622.2622.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2572 738 1 1 1 651.7708 1301.527 2 1301.5273 -0.0003 1 33.08 0.00049 R DGDYRDQDYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1812.1812.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2573 740 1 1 1 434.8497 1301.5274 3 1301.5273 0.0001 1 33.38 0.00046 R DGDYRDQDYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1814.1814.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2589 305 1 1 1 652.8181 1303.6216 2 1303.6231 -0.0015 0 32.86 0.0032 K VSMHYSDPKPK I Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1335.1335.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2590 299 1 1 1 435.5482 1303.6228 3 1303.6231 -0.0002 0 26.06 0.012 K VSMHYSDPKPK I Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1329.1329.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2609 454 1 1 1 653.8239 1305.6332 2 1305.6347 -0.0015 1 40.85 0.00058 K TAQQIAKDMER W Oxidation (M) 0.00000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1496.1496.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2610 455 1 1 1 436.2187 1305.6342 3 1305.6347 -0.0004 1 25.17 0.0051 K TAQQIAKDMER W Oxidation (M) 0.00000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1497.1497.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2641 4323 1 1 1 656.8621 1311.7096 2 1311.7147 -0.0051 0 15.48 0.035 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5679.5679.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2645 2174 1 1 1 656.8639 1311.7132 2 1311.7147 -0.0014 0 38.13 0.00085 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3407.3407.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2651 4053 1 1 1 656.8651 1311.7157 2 1311.7147 0.001 0 15.1 0.038 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5399.5399.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2718 1506 1 1 1 664.8608 1327.7071 2 1327.7095 -0.0024 1 68.1 9.40E-07 K SEAEQKLPLGTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2665.2665.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2719 1512 1 1 1 443.5773 1327.7102 3 1327.7095 0.0006 1 29.35 0.008 K SEAEQKLPLGTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2672.2672.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2868 1984 1 1 1 680.3319 1358.6493 2 1358.65 -0.0007 0 43.44 0.00013 R MLPQAATEDDIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3195.3195.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2925 1750 1 1 1 688.3289 1374.6433 2 1374.6449 -0.0016 0 61.42 3.30E-06 R MLPQAATEDDIR G Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2935.2935.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 2948 1894 1 1 1 692.3612 1382.7079 2 1382.7081 -0.0003 1 19.52 0.015 R EKYGIPEPPEPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3095.3095.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3145 4485 1 1 1 719.8538 1437.6931 2 1437.6987 -0.0056 0 60.27 6.90E-06 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5864.5864.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3146 4119 1 1 1 719.8552 1437.6958 2 1437.6987 -0.0029 0 58.88 9.80E-06 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5466.5466.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3147 4598 1 1 1 719.8552 1437.6959 2 1437.6987 -0.0028 0 55.38 8.70E-06 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6004.6004.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3148 3984 1 1 1 719.8553 1437.6961 2 1437.6987 -0.0026 0 69.45 8.60E-07 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5329.5329.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3149 4256 1 1 1 719.856 1437.6974 2 1437.6987 -0.0013 0 53.11 2.90E-05 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5609.5609.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3150 2584 1 1 1 719.8561 1437.6976 2 1437.6987 -0.0011 0 89.34 9.20E-09 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3862.3862.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3151 3773 1 1 1 719.8561 1437.6976 2 1437.6987 -0.0011 0 68.96 1.00E-06 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5110.5110.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3152 4383 1 1 1 719.8566 1437.6986 2 1437.6987 -0.0001 0 60.33 7.30E-06 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5744.5744.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3153 2598 1 1 1 480.2403 1437.699 3 1437.6987 0.0003 0 44.7 0.00021 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3877.3877.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3154 4715 1 1 1 719.8573 1437.7 2 1437.6987 0.0013 0 55.71 1.90E-05 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6164.6164.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3171 1664 1 1 1 720.9111 1439.8077 2 1439.8096 -0.0019 1 43.64 0.00016 K KQGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2839.2839.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3172 1677 1 1 1 480.9434 1439.8083 3 1439.8096 -0.0013 1 22.77 0.019 K KQGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2854.2854.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3282 2295 1 1 1 741.8747 1481.7348 2 1481.7361 -0.0013 0 87.15 6.70E-09 R AHLSENELEALEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3542.3542.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3283 2296 1 1 1 494.9193 1481.7361 3 1481.7361 0 0 44.71 0.00011 R AHLSENELEALEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3543.3543.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3557 2251 1 1 1 783.9037 1565.7929 2 1565.7937 -0.0007 1 94.65 2.30E-09 R ESATADAGYAILEKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3493.3493.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3642 2256 1 1 1 797.9065 1593.7984 2 1593.7998 -0.0014 1 39.92 0.00054 R RESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3498.3498.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3746 2001 1 1 1 546.9529 1637.8368 3 1637.8372 -0.0004 1 62.3 4.00E-06 R RAHLSENELEALEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3214.3214.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3749 275 1 1 1 547.5675 1639.6807 3 1639.6823 -0.0016 1 43.39 4.80E-05 R YGATDRSQDDGGENR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1303.1303.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3816 2304 1 1 1 832.4048 1662.795 2 1662.7961 -0.0011 1 27.14 0.0056 K NSFQPISSLRDDER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3550.3550.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3951 3601 1 1 1 575.6175 1723.8306 3 1723.8318 -0.0012 0 46.12 0.00011 R GFAFVEFSHLQDATR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4930.4930.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3952 3604 1 1 1 862.9227 1723.8309 2 1723.8318 -0.0009 0 78.72 8.90E-08 R GFAFVEFSHLQDATR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4934.4934.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 3962 2635 1 1 1 864.4139 1726.8132 2 1726.8162 -0.003 0 86.88 7.10E-09 K YGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3917.3917.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 4077 2836 1 1 1 590.2974 1767.8704 3 1767.8726 -0.0022 0 23.35 0.0065 R WMEANQHSLNILGQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4133.4133.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 4123 2518 1 1 1 892.9338 1783.853 2 1783.8675 -0.0145 0 27.44 0.0027 R WMEANQHSLNILGQK V Oxidation (M) 0.010000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3788.3788.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 4124 2516 1 1 1 595.6289 1783.8649 3 1783.8675 -0.0026 0 21.52 0.012 R WMEANQHSLNILGQK V Oxidation (M) 0.010000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3786.3786.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 4327 2289 1 1 1 928.4622 1854.9098 2 1854.9112 -0.0014 1 111.97 3.20E-11 R KYGGISTASVDFEQPTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3535.3535.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 4562 1458 1 1 1 987.4745 1972.9345 2 1972.9378 -0.0032 1 58.35 3.40E-06 R GSSYGVTSTESYKETLHK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2612.2612.2.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 5151 2414 1 1 1 841.0898 2520.2477 3 2520.2503 -0.0026 1 42.28 0.0003 R MLPQAATEDDIRGQLQSHGVQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3673.3673.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 5155 3051 1 1 1 845.3862 2533.1367 3 2533.1391 -0.0024 0 91.92 1.90E-09 K GDPTGAGPEASLEPGADSVSMQAFSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4354.4354.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 5163 2259 1 1 1 846.4214 2536.2425 3 2536.2452 -0.0027 1 52.62 2.40E-05 R MLPQAATEDDIRGQLQSHGVQAR E Oxidation (M) 0.10000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3502.3502.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 5169 2570 1 1 1 850.7184 2549.1335 3 2549.134 -0.0005 0 61.85 1.10E-06 K GDPTGAGPEASLEPGADSVSMQAFSR A Oxidation (M) 0.00000000000000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3846.3846.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 5240 2767 1 1 1 933.7766 2798.308 3 2798.3107 -0.0027 1 73.71 1.70E-07 K YGGISTASVDFEQPTRDGLGSDNIGSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4062.4062.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 5297 2874 1 1 1 1082.5159 3244.5258 3 3244.5307 -0.0049 1 54.4 1.10E-05 K GPGITGTKGDPTGAGPEASLEPGADSVSMQAFSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4173.4173.3.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 5301 2489 1 1 1 816.1373 3260.52 4 3260.5256 -0.0056 1 57.3 5.00E-06 K GPGITGTKGDPTGAGPEASLEPGADSVSMQAFSR A Oxidation (M) 0.0000000000000000000000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3756.3756.4.dta 6 1 RBM10_HUMAN RNA-binding protein 10 OS=Homo sapiens GN=RBM10 PE=1 SV=3 2505 103811 104 104 51 51 5302 2472 1 1 1 1087.8479 3260.5219 3 3260.5256 -0.0037 1 76.29 6.60E-08 K GPGITGTKGDPTGAGPEASLEPGADSVSMQAFSR A Oxidation (M) 0.0000000000000000000000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3737.3737.3.dta 6 2 RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens GN=RBM6 PE=1 SV=5 70 129192 2 2 2 2 771 999 1 0 0 455.2484 908.4822 2 908.4828 -0.0006 0 43.51 0.00028 K QNLEIHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2102.2102.2.dta 6 2 RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens GN=RBM6 PE=1 SV=5 70 129192 2 2 2 2 3512 3500 1 0 1 778.9178 1555.8211 2 1555.8246 -0.0035 0 46.59 0.00016 K ILQNLDPPFSIDGK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4825.4825.2.dta 6 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 90 92610 6 6 4 4 138 436 1 0 1 338.1745 674.3345 2 674.3347 -0.0002 0 26.17 0.031 R EGSGLGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1476.1476.2.dta 6 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 90 92610 6 6 4 4 275 255 1 0 1 372.7219 743.4292 2 743.429 0.0003 1 40.76 0.0013 K KGALAER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1282.1282.2.dta 6 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 90 92610 6 6 4 4 2501 1467 1 0 1 430.8871 1289.6393 3 1289.6398 -0.0004 1 30.37 0.0014 K TAQQIAKDMER W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2622.2622.3.dta 6 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 90 92610 6 6 4 4 2609 454 1 0 1 653.8239 1305.6332 2 1305.6347 -0.0015 1 40.85 0.00058 K TAQQIAKDMER W Oxidation (M) 0.00000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1496.1496.2.dta 6 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 90 92610 6 6 4 4 2610 455 1 0 1 436.2187 1305.6342 3 1305.6347 -0.0004 1 25.17 0.0051 K TAQQIAKDMER W Oxidation (M) 0.00000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1497.1497.3.dta 6 RBM5_HUMAN RNA-binding protein 5 OS=Homo sapiens GN=RBM5 PE=1 SV=2 90 92610 6 6 4 4 2948 1894 1 0 1 692.3612 1382.7079 2 1382.7081 -0.0003 1 19.52 0.015 R EKYGIPEPPEPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3095.3095.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 131 2016 1 1 1 336.7184 671.4223 2 671.4218 0.0005 0 31.06 0.0038 R ILEIGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3230.3230.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 133 37 1 1 1 337.2088 672.403 2 672.4031 -0.0001 1 22.19 0.035 R QRITR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1042.1042.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 402 1413 1 1 1 400.7655 799.5165 2 799.5167 -0.0002 1 29.64 0.0038 R ILEIGKK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2562.2562.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 432 1405 1 1 1 406.7587 811.5028 2 811.5028 0 1 25.87 0.003 K RSLPALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2553.2553.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 497 1726 1 1 1 414.7688 827.5231 2 827.5229 0.0002 1 30.32 0.0051 R RILEIGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2908.2908.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 754 173 1 1 1 452.7402 903.4659 2 903.4661 -0.0003 0 53.87 4.70E-05 K ISETAQQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1193.1193.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 868 3861 1 1 1 468.2816 934.5486 2 934.5488 -0.0001 0 30.61 0.0019 K NFLSTLIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5202.5202.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 1099 2066 1 1 1 500.8055 999.5965 2 999.5965 0 0 25.37 0.015 R QVTPTTIIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3287.3287.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 1305 386 1 1 1 524.7667 1047.5189 2 1047.5196 -0.0007 0 58.43 1.40E-05 K QSTETAANVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1422.1422.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 1600 1505 1 1 1 559.3008 1116.5871 2 1116.5887 -0.0016 0 76.63 2.20E-07 K GAAGAVTQSLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2664.2664.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 1647 3188 1 1 1 564.8165 1127.6184 2 1127.6186 -0.0002 0 46.31 4.50E-05 K ELVQNLLDGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4497.4497.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2300 825 1 1 1 629.3119 1256.6092 2 1256.6109 -0.0017 1 53.01 1.10E-05 R SRQEDPEQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1908.1908.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2401 4349 1 1 1 641.8585 1281.7025 2 1281.7041 -0.0016 0 25.28 0.012 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5705.5705.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2402 3230 1 1 1 641.8588 1281.7031 2 1281.7041 -0.001 0 65.62 1.10E-06 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4542.4542.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2403 4805 1 1 1 641.8588 1281.7031 2 1281.7041 -0.001 0 49.57 4.50E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6318.6318.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2404 3356 1 1 1 641.8589 1281.7032 2 1281.7041 -0.0008 0 50.03 3.80E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4674.4674.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2405 4561 1 1 1 641.859 1281.7035 2 1281.7041 -0.0006 0 28.61 0.0052 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5954.5954.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2406 4636 1 1 1 641.8591 1281.7036 2 1281.7041 -0.0005 0 65.03 1.20E-06 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6054.6054.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2407 3722 1 1 1 641.8591 1281.7036 2 1281.7041 -0.0005 0 25.33 0.011 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5058.5058.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2408 4021 1 1 1 641.8592 1281.7038 2 1281.7041 -0.0002 0 26.78 0.008 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5366.5366.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2409 4464 1 1 1 641.8593 1281.704 2 1281.7041 -0.0001 0 68.43 5.50E-07 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5835.5835.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2410 4865 1 1 1 641.8593 1281.7041 2 1281.7041 0 0 47.21 7.20E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6409.6409.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2411 4757 1 1 1 641.8594 1281.7043 2 1281.7041 0.0003 0 56.88 7.80E-06 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6235.6235.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2412 4707 1 1 1 641.8595 1281.7044 2 1281.7041 0.0004 0 81.22 2.90E-08 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6152.6152.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2413 3874 1 1 1 641.8597 1281.7048 2 1281.7041 0.0007 0 26.43 0.0086 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5216.5216.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2473 1442 1 1 1 643.8557 1285.6968 2 1285.699 -0.0022 0 110.97 6.40E-11 K ALSAVSAQAAAAQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2594.2594.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2523 3363 1 1 1 648.8248 1295.6351 2 1295.6398 -0.0047 0 42.58 0.0002 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4680.4680.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2524 4647 1 1 1 648.8256 1295.6367 2 1295.6398 -0.0031 0 37.23 0.0012 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6069.6069.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2525 4824 1 1 1 648.8259 1295.6373 2 1295.6398 -0.0025 0 34.21 0.0023 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6349.6349.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2526 4573 1 1 1 648.8259 1295.6373 2 1295.6398 -0.0025 0 43.23 0.00014 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5969.5969.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2527 4474 1 1 1 648.826 1295.6374 2 1295.6398 -0.0023 0 44.57 0.0001 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5848.5848.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2528 4552 1 1 1 648.8264 1295.6383 2 1295.6398 -0.0015 0 35.48 0.0018 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5943.5943.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2529 3895 1 1 1 648.8266 1295.6386 2 1295.6398 -0.0011 0 32.13 0.00097 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5237.5237.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2530 4723 1 1 1 648.8268 1295.639 2 1295.6398 -0.0007 0 37.35 0.00078 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6177.6177.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2531 3599 1 1 1 648.827 1295.6394 2 1295.6398 -0.0004 0 23.94 0.01 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4929.4929.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2532 3750 1 1 1 648.827 1295.6394 2 1295.6398 -0.0004 0 32.12 0.0026 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5087.5087.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2533 4177 1 1 1 648.8271 1295.6396 2 1295.6398 -0.0001 0 44.06 0.00024 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5526.5526.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2534 4393 1 1 1 648.8271 1295.6397 2 1295.6398 0 0 34.07 0.0024 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5755.5755.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2535 3115 1 1 1 648.8273 1295.64 2 1295.6398 0.0002 0 67.94 9.90E-07 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4422.4422.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2536 4774 1 1 1 648.8275 1295.6404 2 1295.6398 0.0006 0 39.44 0.00062 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6264.6264.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2537 4303 1 1 1 648.8277 1295.6408 2 1295.6398 0.0011 0 44.25 0.00023 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5659.5659.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2538 4040 1 1 1 648.8277 1295.6408 2 1295.6398 0.0011 0 33.98 0.0021 K FFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5386.5386.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2622 3650 1 1 1 654.8156 1307.6166 2 1307.618 -0.0014 0 39.48 0.00049 R DLIFCLENER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4983.4983.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2775 1510 1 1 1 671.4025 1340.7904 2 1340.7928 -0.0024 0 48.79 4.70E-05 R RPLVPAGPAPPAAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2669.2669.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 2993 1868 1 1 1 696.323 1390.6314 2 1390.6333 -0.0018 0 63.54 2.10E-06 K EMQQQELAQMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3066.3066.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3124 3525 1 1 1 715.8851 1429.7557 2 1429.7565 -0.0008 0 33.91 0.00066 K DETFLLQAPLQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4852.4852.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3295 3944 1 1 1 744.4241 1486.8336 2 1486.8355 -0.0019 0 54.6 1.30E-05 R ILATNSELVGTLTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5287.5287.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3296 3049 1 1 1 744.4244 1486.8342 2 1486.8355 -0.0013 0 99.62 3.90E-10 R ILATNSELVGTLTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4352.4352.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3297 4786 1 1 1 744.4247 1486.8348 2 1486.8355 -0.0007 0 64.19 1.40E-06 R ILATNSELVGTLTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6283.6283.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3298 3062 1 1 1 496.6191 1486.8356 3 1486.8355 0.0001 0 37.27 0.00067 R ILATNSELVGTLTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4366.4366.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3299 3285 1 1 1 744.4252 1486.8359 2 1486.8355 0.0004 0 66.4 9.60E-07 R ILATNSELVGTLTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4599.4599.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3560 2714 1 1 1 783.9385 1565.8624 2 1565.8638 -0.0014 1 87.27 7.60E-09 R QRDANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4004.4004.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3561 2712 1 1 1 522.9616 1565.863 3 1565.8638 -0.0008 1 42.46 0.00023 R QRDANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4002.4002.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3597 2869 1 1 1 527.6069 1579.799 3 1579.7994 -0.0005 1 37.56 0.0013 K FFEQLDQIEKQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4167.4167.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3716 588 1 1 1 541.5919 1621.7537 3 1621.7552 -0.0014 1 29.05 0.0063 K AKEMQQQELAQMR Q 2 Oxidation (M) 0.0001000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1645.1645.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3970 2849 1 1 1 576.9874 1727.9405 3 1727.9417 -0.0013 1 54.51 1.60E-05 R LQNLVEKISETAQQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4146.4146.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3971 2855 1 1 1 864.9775 1727.9405 2 1727.9417 -0.0012 1 81.66 3.20E-08 R LQNLVEKISETAQQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4153.4153.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3985 4002 1 1 1 866.467 1730.9195 2 1730.9243 -0.0048 0 66.91 5.40E-07 R ELNSSPQPYLVPFLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5347.5347.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3986 4351 1 1 1 866.4684 1730.9222 2 1730.9243 -0.0021 0 40.24 0.00049 R ELNSSPQPYLVPFLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5707.5707.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3987 4019 1 1 1 577.9817 1730.9232 3 1730.9243 -0.0011 0 22.99 0.0085 R ELNSSPQPYLVPFLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5364.5364.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3988 4501 1 1 1 866.4711 1730.9277 2 1730.9243 0.0034 0 32.62 0.00087 R ELNSSPQPYLVPFLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5883.5883.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 3989 4154 1 1 1 866.4731 1730.9317 2 1730.9243 0.0074 0 22.31 0.031 R ELNSSPQPYLVPFLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5500.5500.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4008 3580 1 1 1 579.6451 1735.9136 3 1735.9145 -0.0009 1 21.22 0.016 R AQLKFFEQLDQIEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4909.4909.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4204 3014 1 1 1 903.4632 1804.9118 2 1804.9142 -0.0023 1 74.51 1.00E-07 R SCKDETFLLQAPLQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4316.4316.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4205 4202 1 1 1 602.645 1804.9132 3 1804.9142 -0.0009 1 15.04 0.039 R SCKDETFLLQAPLQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5553.5553.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4206 3011 1 1 1 602.6453 1804.914 3 1804.9142 -0.0002 1 51.18 3.70E-05 R SCKDETFLLQAPLQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4313.4313.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4207 3699 1 1 1 903.4687 1804.9229 2 1804.9142 0.0088 1 31.22 0.0012 R SCKDETFLLQAPLQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5034.5034.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4305 1503 1 1 1 921.9858 1841.957 2 1841.9595 -0.0025 0 93.5 2.00E-09 K QVSQAQTTVQPSATLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2662.2662.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4306 1513 1 1 1 614.9931 1841.9575 3 1841.9595 -0.0021 0 45.91 6.20E-05 K QVSQAQTTVQPSATLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2673.2673.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4393 3549 1 1 1 944.5197 1887.0249 2 1887.0254 -0.0005 1 57.14 6.80E-06 R ELNSSPQPYLVPFLKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4877.4877.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4635 2073 1 1 1 998.4802 1994.9458 2 1994.9467 -0.0009 0 104.83 1.80E-10 R TVPGATTTSSAATETMENVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3295.3295.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4871 1151 1 1 1 1070.5244 2139.0343 2 2139.0365 -0.0023 1 45.43 9.50E-05 R TVPGATTTSSAATETMENVKK C Oxidation (M) 0.000000000000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2270.2270.2.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 4917 3704 1 1 1 726.3739 2176.0999 3 2176.1012 -0.0013 1 57.44 4.10E-06 K ELVQNLLDGKIEAEDFTSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5039.5039.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 5179 3594 1 1 1 855.4797 2563.4174 3 2563.4222 -0.0048 0 34.08 0.00051 K TAATVTSALQPPVLSLTQPTQVGVGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4924.4924.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 5183 1960 1 1 1 861.0692 2580.1858 3 2580.1875 -0.0017 0 17.67 0.041 K VDCPGPGSGAEGSGPGSVVPGSSGVGTPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3168.3168.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 5211 1732 1 1 1 903.7673 2708.28 3 2708.2825 -0.0025 1 63.18 1.70E-06 R KVDCPGPGSGAEGSGPGSVVPGSSGVGTPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2915.2915.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 5274 3231 1 1 1 1021.5441 3061.6106 3 3061.6157 -0.0051 0 77.29 4.10E-08 R SPGVQPQLVLGGAAQTASLGTATAVQTGTPQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4543.4543.3.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 5275 3253 1 1 1 766.4102 3061.6115 4 3061.6157 -0.0041 0 63.46 9.90E-07 R SPGVQPQLVLGGAAQTASLGTATAVQTGTPQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4565.4565.4.dta 7 1 TAF4_HUMAN Transcription initiation factor TFIID subunit 4 OS=Homo sapiens GN=TAF4 PE=1 SV=2 2339 110332 79 79 37 37 5329 1935 1 1 1 899.7045 3594.789 4 3594.7927 -0.0037 0 41.38 0.00026 R AAAAGALGNHVVSGSPAGAAGAGPAAPAEGAPGAAPEPPPAGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3140.3140.4.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2401 4349 1 0 1 641.8585 1281.7025 2 1281.7041 -0.0016 0 25.28 0.012 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5705.5705.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2402 3230 1 0 1 641.8588 1281.7031 2 1281.7041 -0.001 0 65.62 1.10E-06 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4542.4542.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2403 4805 1 0 1 641.8588 1281.7031 2 1281.7041 -0.001 0 49.57 4.50E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6318.6318.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2404 3356 1 0 1 641.8589 1281.7032 2 1281.7041 -0.0008 0 50.03 3.80E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4674.4674.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2405 4561 1 0 1 641.859 1281.7035 2 1281.7041 -0.0006 0 28.61 0.0052 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5954.5954.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2406 4636 1 0 1 641.8591 1281.7036 2 1281.7041 -0.0005 0 65.03 1.20E-06 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6054.6054.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2407 3722 1 0 1 641.8591 1281.7036 2 1281.7041 -0.0005 0 25.33 0.011 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5058.5058.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2408 4021 1 0 1 641.8592 1281.7038 2 1281.7041 -0.0002 0 26.78 0.008 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5366.5366.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2409 4464 1 0 1 641.8593 1281.704 2 1281.7041 -0.0001 0 68.43 5.50E-07 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5835.5835.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2410 4865 1 0 1 641.8593 1281.7041 2 1281.7041 0 0 47.21 7.20E-05 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6409.6409.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2411 4757 1 0 1 641.8594 1281.7043 2 1281.7041 0.0003 0 56.88 7.80E-06 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6235.6235.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2412 4707 1 0 1 641.8595 1281.7044 2 1281.7041 0.0004 0 81.22 2.90E-08 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6152.6152.2.dta 7 TAF4B_HUMAN Transcription initiation factor TFIID subunit 4B OS=Homo sapiens GN=TAF4B PE=1 SV=2 399 91832 13 13 1 1 2413 3874 1 0 1 641.8597 1281.7048 2 1281.7041 0.0007 0 26.43 0.0086 R DANLTALAAIGPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5216.5216.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 11 1495 1 0 0 300.6945 599.3744 2 599.3755 -0.0011 0 29.46 0.013 R ALQLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2653.2653.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 53 19 1 1 0 315.7126 629.4106 2 629.4112 -0.0006 1 27.35 0.023 R IIEKK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1022.1022.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 373 2335 1 1 1 394.7242 787.4338 2 787.4341 -0.0003 0 35.87 0.00085 K APGLGAFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3585.3585.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 403 2846 1 1 1 401.2017 800.3889 2 800.3891 -0.0002 0 25.76 0.012 R CFFLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4143.4143.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 512 3005 1 1 1 416.768 831.5214 2 831.5218 -0.0004 0 27.97 0.0017 K VFLALAAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4306.4306.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 612 2904 1 1 1 429.2475 856.4804 2 856.4807 -0.0003 0 33.48 0.0046 R SPNLWLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4203.4203.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 630 695 1 1 1 432.2402 862.4659 2 862.4661 -0.0002 1 22.71 0.04 K NKEFVAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1764.1764.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 707 3342 1 1 1 447.759 893.5034 2 893.5044 -0.001 0 24.44 0.019 R LLNFLMK H Oxidation (M) 0.0000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4659.4659.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 829 1781 1 1 1 463.7343 925.454 2 925.4545 -0.0005 0 35.65 0.0011 K YFEGVSPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2969.2969.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 830 5322 1 1 1 309.498 925.472 3 925.473 -0.0009 1 25.03 0.019 R GSKDHNIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.967.967.3.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 831 5319 1 1 1 463.7435 925.4724 2 925.473 -0.0006 1 44.96 0.00019 R GSKDHNIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.964.964.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 840 3916 1 1 1 465.2963 928.578 2 928.5779 0.0001 0 18.5 0.045 K MAVLALLAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5259.5259.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 914 3333 1 1 1 473.2934 944.5722 2 944.5728 -0.0007 0 23.54 0.016 K MAVLALLAK I Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4649.4649.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 920 632 1 1 1 474.7407 947.4669 2 947.4672 -0.0003 0 45.56 0.00027 R TQEGSLSAR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1694.1694.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 938 3065 1 1 1 478.7923 955.57 2 955.5702 -0.0001 0 38.37 0.00036 R LLEEALLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4369.4369.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1008 144 1 1 1 490.2455 978.4765 2 978.4771 -0.0005 1 34.27 0.003 K FSGKDPNSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1160.1160.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1081 4045 1 1 1 498.3288 994.643 2 994.6426 0.0004 0 23.6 0.0044 K IPALDLLIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5390.5390.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1134 3870 1 1 1 505.2893 1008.564 2 1008.5644 -0.0004 0 32.17 0.0027 R EIFNFVLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5212.5212.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1135 957 1 1 1 505.7274 1009.4402 2 1009.44 0.0003 0 43.24 0.0001 K CFGTGAAGNR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2055.2055.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1185 3066 1 1 1 512.2806 1022.5466 2 1022.547 -0.0004 0 37.46 0.0013 K VCLDIIYK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4370.4370.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1322 2636 1 1 1 526.2742 1050.5339 2 1050.5346 -0.0006 0 50.76 6.10E-05 R SIGEYDVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3918.3918.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1325 2677 1 1 1 526.7845 1051.5545 2 1051.555 -0.0004 0 50.27 5.20E-05 R GIFTSEIGTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3964.3964.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1329 1908 1 1 1 351.8854 1052.6343 3 1052.6342 0.0001 0 20.22 0.0095 K AIRPQIDLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3110.3110.3.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1389 2829 1 1 1 535.2602 1068.5058 2 1068.5063 -0.0004 0 27.67 0.0091 R GYGLFAGPCK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4126.4126.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1394 3943 1 1 1 535.2905 1068.5665 2 1068.5678 -0.0013 0 23.66 0.033 K FLCIFLEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5286.5286.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1407 805 1 1 1 537.2498 1072.485 2 1072.4859 -0.001 0 35.26 0.00089 K NTCTSVYTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1886.1886.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1583 1011 1 1 1 558.311 1114.6075 2 1114.6094 -0.0019 1 22.21 0.018 K ALKLNSNEAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2115.2115.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1677 2327 1 1 1 568.3085 1134.6025 2 1134.6033 -0.0008 0 38.16 0.0012 R HGDLPDIQIK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3576.3576.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1738 4183 1 1 1 575.329 1148.6434 2 1148.6441 -0.0007 0 60.64 3.20E-06 K AALSALESFLK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5533.5533.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1879 2156 1 1 1 588.3167 1174.6189 2 1174.6194 -0.0005 0 95.52 3.10E-09 R VTELALTASDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3387.3387.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 1881 1436 1 1 1 588.7869 1175.5592 2 1175.5605 -0.0013 0 54.83 2.10E-05 R LACDVDQVTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2587.2587.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2044 3303 1 1 1 603.3712 1204.7279 2 1204.7292 -0.0013 0 28.59 0.0017 K LGNPIVPLNIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4619.4619.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2115 3392 1 1 1 609.8576 1217.7007 2 1217.7019 -0.0013 0 63.33 1.20E-06 R LLALNSLYSPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4713.4713.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2226 3845 1 1 1 620.3232 1238.6318 2 1238.6329 -0.0011 0 41.01 0.00062 K GLSSLLCNFTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5185.5185.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2336 1830 1 1 1 633.8397 1265.6648 2 1265.6663 -0.0015 0 52.81 3.00E-05 R CGAALAGHQLIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3024.3024.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2375 689 1 1 1 638.348 1274.6815 2 1274.683 -0.0015 1 43.88 0.00028 K TLSEKNNITQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1757.1757.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2512 2850 1 1 1 647.3432 1292.6718 2 1292.6725 -0.0006 0 54.83 2.00E-05 R DQNILLGTTYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4147.4147.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2569 2449 1 1 1 650.8641 1299.7137 2 1299.7146 -0.0009 0 70.82 5.90E-07 K QITQSALLAEAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3712.3712.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2687 2739 1 1 1 660.8173 1319.6201 2 1319.6214 -0.0013 0 44.68 0.0002 R QCLPSLDLSCK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4030.4030.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2697 3632 1 1 1 661.8423 1321.6701 2 1321.67 0.0001 0 49.41 7.40E-05 R MSTSPEAFLALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4964.4964.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2753 3397 1 1 1 669.8396 1337.6646 2 1337.6649 -0.0003 0 52.56 4.20E-05 R MSTSPEAFLALR S Oxidation (M) 0.100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4718.4718.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 2989 2417 1 1 1 695.8331 1389.6517 2 1389.6524 -0.0007 0 43.39 0.00022 R NELEIPGQYDGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3676.3676.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 3011 2235 1 1 1 698.8506 1395.6867 2 1395.6882 -0.0014 0 64.23 3.10E-06 K LNESTFDTQITK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3475.3475.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 3233 2231 1 1 1 730.3995 1458.7844 2 1458.7865 -0.0021 0 53.18 3.20E-05 R VVQMLGSLGGQINK N Oxidation (M) 0.00010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3470.3470.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 3254 1691 1 1 1 734.3572 1466.6999 2 1466.7001 -0.0002 0 70.71 3.30E-07 R SLGPPQGEEDSVPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2869.2869.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 3336 2519 1 1 1 748.9028 1495.791 2 1495.7929 -0.0019 0 70.88 4.10E-07 R NCISTVVHQGLIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3789.3789.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 3337 2514 1 1 1 499.6048 1495.7925 3 1495.7929 -0.0005 0 23.85 0.021 R NCISTVVHQGLIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3784.3784.3.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 3387 4306 1 1 1 759.397 1516.7794 2 1516.7807 -0.0013 0 74.79 2.80E-07 K NILEESLCELVAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5661.5661.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 3583 2958 1 0 1 787.9038 1573.7931 2 1573.7947 -0.0016 0 91.98 4.50E-09 K NLSSNEAISLEEIR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4258.4258.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 3741 4014 1 1 1 818.9145 1635.8145 2 1635.8178 -0.0033 0 52.5 4.50E-05 R SDPGLLTNTMDVFVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5359.5359.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 4078 3384 1 1 1 884.9508 1767.8871 2 1767.889 -0.002 0 99.52 7.10E-10 K TVSLLDENNVSSYLSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4704.4704.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 4237 3901 1 1 1 908.0139 1814.0132 2 1814.0149 -0.0018 0 72.74 1.40E-07 R TVGALQVLGTEAQSSLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5243.5243.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 4454 1742 1 1 1 639.9721 1916.8945 3 1916.8977 -0.0032 0 41.31 0.00037 R ATQQQHDFTLTQTADGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2926.2926.3.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 4455 1752 1 1 1 959.4551 1916.8956 2 1916.8977 -0.0021 0 70.25 4.50E-07 R ATQQQHDFTLTQTADGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2937.2937.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 4753 2211 1 1 1 1023.9991 2045.9837 2 2045.984 -0.0003 0 70.64 2.40E-07 K INQVFHGSCITEGNELTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3448.3448.2.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 4809 3758 1 1 1 695.6848 2084.0324 3 2084.0361 -0.0037 0 24.28 0.0053 R ELLNPVVEFVSHPSTTCR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5096.5096.3.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 4847 2638 1 1 1 703.3461 2107.0164 3 2107.0181 -0.0018 1 33.32 0.00075 K TSALSDETKNNWEVSALSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3920.3920.3.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 4858 3295 1 1 1 707.7037 2120.0892 3 2120.0936 -0.0044 0 38.62 0.00078 K LAGANPAVITCDELLLGHEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4610.4610.3.dta 8 1 PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1585 473749 59 59 54 54 4911 3387 1 1 1 1087.0359 2172.0572 2 2172.062 -0.0047 0 98.32 7.50E-10 R IIANALSSEPACLAEIEEDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4707.4707.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 38 1237 1 1 1 311.1712 620.3279 2 620.3282 -0.0003 0 24.46 0.033 R VAFER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2366.2366.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 114 928 2 1 1 331.7084 661.4023 2 661.4024 -0.0001 1 20.47 0.035 R RIFAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2023.2023.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 189 698 1 1 1 348.2133 694.412 2 694.4126 -0.0006 0 30.76 0.0019 R NALIHK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1767.1767.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 246 1571 1 1 1 362.7211 723.4276 2 723.4279 -0.0003 0 26.86 0.0032 K LPIEPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2735.2735.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 301 1176 1 1 1 379.719 757.4235 2 757.4235 0 0 33.25 0.004 R LGYIHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2298.2298.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 365 894 1 1 1 393.7454 785.4762 2 785.4759 0.0003 1 27.46 0.019 R KLEAGIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1985.1985.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 378 945 1 1 1 395.2269 788.4393 2 788.4392 0.0001 0 35.64 0.0027 K ILTTEGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2042.2042.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 420 1029 1 1 1 405.2041 808.3937 2 808.3935 0.0002 0 24.37 0.027 R MLNMIR Q 2 Oxidation (M) 0.100100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2135.2135.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 494 845 1 1 1 414.6874 827.3603 2 827.3596 0.0007 0 29.3 0.0025 K SCGYSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1930.1930.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 676 5333 1 1 1 438.7109 875.4073 2 875.4072 0.0001 1 25.7 0.014 R FCEHKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.982.982.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 806 712 1 1 1 459.2744 916.5342 2 916.5342 0 1 25.63 0.013 R KILTTEGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1783.1783.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 846 1524 1 1 1 466.2637 930.5128 2 930.5134 -0.0006 0 60.45 9.60E-06 R ISAVSVAER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2684.2684.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 885 1694 1 1 1 470.7477 939.4808 2 939.4814 -0.0006 0 44.13 0.00028 R LNQYFQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2873.2873.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1041 559 1 1 1 493.7562 985.4978 2 985.4981 -0.0003 0 37.2 0.001 R YGDGPRPPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1613.1613.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1114 3296 1 1 1 502.3002 1002.5858 2 1002.5862 -0.0004 0 60.08 3.30E-06 R LGGIGQFLAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4612.4612.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1195 4061 1 1 1 513.2736 1024.5326 2 1024.5342 -0.0016 0 31.13 0.0061 R DFVNYLVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5407.5407.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1196 4522 1 1 1 513.2738 1024.5331 2 1024.5342 -0.0011 0 26.37 0.018 R DFVNYLVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5906.5906.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1197 3469 1 1 1 513.2744 1024.5342 2 1024.5342 0 0 46.89 0.00015 R DFVNYLVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4794.4794.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1198 4737 1 1 1 513.2745 1024.5345 2 1024.5342 0.0003 0 22.36 0.042 R DFVNYLVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6200.6200.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1421 1605 1 1 1 538.28 1074.5455 2 1074.5458 -0.0003 0 36.69 0.0012 K LAQFEPSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2773.2773.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1422 1659 1 1 1 538.2812 1074.5479 2 1074.5458 0.0022 0 25.37 0.03 K LAQFEPSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2834.2834.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1463 1233 1 1 1 544.3146 1086.6146 2 1086.6145 0.0001 1 55.15 1.70E-05 R RISAVSVAER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2362.2362.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1464 1241 1 1 1 363.2122 1086.6148 3 1086.6145 0.0003 1 19.18 0.031 R RISAVSVAER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2370.2370.3.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1773 2750 1 1 1 579.3319 1156.6493 2 1156.6492 0 0 47.82 3.90E-05 K VFDPVPVGVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4043.4043.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1776 3463 1 1 1 579.7733 1157.532 2 1157.5328 -0.0008 0 26.81 0.01 K NFLYAWCGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4787.4787.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1877 1983 1 1 1 588.3055 1174.5965 2 1174.5982 -0.0017 0 44.8 0.00028 R DVVQAYPEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3194.3194.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1920 481 1 1 1 593.7828 1185.551 2 1185.5527 -0.0017 0 35.24 0.0012 K YTQVGPDHNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1526.1526.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1921 488 1 1 1 396.1914 1185.5524 3 1185.5527 -0.0003 0 21.51 0.032 K YTQVGPDHNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1534.1534.3.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1922 1514 1 1 1 593.7956 1185.5766 2 1185.5778 -0.0012 1 62.67 3.50E-06 R GANLKDYYSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2674.2674.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 1923 1516 1 1 1 396.1999 1185.5778 3 1185.5778 0 1 26.36 0.017 R GANLKDYYSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2676.2676.3.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 2110 1072 1 1 1 609.8087 1217.6029 2 1217.604 -0.0012 1 29.49 0.0083 R VAFERGEEPGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2183.2183.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 2132 2732 1 1 1 407.9113 1220.7122 3 1220.7128 -0.0006 0 46.79 3.00E-05 R TPLHEIALSIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4023.4023.3.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 2133 2729 1 1 1 611.3634 1220.7123 2 1220.7128 -0.0006 0 57.56 2.50E-06 R TPLHEIALSIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4019.4019.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 2320 3414 1 1 1 630.8468 1259.6791 2 1259.6795 -0.0004 0 73.88 4.00E-07 R AAMEALVVEVTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4735.4735.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 2468 2306 1 1 1 643.3793 1284.744 2 1284.7442 -0.0002 1 48.88 4.10E-05 R KVFDPVPVGVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3553.3553.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 2491 2713 1 1 1 644.8557 1287.6968 2 1287.6969 -0.0001 0 56.98 1.40E-05 K LAAQSCALSLVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4003.4003.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 2670 4164 1 1 1 659.3288 1316.643 2 1316.6441 -0.0011 0 49.64 6.90E-05 K YPSPFFVFGEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5512.5512.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 2856 1643 1 1 1 679.3481 1356.6816 2 1356.682 -0.0004 0 64.8 2.60E-06 R AAECNIVVTQPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2816.2816.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 3083 2376 1 1 1 708.9022 1415.7899 2 1415.7918 -0.0019 1 51.38 3.70E-05 K KLAAQSCALSLVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3630.3630.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 3356 2144 1 1 1 501.9348 1502.7827 3 1502.7841 -0.0014 0 54.9 7.10E-06 R GISHVIVDEIHER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3374.3374.3.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 3591 3043 1 1 1 790.4242 1578.8338 2 1578.8365 -0.0027 0 69.42 3.10E-07 K QPAIISQLDPVNER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4346.4346.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 3920 3931 1 1 1 857.9534 1713.8923 2 1713.8938 -0.0015 0 77.83 1.20E-07 K VQSDGQIVLVDDWIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5274.5274.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 4021 3280 1 1 1 871.4322 1740.8498 2 1740.853 -0.0032 0 89.5 6.10E-09 R ELDALDANDELTPLGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4594.4594.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 4431 1249 1 1 1 635.6448 1903.9125 3 1903.9177 -0.0052 1 21.65 0.0093 K IQGEYKYTQVGPDHNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2379.2379.3.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 4553 3896 1 1 1 986.0295 1970.0445 2 1970.0473 -0.0027 0 56.24 1.10E-05 K AIEPPPLDAVIEAEHTLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5238.5238.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 4756 4280 1 1 1 1025.5142 2049.0138 2 2049.0167 -0.003 0 77.07 1.20E-07 K TTQVPQFILDDFIQNDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5635.5635.2.dta 9 1 DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 1142 142181 47 47 39 39 4904 2640 1 1 1 1081.989 2161.9635 2 2161.9665 -0.003 0 72.78 1.30E-07 K AENNSEVGASGYGVPGPTWDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3923.3923.2.dta 9 IL21R_HUMAN Interleukin-21 receptor OS=Homo sapiens GN=IL21R PE=1 SV=1 26 59947 1 1 1 1 806 712 1 0 1 459.2744 916.5342 2 916.5342 0 1 25.63 0.013 R KLISVDSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1783.1783.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 235 124 1 1 1 360.6765 719.3385 2 719.3384 0.0001 0 26.34 0.024 K ICASNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1137.1137.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 357 1871 1 1 1 392.2237 782.4328 2 782.4327 0.0001 1 28.61 0.0076 R VKDFFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3069.3069.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 504 2818 1 1 1 415.7527 829.4909 2 829.4909 0 0 24.94 0.023 K DILTQLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4114.4114.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 514 3064 1 1 1 417.2132 832.4118 2 832.412 -0.0002 0 23.49 0.032 K FSGFTFK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4368.4368.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 576 515 1 1 1 423.7252 845.4358 2 845.4355 0.0003 0 40.98 0.00081 K SAQNLASR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1564.1564.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 581 2222 1 1 1 425.2451 848.4757 2 848.4756 0.0001 0 46.11 0.00014 K IQSGIFGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3460.3460.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 838 1302 1 1 1 465.2685 928.5224 2 928.5229 -0.0005 0 25.67 0.012 K DLLSKPEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2438.2438.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 969 2252 1 1 1 481.7815 961.5485 2 961.5484 0.0001 0 31.2 0.0026 K LLYVTPEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3494.3494.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1145 2346 1 1 1 337.8705 1010.5896 3 1010.5913 -0.0017 0 22.42 0.021 R FVIHASLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3597.3597.3.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1146 2343 1 1 1 506.3026 1010.5907 2 1010.5913 -0.0006 0 25.05 0.0097 R FVIHASLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3594.3594.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1220 1981 1 1 1 515.3005 1028.5864 2 1028.5866 -0.0002 0 30.05 0.0068 R SLIVDQVQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3192.3192.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1222 1980 1 1 1 515.301 1028.5874 2 1028.5866 0.0008 0 28.58 0.0063 R SLIVDQVQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3190.3190.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1370 1373 1 1 1 533.2818 1064.549 2 1064.5502 -0.0012 0 61.1 5.40E-06 K SSTAAYQPIK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2517.2517.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1691 1451 1 1 1 569.8082 1137.6018 2 1137.603 -0.0012 0 50.46 4.50E-05 K AQLYTTNTVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2604.2604.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1759 1468 1 1 1 578.2908 1154.567 2 1154.568 -0.001 0 26.92 0.006 K HTASINDLER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2623.2623.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1918 2232 1 1 1 593.3632 1184.7118 2 1184.7129 -0.0011 1 48.53 2.70E-05 R VQKDILTQLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3472.3472.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1919 2234 1 1 1 395.9115 1184.7128 3 1184.7129 -0.0001 1 32.14 0.0013 R VQKDILTQLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3474.3474.3.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1955 2325 1 1 1 596.3112 1190.6078 2 1190.6084 -0.0006 0 35.46 0.0029 R FQSLSFPHTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3574.3574.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 1956 2321 1 1 1 397.8766 1190.608 3 1190.6084 -0.0004 0 27.99 0.016 R FQSLSFPHTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3569.3569.3.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 2051 2932 1 1 1 603.8395 1205.6645 2 1205.6656 -0.001 0 68.67 5.20E-07 K YGAEVISVLQK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4232.4232.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 2058 2269 1 1 1 604.7859 1207.5573 2 1207.5577 -0.0003 0 48.34 9.60E-05 K CLGELTEVCK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3513.3513.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 2258 2566 1 1 1 623.8352 1245.6559 2 1245.6565 -0.0006 1 56.36 2.00E-05 R DVTDDVKSIVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3842.3842.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 2309 3942 1 1 1 629.855 1257.6954 2 1257.6969 -0.0015 0 29.39 0.0084 K SLLPDFLQTPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5285.5285.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 2351 2161 1 1 1 635.8654 1269.7163 2 1269.718 -0.0017 1 38.71 0.00067 K LIDTIPDDKLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3393.3393.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 2368 1431 1 1 1 637.7851 1273.5556 2 1273.5575 -0.0018 0 54.89 8.60E-06 K SVEGYYQESGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2582.2582.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 2623 3951 1 1 1 654.8237 1307.6328 2 1307.6332 -0.0005 0 44.71 0.00024 K VAFDCLEWIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5294.5294.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 2758 1771 1 1 1 670.2839 1338.5533 2 1338.5544 -0.0011 0 49.46 1.70E-05 R ECDTMADTLQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2958.2958.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 2936 4480 1 1 1 690.8309 1379.6472 2 1379.647 0.0002 0 32.96 0.0029 K SFVSSNWAETPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5854.5854.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 3002 659 1 1 1 464.8821 1391.6243 3 1391.6252 -0.0009 0 20.83 0.024 R FVQEHSSSQGMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1724.1724.3.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 3225 2611 1 1 1 729.871 1457.7275 2 1457.7296 -0.0021 0 58.03 1.30E-05 K LLDCGNELLQQR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3892.3892.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 3271 1225 1 1 1 738.8712 1475.7279 2 1475.729 -0.0011 0 53.75 3.40E-05 K EVVCTTQNTPTVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2353.2353.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 3599 3149 1 1 1 791.9008 1581.7871 2 1581.7886 -0.0015 0 85.76 1.70E-08 K TDSEATNIYLQLSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4457.4457.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 3669 890 1 1 1 802.9183 1603.822 2 1603.824 -0.002 1 59.55 7.10E-06 K EVVCTTQNTPTVKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1980.1980.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 3677 3537 1 1 1 804.4293 1606.844 2 1606.8454 -0.0014 0 59.22 2.80E-06 K LTSLDIPATYLTGDK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4865.4865.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 3713 1621 1 1 1 811.4043 1620.794 2 1620.7955 -0.0015 0 79.74 4.40E-08 K TSSDNNVSVTNVSVAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2792.2792.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 3861 3016 1 1 1 844.4225 1686.8305 2 1686.8325 -0.002 0 72.21 4.50E-07 R DGLAALAYHAGLSDSAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4318.4318.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 3862 3027 1 1 1 563.2845 1686.8316 3 1686.8325 -0.0009 0 36.34 0.0019 R DGLAALAYHAGLSDSAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4329.4329.3.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 4889 993 1 1 1 1076.5072 2150.9999 2 2151.004 -0.0041 0 126.3 1.20E-12 K SSSIIGSSSASHTSQATSGANSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2095.2095.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 4890 990 1 1 1 718.0079 2151.002 3 2151.004 -0.002 0 53.36 2.30E-05 K SSSIIGSSSASHTSQATSGANSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2092.2092.3.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 5028 2760 1 1 1 1122.0081 2242.0016 2 2242.0026 -0.001 0 72.06 2.00E-07 K YSEWTSPAEDSSPGISLSSSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4054.4054.2.dta 10 1 BLM_HUMAN Bloom syndrome protein OS=Homo sapiens GN=BLM PE=1 SV=1 1096 160611 41 41 35 35 5117 2744 1 1 1 805.7328 2414.1767 3 2414.1826 -0.0059 1 44.3 0.00018 R DGLAALAYHAGLSDSARDEVQQK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4036.4036.3.dta 10 RECQ1_HUMAN ATP-dependent DNA helicase Q1 OS=Homo sapiens GN=RECQL PE=1 SV=3 31 74436 1 1 1 1 969 2252 1 0 1 481.7815 961.5485 2 961.5484 0.0001 0 31.2 0.0026 K LIYVTPEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3494.3494.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 77 167 1 1 1 323.218 644.4215 2 644.4221 -0.0006 1 28.47 0.0058 K VGTLKK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1186.1186.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 87 1108 1 1 1 326.1765 650.3385 2 650.3387 -0.0002 0 29.26 0.011 K YAELR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2223.2223.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 289 677 1 1 1 377.2106 752.4066 2 752.4068 -0.0002 1 37.19 0.00058 K KYDLSK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1744.1744.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 298 1227 1 1 1 378.7343 755.4541 2 755.4541 0 0 37.92 0.00028 R GPAVLATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2355.2355.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 527 1811 1 1 1 419.7244 837.4342 2 837.4345 -0.0002 0 45.23 0.00017 R STGASFIR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3003.3003.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 585 1755 1 1 1 425.7502 849.4859 2 849.4861 -0.0002 0 26.59 0.0038 K VFFRPGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2940.2940.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 633 873 1 1 1 432.7451 863.4757 2 863.4752 0.0005 1 30.43 0.0058 R KSPEYLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1962.1962.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 775 1281 1 1 1 455.7476 909.4806 2 909.4807 -0.0001 0 23.22 0.031 K IYSSEAIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2415.2415.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 979 2806 1 1 1 482.7766 963.5387 2 963.5389 -0.0003 0 52.02 2.50E-05 K LSFISVGNK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4102.4102.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1075 1087 1 1 1 497.7653 993.516 2 993.5165 -0.0005 0 23.66 0.014 R VMLTTAGGTK G Oxidation (M) 0.0100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2199.2199.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1342 3158 1 1 1 529.3157 1056.6168 2 1056.6179 -0.0011 0 49.59 5.50E-05 K TQLNLLLDK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4466.4466.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1441 2458 1 1 1 541.2744 1080.5342 2 1080.5352 -0.0011 0 34.48 0.0012 K LQQFFNER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3722.3722.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1481 1279 1 1 1 546.2609 1090.5072 2 1090.5077 -0.0005 0 51.93 3.80E-05 R LCAGASEDIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2413.2413.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1579 653 1 1 1 558.2714 1114.5282 2 1114.5295 -0.0013 1 29.42 0.0057 R YFANKETDK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1717.1717.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1601 517 1 1 1 559.7844 1117.5542 2 1117.555 -0.0008 1 54.74 3.10E-05 R ICVQGKEER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1566.1566.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1681 3032 1 1 1 568.772 1135.5295 2 1135.5298 -0.0003 0 46.65 0.00013 R QFEEIWER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4334.4334.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1682 2036 1 1 1 568.7825 1135.5504 2 1135.5509 -0.0005 0 51.51 1.50E-05 K ALGLNENDYK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3254.3254.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1790 2442 1 1 1 581.7975 1161.5805 2 1161.5818 -0.0013 0 43.03 0.00051 K FVEIHFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3704.3704.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 1916 2002 1 1 1 593.3042 1184.5938 2 1184.5938 0 0 25.59 0.021 K LHLSSPDNFR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3215.3215.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2032 2962 1 1 1 602.8238 1203.633 2 1203.6346 -0.0016 0 50.23 8.30E-05 K SSEELLSALQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4262.4262.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2116 3260 1 1 1 610.3283 1218.6421 2 1218.6431 -0.001 0 33.89 0.0033 K VQWCSLSVIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4573.4573.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2172 1990 1 1 1 614.3382 1226.6618 2 1226.6619 0 0 61.64 5.00E-06 R IQAEVEAQLAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3202.3202.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2251 1050 1 1 1 622.8326 1243.6506 2 1243.652 -0.0014 1 31.38 0.0057 K ETDKQILQNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2158.2158.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2732 2579 1 1 1 666.8712 1331.7279 2 1331.7296 -0.0017 1 34.83 0.00054 K SSEELLSALQKK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3856.3856.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2756 1061 1 1 1 669.8773 1337.74 2 1337.7415 -0.0016 1 47.51 6.80E-05 K VPLKVEQANNAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2170.2170.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2808 2586 1 1 1 674.3539 1346.6933 2 1346.6942 -0.0009 1 35.4 0.0027 R NIRDDEGFIIR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3864.3864.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2809 2601 1 1 1 449.9052 1346.6936 3 1346.6942 -0.0006 1 27.93 0.015 R NIRDDEGFIIR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3880.3880.3.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2812 1002 1 1 1 674.8287 1347.6429 2 1347.6452 -0.0023 1 46.65 0.00017 R LCAGASEDIREK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2105.2105.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2813 1000 1 1 1 450.2218 1347.6435 3 1347.6452 -0.0017 1 27.54 0.0058 R LCAGASEDIREK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2103.2103.3.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 2882 3251 1 1 1 682.3597 1362.7048 2 1362.7064 -0.0016 0 52.33 2.70E-05 K NLEISIDTLMAK I Oxidation (M) 0.000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4563.4563.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 3091 1638 1 1 1 710.8876 1419.7607 2 1419.7609 -0.0002 1 69.6 7.20E-07 R ILKEEQELYQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2810.2810.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 3343 4437 1 1 1 749.9097 1497.8048 2 1497.8038 0.0009 0 65.31 7.50E-07 K LVGILDILDEENR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5804.5804.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 3531 3451 1 1 1 521.6064 1561.7973 3 1561.7988 -0.0014 1 27.24 0.013 K IGLDDEEKLDLFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4774.4774.3.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 3605 4011 1 1 1 793.4312 1584.8479 2 1584.8511 -0.0032 0 83.96 2.30E-08 R IVEANPLLEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5356.5356.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 3606 4039 1 1 1 529.2909 1584.8509 3 1584.8511 -0.0003 0 38.9 0.00022 R IVEANPLLEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5385.5385.3.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 3682 3305 1 1 1 804.8921 1607.7696 2 1607.7726 -0.0029 0 76.82 1.70E-07 R CGGIQYLQNAIESR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4620.4620.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 3856 2888 1 1 1 561.6291 1681.8654 3 1681.8675 -0.0021 1 18.83 0.021 K ALGLNENDYKFGLTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4187.4187.3.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 3990 2003 1 1 1 866.8865 1731.7584 2 1731.7588 -0.0004 0 98.52 3.30E-10 R YLTESYGTGQDIDDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3216.3216.2.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 4874 3694 1 1 1 715.0339 2142.08 3 2142.0804 -0.0004 0 55.84 5.80E-06 R IAQSEAELISDEAQADLALR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5029.5029.3.dta 11 1 MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 1033 150965 40 40 36 36 4875 3693 1 1 1 1072.0474 2142.0802 2 2142.0804 -0.0002 0 77.45 8.60E-08 R IAQSEAELISDEAQADLALR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5028.5028.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 303 442 4 1 1 379.7295 757.4444 2 757.4446 -0.0002 1 25.1 0.039 R RVDQLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1483.1483.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 995 2173 1 1 0 487.2692 972.5238 2 972.524 -0.0002 0 43.53 0.00042 K IEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3406.3406.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 1234 1613 1 1 1 517.2615 1032.5084 2 1032.5087 -0.0003 0 44.36 8.40E-05 R TLLEGEESR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2782.2782.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 1369 1207 1 1 1 533.2644 1064.5143 2 1064.5138 0.0004 0 38.91 0.00082 K AQYEDIAQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2333.2333.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 1378 660 1 1 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 1486 313 1 1 1 546.7544 1091.4942 2 1091.4956 -0.0014 0 94.54 1.70E-09 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1344.1344.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 1631 1334 1 1 1 563.2743 1124.534 2 1124.5349 -0.0009 0 57.26 5.20E-06 K AEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2474.2474.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 2332 2422 1 1 1 633.3215 1264.6284 2 1264.6299 -0.0015 0 64.54 2.50E-06 R TNAENEFVTIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3682.3682.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 2577 1842 1 1 1 651.8538 1301.6931 2 1301.6939 -0.0008 1 53.48 3.90E-05 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3037.3037.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 2578 4409 1 1 1 651.8609 1301.7073 2 1301.7078 -0.0006 0 31.38 0.0017 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5772.5772.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 2579 4145 1 1 1 651.861 1301.7074 2 1301.7078 -0.0005 0 95.59 1.80E-09 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5492.5492.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 2766 1098 1 1 1 670.838 1339.6615 2 1339.6619 -0.0004 1 59.87 6.40E-06 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2212.2212.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 2947 3402 1 1 1 692.3482 1382.6819 2 1382.683 -0.0012 0 69.67 9.50E-07 K SLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4723.4723.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 3007 1821 1 1 1 697.3688 1392.7231 2 1392.7249 -0.0018 1 75.2 2.00E-07 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3014.3014.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 3008 1819 1 1 1 465.2489 1392.7249 3 1392.7249 0 1 40.07 0.00073 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3012.3012.3.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 3269 2070 1 1 0 738.3958 1474.7771 2 1474.778 -0.0009 0 74.83 2.90E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3292.3292.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 3926 2463 1 1 1 858.9278 1715.841 2 1715.8438 -0.0028 0 92.84 3.50E-09 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3727.3727.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 4071 2210 1 1 1 883.3698 1764.7251 2 1764.7275 -0.0024 0 143.26 4.70E-15 R FSSCGGGGGSFGAGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3447.3447.2.dta 12 1 K2C1_HUMAN "Keratin, type II cytoskeletal 1 OS=Homo sapiens GN=KRT1 PE=1 SV=6" 960 66170 19 19 17 17 5109 1021 1 1 1 1192.4789 2382.9432 2 2382.9447 -0.0014 0 183.37 4.60E-19 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2126.2126.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 506 2018 1 0 1 416.251 830.4875 2 830.4862 0.0013 0 25.99 0.019 R SLVGLGGTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3233.3233.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 995 2173 1 0 0 487.2692 972.5238 2 972.524 -0.0002 0 43.53 0.00042 K IEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3406.3406.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 1076 1044 1 0 1 497.7874 993.5603 2 993.5607 -0.0004 0 38.64 0.00055 R LQGEIAHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2152.2152.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 1077 1052 1 0 1 332.1941 993.5605 3 993.5607 -0.0002 0 19.19 0.048 R LQGEIAHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2160.2160.3.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 1250 2258 1 0 1 519.2673 1036.5201 2 1036.5189 0.0012 0 60.62 7.00E-06 R YLDGLTAER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3500.3500.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 1378 660 1 0 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 1544 1348 1 0 0 554.2747 1106.5349 2 1106.5356 -0.0007 0 38.52 0.0012 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2489.2489.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 1658 1837 1 0 1 566.2585 1130.5024 2 1130.5026 -0.0002 0 36.05 0.00068 R STSSFSCLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3032.3032.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 1981 726 1 0 1 599.2778 1196.541 2 1196.5422 -0.0012 0 83.87 1.90E-08 K GGSISGGGYGSGGGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1798.1798.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 2283 1434 1 0 1 627.8066 1253.5986 2 1253.6001 -0.0014 0 96.98 1.40E-09 R GFSSGSAVVSGGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2585.2585.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 2685 1541 1 0 1 660.7945 1319.5744 2 1319.5756 -0.0012 0 80.11 2.10E-08 R HGGGGGGFGGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2703.2703.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 2722 4135 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 72.34 4.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5482.5482.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 2746 1897 1 0 1 668.8586 1335.7026 2 1335.7034 -0.0008 1 69.37 7.20E-07 R TAAENDFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3098.3098.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 3269 2070 1 0 0 738.3958 1474.7771 2 1474.778 -0.0009 0 74.83 2.90E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3292.3292.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 4018 671 1 0 1 870.8551 1739.6957 2 1739.6983 -0.0027 0 107.29 1.90E-11 R GSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1737.1737.2.dta 12 2 K22E_HUMAN "Keratin, type II cytoskeletal 2 epidermal OS=Homo sapiens GN=KRT2 PE=1 SV=2" 731 65678 18 18 16 16 4020 813 1 0 1 871.3771 1740.7396 2 1740.7412 -0.0016 0 129.52 1.70E-13 R GGSGGGGSISGGGYGSGGGSGGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1895.1895.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 1158 2022 1 0 1 508.7718 1015.5291 2 1015.5298 -0.0007 0 41.49 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3237.3237.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 1378 660 1 0 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 1544 1348 1 0 0 554.2747 1106.5349 2 1106.5356 -0.0007 0 38.52 0.0012 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2489.2489.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 2722 4135 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 72.34 4.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5482.5482.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 2831 1951 1 0 1 675.8663 1349.7181 2 1349.7191 -0.0009 1 44.14 0.00023 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3158.3158.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 3051 3786 1 0 1 704.3582 1406.7019 2 1406.7041 -0.0023 0 64.98 2.60E-06 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5124.5124.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 3099 1741 1 0 1 712.8188 1423.623 2 1423.6263 -0.0033 0 60.45 2.50E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2925.2925.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 3199 2102 1 0 1 724.3914 1446.7682 2 1446.7678 0.0003 0 50.27 2.00E-05 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3327.3327.2.dta 12 3 K2C6A_HUMAN "Keratin, type II cytoskeletal 6A OS=Homo sapiens GN=KRT6A PE=1 SV=3" 340 60293 11 11 10 10 3650 2212 1 0 1 799.883 1597.7514 2 1597.7519 -0.0004 0 83.51 1.50E-08 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3449.3449.2.dta 12 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 287 60315 9 9 8 8 1378 660 1 0 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 287 60315 9 9 8 8 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 287 60315 9 9 8 8 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 287 60315 9 9 8 8 1544 1348 1 0 0 554.2747 1106.5349 2 1106.5356 -0.0007 0 38.52 0.0012 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2489.2489.2.dta 12 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 287 60315 9 9 8 8 2722 4135 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 72.34 4.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5482.5482.2.dta 12 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 287 60315 9 9 8 8 2831 1951 1 0 1 675.8663 1349.7181 2 1349.7191 -0.0009 1 44.14 0.00023 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3158.3158.2.dta 12 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 287 60315 9 9 8 8 3051 3786 1 0 1 704.3582 1406.7019 2 1406.7041 -0.0023 0 64.98 2.60E-06 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5124.5124.2.dta 12 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 287 60315 9 9 8 8 3099 1741 1 0 1 712.8188 1423.623 2 1423.6263 -0.0033 0 60.45 2.50E-06 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2925.2925.2.dta 12 K2C6B_HUMAN "Keratin, type II cytoskeletal 6B OS=Homo sapiens GN=KRT6B PE=1 SV=5" 287 60315 9 9 8 8 3650 2212 1 0 1 799.883 1597.7514 2 1597.7519 -0.0004 0 83.51 1.50E-08 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3449.3449.2.dta 12 K2C5_HUMAN "Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3" 114 62568 5 5 4 4 1158 2022 1 0 1 508.7718 1015.5291 2 1015.5298 -0.0007 0 41.49 0.00066 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3237.3237.2.dta 12 K2C5_HUMAN "Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3" 114 62568 5 5 4 4 1378 660 1 0 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 K2C5_HUMAN "Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3" 114 62568 5 5 4 4 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 K2C5_HUMAN "Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3" 114 62568 5 5 4 4 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 K2C5_HUMAN "Keratin, type II cytoskeletal 5 OS=Homo sapiens GN=KRT5 PE=1 SV=3" 114 62568 5 5 4 4 2722 4135 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 72.34 4.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5482.5482.2.dta 12 K2C1B_HUMAN "Keratin, type II cytoskeletal 1b OS=Homo sapiens GN=KRT77 PE=2 SV=3" 96 62149 4 4 3 3 1378 660 1 0 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 K2C1B_HUMAN "Keratin, type II cytoskeletal 1b OS=Homo sapiens GN=KRT77 PE=2 SV=3" 96 62149 4 4 3 3 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 K2C1B_HUMAN "Keratin, type II cytoskeletal 1b OS=Homo sapiens GN=KRT77 PE=2 SV=3" 96 62149 4 4 3 3 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 K2C1B_HUMAN "Keratin, type II cytoskeletal 1b OS=Homo sapiens GN=KRT77 PE=2 SV=3" 96 62149 4 4 3 3 3269 2070 1 0 0 738.3958 1474.7771 2 1474.778 -0.0009 0 74.83 2.90E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3292.3292.2.dta 12 K2C75_HUMAN "Keratin, type II cytoskeletal 75 OS=Homo sapiens GN=KRT75 PE=1 SV=2" 94 59809 4 4 3 3 1378 660 1 0 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 R YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 K2C75_HUMAN "Keratin, type II cytoskeletal 75 OS=Homo sapiens GN=KRT75 PE=1 SV=2" 94 59809 4 4 3 3 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 K2C75_HUMAN "Keratin, type II cytoskeletal 75 OS=Homo sapiens GN=KRT75 PE=1 SV=2" 94 59809 4 4 3 3 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 K2C75_HUMAN "Keratin, type II cytoskeletal 75 OS=Homo sapiens GN=KRT75 PE=1 SV=2" 94 59809 4 4 3 3 2722 4135 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 72.34 4.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5482.5482.2.dta 12 K2C79_HUMAN "Keratin, type II cytoskeletal 79 OS=Homo sapiens GN=KRT79 PE=1 SV=2" 90 58085 3 3 2 2 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 K2C79_HUMAN "Keratin, type II cytoskeletal 79 OS=Homo sapiens GN=KRT79 PE=1 SV=2" 90 58085 3 3 2 2 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 K2C79_HUMAN "Keratin, type II cytoskeletal 79 OS=Homo sapiens GN=KRT79 PE=1 SV=2" 90 58085 3 3 2 2 2722 4135 1 0 0 665.3659 1328.7173 2 1328.7187 -0.0015 0 72.34 4.90E-07 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5482.5482.2.dta 12 K2C3_HUMAN "Keratin, type II cytoskeletal 3 OS=Homo sapiens GN=KRT3 PE=1 SV=3" 67 64549 4 4 3 3 1378 660 1 0 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 K2C3_HUMAN "Keratin, type II cytoskeletal 3 OS=Homo sapiens GN=KRT3 PE=1 SV=3" 67 64549 4 4 3 3 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 K2C3_HUMAN "Keratin, type II cytoskeletal 3 OS=Homo sapiens GN=KRT3 PE=1 SV=3" 67 64549 4 4 3 3 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 K2C3_HUMAN "Keratin, type II cytoskeletal 3 OS=Homo sapiens GN=KRT3 PE=1 SV=3" 67 64549 4 4 3 3 2831 1951 1 0 1 675.8663 1349.7181 2 1349.7191 -0.0009 1 44.14 0.00023 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3158.3158.2.dta 12 K22O_HUMAN "Keratin, type II cytoskeletal 2 oral OS=Homo sapiens GN=KRT76 PE=1 SV=2" 60 66370 4 4 3 3 1378 660 1 0 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 K22O_HUMAN "Keratin, type II cytoskeletal 2 oral OS=Homo sapiens GN=KRT76 PE=1 SV=2" 60 66370 4 4 3 3 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 K22O_HUMAN "Keratin, type II cytoskeletal 2 oral OS=Homo sapiens GN=KRT76 PE=1 SV=2" 60 66370 4 4 3 3 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 K22O_HUMAN "Keratin, type II cytoskeletal 2 oral OS=Homo sapiens GN=KRT76 PE=1 SV=2" 60 66370 4 4 3 3 1544 1348 1 0 0 554.2747 1106.5349 2 1106.5356 -0.0007 0 38.52 0.0012 R AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2489.2489.2.dta 12 K2C8_HUMAN "Keratin, type II cytoskeletal 8 OS=Homo sapiens GN=KRT8 PE=1 SV=7" 42 53671 3 3 2 2 1378 660 1 0 0 533.7611 1065.5077 2 1065.509 -0.0014 1 18.88 0.017 K YEDEINKR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1725.1725.2.dta 12 K2C8_HUMAN "Keratin, type II cytoskeletal 8 OS=Homo sapiens GN=KRT8 PE=1 SV=7" 42 53671 3 3 2 2 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 K2C8_HUMAN "Keratin, type II cytoskeletal 8 OS=Homo sapiens GN=KRT8 PE=1 SV=7" 42 53671 3 3 2 2 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 K2C71_HUMAN "Keratin, type II cytoskeletal 71 OS=Homo sapiens GN=KRT71 PE=1 SV=3" 39 57769 2 2 1 1 1447 2529 1 0 0 361.5376 1081.591 3 1081.592 -0.0011 1 20.85 0.035 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3800.3800.3.dta 12 K2C71_HUMAN "Keratin, type II cytoskeletal 71 OS=Homo sapiens GN=KRT71 PE=1 SV=3" 39 57769 2 2 1 1 1448 2531 1 0 0 541.8029 1081.5913 2 1081.592 -0.0007 1 38.54 0.00091 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3803.3803.2.dta 12 K2C4_HUMAN "Keratin, type II cytoskeletal 4 OS=Homo sapiens GN=KRT4 PE=1 SV=4" 39 57649 1 1 1 1 1544 1348 1 0 0 554.2747 1106.5349 2 1106.5356 -0.0007 0 38.52 0.0012 R AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2489.2489.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 75 1355 1 1 1 323.1817 644.3488 2 644.3493 -0.0005 0 29.4 0.02 R LDIER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2497.2497.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 139 1398 1 1 1 338.6866 675.3587 2 675.3592 -0.0004 0 22.86 0.017 R GFVPEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2545.2545.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 284 1036 1 1 1 376.1849 750.3553 2 750.3548 0.0005 0 43.95 0.00036 K SDSFAPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2143.2143.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 393 1810 1 1 1 399.2113 796.4081 2 796.4079 0.0001 0 43.64 0.00018 K SSFSITR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3002.3002.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 434 666 1 1 1 408.222 814.4295 2 814.4297 -0.0002 0 36.92 0.0013 R EAQVNVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1732.1732.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 817 1122 1 1 1 461.7351 921.4556 2 921.4556 0 1 24.37 0.029 K LRDDFEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2238.2238.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 887 258 1 1 1 470.7642 939.5138 2 939.5138 0.0001 1 31.93 0.003 R DLVHSNKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1285.1285.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 982 1577 1 1 1 484.2223 966.4301 2 966.4308 -0.0007 0 22.01 0.025 R SNWQNYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2742.2742.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1009 827 1 1 1 490.2455 978.4765 2 978.4771 -0.0005 0 28.6 0.011 K TDSEKPFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1910.1910.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1013 1089 1 1 1 327.8188 980.4347 3 980.4352 -0.0005 0 23.6 0.015 K YYLHDDR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2202.2202.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1014 1082 1 1 1 491.2247 980.4349 2 980.4352 -0.0003 0 32.3 0.002 K YYLHDDR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2194.2194.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1032 2205 1 1 1 492.7955 983.5765 2 983.5764 0.0001 0 70.32 2.60E-07 K SPLQSVVVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3442.3442.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1159 1657 1 1 1 508.7719 1015.5293 2 1015.5298 -0.0005 0 44.45 0.0002 R ASAVSELSPR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2832.2832.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1241 2662 1 1 1 518.2772 1034.5399 2 1034.5397 0.0002 0 24.66 0.015 R IDISPSTFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3947.3947.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1495 1786 1 1 1 547.2924 1092.5702 2 1092.5716 -0.0015 1 31.02 0.0053 R GFVPEKNFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2975.2975.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1559 783 1 1 1 370.5173 1108.5302 3 1108.5301 0 1 25.72 0.012 K KYYLHDDR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1862.1862.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1614 1604 1 1 1 560.7849 1119.5552 2 1119.556 -0.0009 1 28.6 0.013 K YKDDPVDLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2772.2772.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 1693 1712 1 1 1 570.7617 1139.5088 2 1139.5095 -0.0007 0 56.49 5.90E-06 K GSFSDTGLGDGK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2893.2893.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 2236 621 1 1 1 621.2853 1240.5561 2 1240.5571 -0.001 0 68.06 4.70E-07 K EESAASGGAAYTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1682.1682.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 2560 794 1 1 1 650.3253 1298.636 2 1298.6367 -0.0008 1 25.71 0.017 R SEGGHRGFVPEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1874.1874.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 2561 788 1 1 1 433.886 1298.636 3 1298.6367 -0.0007 1 28.26 0.0094 R SEGGHRGFVPEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1867.1867.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 2865 293 2 0 1 679.8517 1357.6889 2 1357.6837 0.0052 1 34.91 0.0029 K VIGANKNQEEEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1323.1323.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 2946 537 1 1 1 692.3217 1382.6289 2 1382.6314 -0.0025 0 65.18 1.50E-06 K SPPSTGSTYGSSQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1588.1588.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 2961 758 1 1 1 693.3119 1384.6093 2 1384.6107 -0.0013 0 56.09 8.50E-06 K EQTFSGGTSQDTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1834.1834.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 3013 525 1 1 1 699.3356 1396.6567 2 1396.6582 -0.0015 1 60.18 2.80E-06 K EESAASGGAAYTKR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1575.1575.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 3301 2552 1 1 1 744.895 1487.7755 2 1487.7773 -0.0018 1 41.87 0.00013 K SGKWEGLVYAPPGK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3826.3826.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 3418 2045 1 1 1 765.3936 1528.7726 2 1528.7746 -0.0021 0 66.52 1.50E-06 R SIFQHIQSAQSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3264.3264.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 3419 2044 1 1 1 510.5985 1528.7735 3 1528.7746 -0.0011 0 46.54 0.00017 R SIFQHIQSAQSQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3263.3263.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 3714 1812 1 1 1 811.8801 1621.7457 2 1621.7471 -0.0014 1 82.39 2.50E-08 R KTEELEEESFPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3004.3004.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 3715 1806 1 1 1 541.5892 1621.7459 3 1621.7471 -0.0012 1 24.48 0.015 R KTEELEEESFPER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2997.2997.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 3870 1988 1 1 1 564.921 1691.7411 3 1691.7427 -0.0016 1 24.2 0.011 R NREEEWDPEYTPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3199.3199.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 3871 1991 1 1 1 846.8783 1691.742 2 1691.7427 -0.0006 1 26.62 0.006 R NREEEWDPEYTPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3203.3203.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 4768 1805 1 1 1 1027.9734 2053.9322 2 2053.9341 -0.0019 0 66.24 7.80E-07 K ASESSKPWPDATYGTGSASR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2996.2996.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 4769 1802 1 1 1 685.6517 2053.9332 3 2053.9341 -0.0009 0 62.98 1.60E-06 K ASESSKPWPDATYGTGSASR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2993.2993.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 4886 3159 1 1 1 717.3442 2149.0107 3 2149.011 -0.0003 0 40.65 0.00038 R MDSFDEDLARPSGLLAQER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4467.4467.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 4906 2994 1 1 1 1083.5083 2165.002 2 2165.0059 -0.0038 0 20.76 0.031 R MDSFDEDLARPSGLLAQER K Oxidation (M) 0.1000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4295.4295.2.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 4907 2977 1 1 1 722.6752 2165.0039 3 2165.0059 -0.002 0 39.02 0.00048 R MDSFDEDLARPSGLLAQER K Oxidation (M) 0.1000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4277.4277.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 5191 1101 1 1 1 869.3992 2605.1759 3 2605.178 -0.0021 1 74.3 1.10E-07 K SPPSTGSTYGSSQKEESAASGGAAYTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2215.2215.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 5285 921 1 1 1 1038.1279 3111.362 3 3111.3613 0.0006 1 71.29 9.70E-08 K DSRPSQAAGDNQGDEAKEQTFSGGTSQDTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2015.2015.3.dta 13 1 TR150_HUMAN Thyroid hormone receptor-associated protein 3 OS=Homo sapiens GN=THRAP3 PE=1 SV=2 955 108658 40 40 31 31 5286 920 1 1 1 778.8481 3111.3632 4 3111.3613 0.0019 1 46.94 2.70E-05 K DSRPSQAAGDNQGDEAKEQTFSGGTSQDTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2014.2014.4.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 279 3008 2 1 1 374.2288 746.4431 2 746.4439 -0.0008 0 29.29 0.0089 R ALQLFR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4309.4309.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 441 655 1 1 1 408.732 815.4495 2 815.4501 -0.0006 1 42.3 0.00069 K ADVDKIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1719.1719.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 686 440 1 1 1 442.2533 882.492 2 882.4923 -0.0003 0 27.26 0.0095 R LQSGHLTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1480.1480.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 1451 2775 1 1 1 542.3112 1082.6079 2 1082.6084 -0.0005 0 51.85 2.80E-05 K APAVQDLLTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4070.4070.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 1452 2176 1 1 1 542.3235 1082.6325 2 1082.6335 -0.001 0 18.16 0.029 R LILEPTQAAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3409.3409.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 1477 931 1 1 1 545.7723 1089.53 2 1089.5302 -0.0002 0 49.2 0.00011 K VQLGDQTDSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2026.2026.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 1628 1378 1 1 1 375.2118 1122.6135 3 1122.6145 -0.001 1 25.74 0.013 K IHLDNLDKR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2523.2523.3.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 1689 2912 1 1 1 569.7761 1137.5376 2 1137.539 -0.0014 0 23.76 0.029 K IFGCQNPFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4210.4210.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 1912 2466 1 1 1 592.3044 1182.5943 2 1182.5955 -0.0011 0 48.09 3.10E-05 R SYVLVESVCK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3730.3730.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2134 2986 1 1 1 611.8278 1221.6411 2 1221.6427 -0.0017 0 42.31 0.0004 K LVVECFSQLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4287.4287.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2395 2616 1 1 1 641.3333 1280.652 2 1280.6513 0.0006 0 30.08 0.0074 K FLQQEQSVFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3897.3897.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2604 3193 1 1 1 653.337 1304.6594 2 1304.6612 -0.0018 0 25.54 0.007 R SQPFTLQDLEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4502.4502.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2735 1407 1 1 1 667.8162 1333.6179 2 1333.6197 -0.0018 0 47.97 8.40E-05 R FAASNPCGNIQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2555.2555.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2798 654 1 1 1 449.5568 1345.6486 3 1345.6487 -0.0001 0 29.46 0.0017 K AGGQINHDLHER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1718.1718.3.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2807 2741 1 1 1 674.3479 1346.6812 2 1346.683 -0.0018 0 37.45 0.0016 R LFLESSDANPVR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4033.4033.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2820 3007 1 1 1 675.8451 1349.6756 2 1349.6762 -0.0005 0 49.96 4.40E-05 R DGQILVYCLNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4308.4308.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2830 2698 1 1 1 675.8662 1349.7179 2 1349.7191 -0.0012 0 74.68 2.20E-07 R VFTEANLVSVGSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3987.3987.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2854 2690 1 1 1 678.8718 1355.7291 2 1355.7297 -0.0006 0 71.86 3.10E-07 K GEPVLLVGETGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3978.3978.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 2997 2787 1 1 1 696.3667 1390.7188 2 1390.7205 -0.0016 0 53.78 9.10E-06 R TDSQLQGQVLFR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4083.4083.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 3115 2858 1 1 1 714.8824 1427.7503 2 1427.7507 -0.0004 0 88.27 1.10E-08 R LLEEAQLQDLEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4156.4156.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 3121 3376 1 1 1 715.3765 1428.7384 2 1428.7395 -0.0011 0 63.82 3.70E-06 R AILCAIQNLEER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4695.4695.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 3221 2709 1 1 1 728.3714 1454.7282 2 1454.73 -0.0017 0 34.49 0.0026 R NLLSCVQEIHSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3998.3998.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 3255 3922 1 1 1 734.4189 1466.8233 2 1466.8245 -0.0012 0 56.55 7.20E-06 K ALVLANPEVSLWR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5265.5265.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 3849 3768 1 1 1 841.477 1680.9394 2 1680.941 -0.0016 0 63.23 1.40E-06 R LNALLEPGGVLTISER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5106.5106.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 3982 3825 1 1 1 866.442 1730.8695 2 1730.8727 -0.0032 0 80.52 5.90E-08 K DFADILVQPTLEENK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5164.5164.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 4342 3891 1 1 1 931.4714 1860.9282 2 1860.9292 -0.001 0 81.38 2.30E-08 R ALEFGEPVLLVGDTGCGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5233.5233.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 4542 3824 1 1 1 984.5238 1967.0331 2 1967.0364 -0.0033 0 31.04 0.0034 K ILQPNTTDEFVIPLDPR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5163.5163.2.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 4851 3110 1 1 1 705.3821 2113.1244 3 2113.1266 -0.0022 1 31.14 0.0034 R LLDDNRELLVTETQEVVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4417.4417.3.dta 14 1 MDN1_HUMAN Midasin OS=Homo sapiens GN=MDN1 PE=1 SV=2 855 638008 29 29 29 29 5041 3481 1 1 1 1131.1056 2260.1966 2 2260.1998 -0.0032 0 85.97 9.70E-09 R VTAVCGVVLPGQLPAPGELGGNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4806.4806.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 627 2336 1 1 1 431.2557 860.4969 2 860.4967 0.0002 0 57.81 1.00E-05 K SNSLISIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3586.3586.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 682 1721 1 1 1 440.7483 879.482 2 879.4814 0.0005 0 43.56 0.00017 R TYTQLVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2903.2903.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 862 3843 1 1 1 467.7715 933.5285 2 933.5284 0.0002 0 34.47 0.0017 K DTLGLFLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5183.5183.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1066 2194 1 1 1 496.7824 991.5503 2 991.5524 -0.0022 0 25.81 0.016 K IIYIAPMR S Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3429.3429.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1240 301 1 1 1 518.2643 1034.514 2 1034.5145 -0.0005 0 35.06 0.0023 R AGRPQYDTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1330.1330.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1243 1231 1 1 1 518.7578 1035.5011 2 1035.5019 -0.0008 0 37.17 0.0015 R MLLQSSEGR C Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2359.2359.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1263 3183 1 1 1 522.2736 1042.5326 2 1042.5335 -0.0009 0 30.63 0.0074 R VFSLSSEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4492.4492.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1420 3746 1 1 1 537.8186 1073.6227 2 1073.6233 -0.0007 0 37.93 0.00054 R AIFEIVLNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5083.5083.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1700 2441 1 1 1 571.3572 1140.6999 2 1140.7019 -0.002 0 52.55 5.80E-06 K KPVIVFVPSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3703.3703.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1741 3795 1 1 1 575.8029 1149.5913 2 1149.5918 -0.0005 0 40.5 0.00019 R TLVEDLFADK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5133.5133.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1775 2952 1 1 1 579.3419 1156.6692 2 1156.6703 -0.0011 1 45.35 0.00011 K KADEVLEILK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4252.4252.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1794 3919 1 1 1 582.2954 1162.5763 2 1162.5771 -0.0008 0 57.6 1.70E-05 R DIDAFWLQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5262.5262.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1915 2151 1 1 1 593.2925 1184.5704 2 1184.5714 -0.0009 0 33.93 0.00066 R FYDDAIVSQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3382.3382.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 1969 3597 1 1 1 597.3204 1192.6262 2 1192.6274 -0.0012 0 38.16 0.00092 K TICAEFAILR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4927.4927.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 2010 2415 1 1 1 599.8376 1197.6607 2 1197.6618 -0.0011 0 46.41 0.00015 K NQVLVFVHSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3674.3674.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 2011 2421 1 1 1 400.228 1197.6621 3 1197.6618 0.0002 0 27.23 0.013 K NQVLVFVHSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3680.3680.3.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 2129 2423 1 1 1 611.3141 1220.6137 2 1220.615 -0.0012 0 62.67 5.10E-06 K TGNFQVTELGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3683.3683.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 2927 2684 1 1 1 688.3872 1374.7599 2 1374.7606 -0.0008 0 77 6.00E-08 K VVLLTGETSTDLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3972.3972.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 2983 4046 1 1 1 694.8448 1387.675 2 1387.6772 -0.0022 0 52.6 4.20E-05 R EEGWWVVIGDAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5392.5392.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 3880 3263 1 1 1 566.9649 1697.8729 3 1697.8736 -0.0008 0 28.05 0.01 R LYDLNHNEIGELIR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4576.4576.3.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 3964 3662 1 1 1 864.4666 1726.9186 2 1726.9213 -0.0028 0 81.13 4.30E-08 R NALLQLTDSQIADVAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4996.4996.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 4091 4105 1 1 1 592.3168 1773.9285 3 1773.9295 -0.001 0 52.83 3.30E-05 R LTAIDILTTCAADIQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5452.5452.3.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 4092 4107 1 1 1 887.9719 1773.9292 2 1773.9295 -0.0003 0 99.07 7.70E-10 R LTAIDILTTCAADIQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5454.5454.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 4405 1528 1 1 1 632.2975 1893.8706 3 1893.8738 -0.0032 1 30.51 0.0014 R EGSASTEVLRTEAEQCK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2688.2688.3.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 4494 3212 1 1 1 972.4891 1942.9636 2 1942.967 -0.0034 0 84.92 1.90E-08 R AALETDENLLLCAPTGAGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4522.4522.2.dta 15 1 U520_HUMAN U5 small nuclear ribonucleoprotein 200 kDa helicase OS=Homo sapiens GN=SNRNP200 PE=1 SV=2 826 246006 26 26 24 24 4510 3533 1 1 1 978.0145 1954.0145 2 1954.0193 -0.0048 0 92.39 2.50E-09 K LPDMLNAEIVLGNVQNAK D Oxidation (M) 0.000100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4860.4860.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 123 159 1 1 1 335.6976 669.3807 2 669.381 -0.0002 0 33.82 0.0018 K VAANAPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1177.1177.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 591 631 1 1 1 427.2153 852.4161 2 852.4164 -0.0003 0 29.5 0.0066 K YIQAACK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1693.1693.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 688 1744 1 1 1 443.2083 884.402 2 884.4028 -0.0008 0 25.85 0.0091 R AYEFAER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2928.2928.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 1392 1075 1 1 1 535.276 1068.5375 2 1068.5386 -0.0011 0 35.02 0.0019 R AHIAQLCEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2186.2186.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 1565 4411 1 1 1 555.8369 1109.6593 2 1109.6597 -0.0004 0 19.11 0.026 K LLLPWLEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5775.5775.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 2212 3863 1 1 1 618.8358 1235.657 2 1235.6584 -0.0014 0 42.46 0.0003 K TLQIFNIEMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5204.5204.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 2539 2704 1 1 1 648.838 1295.6615 2 1295.6622 -0.0007 0 51.36 1.50E-05 K LLYNNVSNFGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3993.3993.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 2591 3221 1 1 1 652.833 1303.6515 2 1303.652 -0.0006 0 67.97 4.90E-07 R NNLAGAEELFAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4532.4532.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 2750 2789 1 1 1 669.3466 1336.6787 2 1336.6809 -0.0022 0 76.99 6.00E-08 R VVGAMQLYSVDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4085.4085.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 2848 4350 1 1 1 677.4252 1352.8359 2 1352.8391 -0.0032 0 70.58 8.70E-08 R NLQNLLILTAIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5706.5706.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 3041 2954 1 1 1 701.8423 1401.6701 2 1401.6711 -0.0009 0 49.02 7.80E-05 R CNEPAVWSQLAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4254.4254.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 3229 1808 1 1 1 730.3502 1458.6858 2 1458.6891 -0.0034 1 42.53 0.00032 R FLRENPYYDSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2999.2999.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 3230 1804 1 1 1 487.2368 1458.6885 3 1458.6891 -0.0006 1 19.59 0.023 R FLRENPYYDSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2995.2995.3.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 3361 1915 1 1 1 754.3809 1506.7472 2 1506.7501 -0.0029 0 71.61 5.40E-07 K VIQCFAETGQVQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3118.3118.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 3491 3237 1 1 1 776.3799 1550.7452 2 1550.7464 -0.0012 0 68.34 3.90E-07 R GQFSTDELVAEVEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4549.4549.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 3503 3881 1 1 1 778.4281 1554.8416 2 1554.844 -0.0023 0 37.82 0.0008 K LTDQLPLIIVCDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5223.5223.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 3711 2671 1 1 1 540.9507 1619.8302 3 1619.8307 -0.0005 1 48.65 8.10E-05 R ALEHFTDLYDIKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3957.3957.3.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 3927 2345 1 1 1 572.9612 1715.8619 3 1715.8631 -0.0012 0 33.07 0.0021 K VSQPIEGHAASFAQFK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3596.3596.3.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 4056 2546 1 1 1 879.9429 1757.8713 2 1757.8736 -0.0023 1 75.72 7.90E-08 R KFNALFAQGNYSEAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3819.3819.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 4094 796 1 1 1 592.9487 1775.8242 3 1775.826 -0.0019 0 33.68 0.00069 R IHEGCEEPATHNALAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1876.1876.3.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 4317 2535 1 1 1 924.4745 1846.9345 2 1846.9359 -0.0014 0 40.05 0.00026 K YESLELCRPVLQQGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3807.3807.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 4551 2895 1 1 1 657.6803 1970.0191 3 1970.0221 -0.0031 0 45.29 5.70E-05 R LASTLVHLGEYQAAVDGAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4194.4194.3.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 4552 2907 1 1 1 986.0169 1970.0193 2 1970.0221 -0.0029 0 62.97 1.20E-06 R LASTLVHLGEYQAAVDGAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4206.4206.2.dta 16 1 CLH1_HUMAN Clathrin heavy chain 1 OS=Homo sapiens GN=CLTC PE=1 SV=5 763 193260 24 24 22 22 4895 3742 1 1 1 1077.0026 2151.9906 2 2151.9929 -0.0023 0 90.77 4.00E-09 R GQCDLELINVCNENSLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5079.5079.2.dta 16 CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 261 189020 8 8 8 8 591 631 1 0 1 427.2153 852.4161 2 852.4164 -0.0003 0 29.5 0.0066 K YIQAACK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1693.1693.2.dta 16 CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 261 189020 8 8 8 8 688 1744 1 0 1 443.2083 884.402 2 884.4028 -0.0008 0 25.85 0.0091 R AYEFAER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2928.2928.2.dta 16 CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 261 189020 8 8 8 8 1392 1075 1 0 1 535.276 1068.5375 2 1068.5386 -0.0011 0 35.02 0.0019 R AHIAQLCEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2186.2186.2.dta 16 CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 261 189020 8 8 8 8 2212 3863 1 0 1 618.8358 1235.657 2 1235.6584 -0.0014 0 42.46 0.0003 K TLQIFNIEMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5204.5204.2.dta 16 CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 261 189020 8 8 8 8 2750 2789 1 0 1 669.3466 1336.6787 2 1336.6809 -0.0022 0 76.99 6.00E-08 R VVGAMQLYSVDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4085.4085.2.dta 16 CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 261 189020 8 8 8 8 2848 4350 1 0 1 677.4252 1352.8359 2 1352.8391 -0.0032 0 70.58 8.70E-08 R NLQNLLILTAIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5706.5706.2.dta 16 CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 261 189020 8 8 8 8 3491 3237 1 0 1 776.3799 1550.7452 2 1550.7464 -0.0012 0 68.34 3.90E-07 R GQFSTDELVAEVEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4549.4549.2.dta 16 CLH2_HUMAN Clathrin heavy chain 2 OS=Homo sapiens GN=CLTCL1 PE=1 SV=2 261 189020 8 8 8 8 3503 3881 1 0 1 778.4281 1554.8416 2 1554.844 -0.0023 0 37.82 0.0008 K LTDQLPLIIVCDR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5223.5223.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 252 1319 1 1 1 365.2162 728.4178 2 728.4181 -0.0003 0 36.62 0.0023 R VSASLPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2457.2457.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 254 1574 1 1 1 365.2163 728.418 2 728.4181 -0.0001 0 23.47 0.048 R GISSLPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2738.2738.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 255 1335 1 1 1 365.2165 728.4184 2 728.4181 0.0003 0 28.7 0.015 R VSASLPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2475.2475.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 267 879 1 1 1 372.2185 742.4224 2 742.4225 -0.0001 0 28.58 0.0078 R ISAVEPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1968.1968.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 450 2163 1 1 1 409.7295 817.4445 2 817.4446 -0.0001 0 33.33 0.0044 K TALPFNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3395.3395.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 519 1556 1 1 1 417.7321 833.4497 2 833.4494 0.0003 0 43.82 0.00038 K ASESISLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2719.2719.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 1811 2107 1 1 1 583.314 1164.6134 2 1164.6139 -0.0005 1 45.93 0.00014 K ALEDSSFLKR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3333.3333.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 2593 3708 1 1 1 652.8638 1303.713 2 1303.7136 -0.0006 0 87.41 1.10E-08 K AFENLLGQALTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5043.5043.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 2672 961 1 1 1 659.3411 1316.6676 2 1316.6684 -0.0008 1 40.67 0.00082 R QAEIERETSVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2059.2059.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 2761 2221 1 1 1 670.3289 1338.6432 2 1338.6449 -0.0018 0 51.79 3.80E-05 R SLTSCSSDITLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3459.3459.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 2772 2268 1 1 1 671.3178 1340.6211 2 1340.6217 -0.0006 0 48.61 7.20E-05 R ICSYCNNILGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3512.3512.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 2840 2063 1 1 1 676.8381 1351.6617 2 1351.6633 -0.0016 0 26.51 0.0081 R TPLHNDNSWIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3284.3284.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 2864 1547 1 1 1 679.8361 1357.6576 2 1357.6586 -0.001 1 40 0.0002 R RGESLDNLDSPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2709.2709.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 3113 460 1 1 1 714.8441 1427.6737 2 1427.6753 -0.0016 0 38.47 0.00046 R SHSPSASQSGSQLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1503.1503.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 3174 2937 1 1 1 721.3246 1440.6347 2 1440.6369 -0.0021 0 73.35 1.30E-07 R EDSFESLDSLGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4237.4237.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 3358 865 1 1 1 752.8833 1503.752 2 1503.7529 -0.0009 0 99.46 9.30E-10 K TSTTGVATTQSPTPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1953.1953.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 3804 3897 1 1 1 829.9401 1657.8656 2 1657.8709 -0.0053 0 25.45 0.0073 R ASLENGVLLCDLINK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5239.5239.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 3805 3871 1 1 1 829.941 1657.8674 2 1657.8709 -0.0035 0 100.91 4.90E-10 R ASLENGVLLCDLINK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5213.5213.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 3922 4313 1 1 1 857.9895 1713.9645 2 1713.9665 -0.0021 0 56.79 4.00E-06 R LSTPIAGLDNINVFLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5669.5669.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 4101 3739 1 1 1 889.9136 1777.8127 2 1777.8159 -0.0032 0 37.98 0.00027 R EPSLATWEATWSEGSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5076.5076.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 4448 1566 1 1 1 957.3922 1912.7699 2 1912.7714 -0.0015 0 126.46 2.30E-13 K CVACECDLGGSSSGAEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2729.2729.2.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 5158 2461 1 1 1 846.0817 2535.2233 3 2535.2241 -0.0008 1 36.23 0.001 R RPVDSYDIPKTEEASSGFLPGDR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3725.3725.3.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 5206 3164 1 1 1 895.1312 2682.3718 3 2682.3712 0.0007 0 47.61 6.70E-05 R VTTEIQLPSQSPVEEQSPASLSSLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4473.4473.3.dta 17 1 LMO7_HUMAN LIM domain only protein 7 OS=Homo sapiens GN=LMO7 PE=1 SV=3 759 194002 24 24 22 22 5225 3835 1 1 1 916.4564 2746.3474 3 2746.345 0.0024 0 23.32 0.02 R SQFFEQGSSDSVVPDLPVPTISAPSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5174.5174.3.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 145 692 1 1 1 339.6818 677.3491 2 677.3497 -0.0006 0 31.75 0.0071 K FVEGAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1760.1760.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 374 1427 1 1 1 394.7346 787.4546 2 787.4552 -0.0006 0 32.34 0.0044 R TSINVVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2577.2577.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 958 1580 1 1 1 480.7625 959.5105 2 959.511 -0.0005 0 30.2 0.006 K VVAVDCGIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2745.2745.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 1119 733 1 1 1 503.246 1004.4774 2 1004.4774 0 0 34.43 0.0022 K ELSEPSSTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1806.1806.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 1152 1874 1 1 1 508.2404 1014.4662 2 1014.4658 0.0004 0 23.63 0.013 R TFEESFQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3073.3073.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 1169 2362 1 1 1 509.7709 1017.5273 2 1017.5277 -0.0005 0 28.98 0.013 K SVGEVMAIGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3615.3615.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 1238 1572 1 1 1 517.7687 1033.5228 2 1033.5226 0.0002 0 55.22 2.60E-05 K SVGEVMAIGR T Oxidation (M) 0.0000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2736.2736.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 1244 2122 1 1 0 518.7689 1035.5233 2 1035.5237 -0.0004 0 29.87 0.008 K EIEYEVVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3349.3349.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 1727 1839 1 1 1 574.7895 1147.5645 2 1147.5656 -0.001 0 61.07 7.50E-06 K CLGLTEAQTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3034.3034.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 1800 3949 1 1 1 582.3734 1162.7323 2 1162.7325 -0.0002 0 29.39 0.0012 K IALGIPLPEIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5292.5292.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2135 3592 1 1 1 611.845 1221.6754 2 1221.6757 -0.0004 0 51.29 3.60E-05 K ATGYPLAFIAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4922.4922.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2215 1203 1 1 1 618.8503 1235.6861 2 1235.6874 -0.0013 0 39.93 0.00042 R VSQEHPVVLTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2328.2328.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2216 1201 1 1 1 412.9033 1235.688 3 1235.6874 0.0007 0 22.67 0.03 R VSQEHPVVLTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2326.2326.3.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2257 2200 1 1 1 623.8258 1245.6371 2 1245.6387 -0.0017 0 39.56 0.00047 K IMGTSPLQIDR A Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3436.3436.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2390 3608 1 1 1 639.8505 1277.6864 2 1277.6867 -0.0004 0 50.71 3.00E-05 K TLGVDFIDVATK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4938.4938.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2557 3676 1 1 1 649.834 1297.6535 2 1297.6554 -0.0018 0 27.61 0.0088 K LYFEELSLER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5010.5010.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2705 2000 1 1 1 663.3625 1324.7104 2 1324.7099 0.0005 0 62.62 2.70E-06 R GQNQPVLNITNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3213.3213.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2939 2405 1 1 1 690.8627 1379.7108 2 1379.7119 -0.0011 0 61.5 5.40E-06 K AFAMTNQILVEK S Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3663.3663.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2944 1581 1 1 1 691.8662 1381.7179 2 1381.7201 -0.0023 0 62.97 2.80E-06 K AQTAHIVLEDGTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2746.2746.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 2945 1583 1 1 1 461.58 1381.7182 3 1381.7201 -0.0019 0 20.34 0.015 K AQTAHIVLEDGTK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2748.2748.3.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 3088 3353 1 1 1 710.376 1418.7375 2 1418.7405 -0.003 0 63.6 1.10E-06 K AVNTLNEALEFAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4670.4670.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 3516 1965 1 1 1 519.6238 1555.8495 3 1555.8504 -0.0009 1 21.33 0.037 K VVAVDCGIKNNVIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3174.3174.3.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 3586 2484 1 1 1 789.4107 1576.8069 2 1576.8096 -0.0028 1 37.47 0.0014 R QLFSDKLNEINEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3750.3750.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 3587 2473 1 1 1 526.6103 1576.809 3 1576.8096 -0.0006 1 17.72 0.025 R QLFSDKLNEINEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3738.3738.3.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 3622 4261 1 1 1 795.4239 1588.8332 2 1588.8348 -0.0016 0 97.65 1.10E-09 K IAPSFAVESIEDALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5615.5615.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 3632 2842 1 1 1 796.8958 1591.777 2 1591.7777 -0.0007 0 96.59 1.60E-09 R SAYALGGLGSGICPNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4139.4139.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 3675 3148 1 1 1 804.4 1606.7854 2 1606.7872 -0.0019 0 94.97 1.70E-09 K VLGTSVESIMATEDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4456.4456.2.dta 18 1 CPSM_HUMAN "Carbamoyl-phosphate synthase [ammonia], mitochondrial OS=Homo sapiens GN=CPS1 PE=1 SV=2" 739 165975 28 28 24 24 4196 3972 1 1 1 902.4965 1802.9785 2 1802.9778 0.0007 0 39.86 0.00046 R TAVDSGIPLLTNFQVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5316.5316.2.dta 18 2 PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 40 245167 2 2 2 2 1244 2122 1 0 0 518.7689 1035.5233 2 1035.5237 -0.0004 0 29.87 0.008 K EIEYEVVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3349.3349.2.dta 18 2 PYR1_HUMAN CAD protein OS=Homo sapiens GN=CAD PE=1 SV=3 40 245167 2 2 2 2 1406 3810 1 0 1 536.8032 1071.5918 2 1071.5924 -0.0006 0 31.88 0.0056 R LSLDDLLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5148.5148.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 39 1822 1 1 1 311.6813 621.3481 2 621.3486 -0.0005 0 29.5 0.013 R NTLFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3015.3015.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 282 3316 1 1 1 374.7337 747.4529 2 747.4531 -0.0002 0 21.33 0.0088 R IFDLIK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4632.4632.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 430 333 1 1 1 406.7348 811.455 2 811.4552 -0.0002 0 38.03 0.00084 R SVLHQTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1365.1365.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 523 1056 1 1 1 418.2555 834.4965 2 834.4963 0.0002 1 19.79 0.03 R TFQALKK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2165.2165.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 622 1135 1 1 1 430.7273 859.44 2 859.4399 0.0001 0 35.69 0.003 R ITDDQLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2253.2253.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 763 279 1 1 1 453.7487 905.4829 2 905.4831 -0.0003 0 41.43 0.00038 R AVGPAQAHR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1307.1307.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 776 1221 1 1 1 304.175 909.503 3 909.5032 -0.0001 0 34.1 0.00073 K TALEAHIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2348.2348.3.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 777 1215 1 1 1 455.759 909.5034 2 909.5032 0.0002 0 40.33 0.00052 K TALEAHIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2342.2342.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 880 449 1 1 1 469.7195 937.4245 2 937.4253 -0.0008 0 46.02 0.00011 K YSNADVNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1490.1490.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 1074 1259 1 1 1 497.7348 993.4551 2 993.455 0.0001 0 37.51 0.00096 K CDTVLGSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2390.2390.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 1356 3999 1 1 1 530.8416 1059.6687 2 1059.6692 -0.0005 0 45.76 2.70E-05 K LFSNILILK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5344.5344.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 1640 1887 1 1 1 564.2519 1126.4892 2 1126.4899 -0.0007 0 19.7 0.034 R CNQCSLAFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3087.3087.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 1641 929 1 1 1 564.261 1126.5075 2 1126.5077 -0.0001 0 36.46 0.0009 R TSNLNYQCK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2024.2024.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 1764 76 1 1 1 578.8066 1155.5987 2 1155.5996 -0.0009 0 51.24 5.30E-05 R QLQQQQQQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1084.1084.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 2261 3082 1 1 1 623.8377 1245.6609 2 1245.6618 -0.001 0 40.95 0.00027 R VVQVWFQNAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4388.4388.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 2286 600 1 1 1 628.3074 1254.6003 2 1254.6026 -0.0023 1 29.54 0.0017 R TSNLNYQCKK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1658.1658.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 2380 3052 1 1 1 638.8428 1275.6711 2 1275.6724 -0.0013 0 40.98 0.00014 R VVQVWFQNTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4355.4355.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 3095 2696 1 1 1 711.8581 1421.7016 2 1421.7038 -0.0022 0 42.31 0.00032 R ISFPGSSESPLSSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3985.3985.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 3258 3603 1 1 1 734.8673 1467.7201 2 1467.7206 -0.0005 1 78.04 8.30E-08 K DSGLTSVGTDTFRL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4933.4933.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 3463 2809 1 1 1 770.4055 1538.7965 2 1538.798 -0.0016 0 61.78 1.60E-06 R LSSGLVSPAPSFYSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4105.4105.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 3689 818 1 1 1 806.4009 1610.7873 2 1610.79 -0.0027 0 82.21 3.90E-08 K LAEAPSAQPNQTQEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1900.1900.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 3838 3421 1 1 1 838.9576 1675.9007 2 1675.9032 -0.0025 0 56.53 1.00E-05 R TTITPEQLEILYQK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4742.4742.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 4278 4043 1 1 1 916.4554 1830.8963 2 1830.8999 -0.0036 0 69.36 3.30E-07 K GLPEEDEDLGQIFTIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5389.5389.2.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 4697 801 1 1 1 674.0071 2018.9994 3 2019.0021 -0.0027 0 25.22 0.0043 K QGQPKPELQQQEQPEQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1882.1882.3.dta 19 1 ZFHX3_HUMAN Zinc finger homeobox protein 3 OS=Homo sapiens GN=ZFHX3 PE=1 SV=2 628 408841 25 25 23 23 4698 817 1 1 1 1010.5074 2019.0002 2 2019.0021 -0.0019 0 36.5 0.00038 K QGQPKPELQQQEQPEQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1899.1899.2.dta 19 ZFHX4_HUMAN Zinc finger homeobox protein 4 OS=Homo sapiens GN=ZFHX4 PE=1 SV=1 113 398157 6 6 6 6 39 1822 1 0 1 311.6813 621.3481 2 621.3486 -0.0005 0 29.5 0.013 R NTLFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3015.3015.2.dta 19 ZFHX4_HUMAN Zinc finger homeobox protein 4 OS=Homo sapiens GN=ZFHX4 PE=1 SV=1 113 398157 6 6 6 6 430 333 1 0 1 406.7348 811.455 2 811.4552 -0.0002 0 38.03 0.00084 R SVLHQTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1365.1365.2.dta 19 ZFHX4_HUMAN Zinc finger homeobox protein 4 OS=Homo sapiens GN=ZFHX4 PE=1 SV=1 113 398157 6 6 6 6 523 1056 1 0 1 418.2555 834.4965 2 834.4963 0.0002 1 19.79 0.03 R TFQALKK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2165.2165.2.dta 19 ZFHX4_HUMAN Zinc finger homeobox protein 4 OS=Homo sapiens GN=ZFHX4 PE=1 SV=1 113 398157 6 6 6 6 1074 1259 1 0 1 497.7348 993.4551 2 993.455 0.0001 0 37.51 0.00096 K CDTVLGSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2390.2390.2.dta 19 ZFHX4_HUMAN Zinc finger homeobox protein 4 OS=Homo sapiens GN=ZFHX4 PE=1 SV=1 113 398157 6 6 6 6 2261 3082 1 0 1 623.8377 1245.6609 2 1245.6618 -0.001 0 40.95 0.00027 R VVQVWFQNAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4388.4388.2.dta 19 ZFHX4_HUMAN Zinc finger homeobox protein 4 OS=Homo sapiens GN=ZFHX4 PE=1 SV=1 113 398157 6 6 6 6 2380 3052 1 0 1 638.8428 1275.6711 2 1275.6724 -0.0013 0 40.98 0.00014 R VVQVWFQNTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4355.4355.2.dta 19 ZFHX2_HUMAN Zinc finger homeobox protein 2 OS=Homo sapiens GN=ZFHX2 PE=2 SV=3 41 277425 1 1 1 1 2380 3052 1 0 1 638.8428 1275.6711 2 1275.6724 -0.0013 0 40.98 0.00014 R VVQVWFQNTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4355.4355.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 162 464 1 1 1 342.7053 683.3961 2 683.3966 -0.0005 0 45.95 0.00015 K GPAAIQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1507.1507.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 276 954 3 1 1 373.2139 744.4132 2 744.413 0.0002 0 26.71 0.04 K EVTQLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2052.2052.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 422 1685 1 1 0 405.2239 808.4332 2 808.433 0.0002 0 23.29 0.031 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2863.2863.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 431 281 1 1 1 406.7529 811.4912 2 811.4916 -0.0003 1 29.43 0.0035 K KGPAAIQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1309.1309.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 712 2770 1 1 1 449.2102 896.4058 2 896.4062 -0.0004 0 25.41 0.013 R MTLDDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4065.4065.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 965 237 1 1 1 481.7484 961.4822 2 961.4828 -0.0007 1 39 0.0014 K SLEDTKNR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1262.1262.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 1016 190 1 1 1 491.7204 981.4263 2 981.4265 -0.0001 0 68.77 4.00E-07 R FSSSGGGGGGGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1212.1212.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 1354 2612 1 1 1 530.7852 1059.5559 2 1059.556 -0.0001 0 37.8 0.001 K TLLDIDNTR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3893.3893.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 1368 1224 1 1 1 533.2536 1064.4927 2 1064.492 0.0006 0 53.49 2.50E-05 K STMQELNSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2352.2352.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 1416 2033 1 1 1 537.7637 1073.5129 2 1073.5142 -0.0012 0 34.59 0.002 R QFSSSYLSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3250.3250.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 1440 549 1 1 1 541.2504 1080.4862 2 1080.487 -0.0008 0 51.49 3.10E-05 K STMQELNSR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1602.1602.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 1768 2115 1 1 1 579.2986 1156.5826 2 1156.5836 -0.001 0 48.65 5.00E-05 R QGVDADINGLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3342.3342.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 2206 802 1 1 1 618.2671 1234.5196 2 1234.5215 -0.0018 0 77.04 3.30E-08 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1883.1883.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 2619 2393 1 1 1 654.342 1306.6694 2 1306.6703 -0.0009 1 27.36 0.014 R IKFEMEQNLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3649.3649.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 2698 1662 1 1 1 662.3391 1322.6637 2 1322.6652 -0.0016 1 27.9 0.013 R IKFEMEQNLR Q Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2837.2837.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 2699 1669 1 1 1 441.8956 1322.6651 3 1322.6652 -0.0002 1 31.4 0.0035 R IKFEMEQNLR Q Oxidation (M) 0.0000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2845.2845.3.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 4178 633 1 1 1 896.3666 1790.7187 2 1790.7205 -0.0018 0 154.45 3.60E-16 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1695.1695.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 4355 2427 1 1 1 934.4634 1866.9123 2 1866.9145 -0.0022 1 49.76 2.40E-05 K TLNDMRQEYEQLIAK N Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3687.3687.2.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 4356 2426 1 1 1 623.3118 1866.9135 3 1866.9145 -0.001 1 15 0.039 K TLNDMRQEYEQLIAK N Oxidation (M) 0.000010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3686.3686.3.dta 20 1 K1C9_HUMAN "Keratin, type I cytoskeletal 9 OS=Homo sapiens GN=KRT9 PE=1 SV=3" 626 62255 20 20 16 16 5292 1234 1 1 1 1075.0973 3222.27 3 3222.2744 -0.0043 0 112.36 5.80E-12 R GGSGGSHGGGSGFGGESGGSYGGGEEASGSGGGYGGGSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2363.2363.3.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 417 1792 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 39.29 0.0011 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2982.2982.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 422 1685 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 23.29 0.031 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2863.2863.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 1232 2705 1 0 1 516.3026 1030.5907 2 1030.591 -0.0003 0 29.27 0.0063 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3994.3994.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 1367 1883 1 0 0 532.8088 1063.603 2 1063.6026 0.0004 1 54.32 1.30E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3083.3083.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 1537 617 1 0 0 553.7655 1105.5165 2 1105.5186 -0.0021 0 45.55 0.00024 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1677.1677.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 2204 1795 1 0 1 617.843 1233.6714 2 1233.6717 -0.0003 1 35.67 0.0017 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2985.2985.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 2205 1797 1 0 1 412.2313 1233.672 3 1233.6717 0.0003 1 29.76 0.0068 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2987.2987.3.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 2325 1568 1 0 1 631.8014 1261.5882 2 1261.5899 -0.0016 0 76.07 1.40E-07 R SLLEGEGSSGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2732.2732.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 2941 1864 1 0 1 691.3275 1380.6405 2 1380.6408 -0.0004 0 72.14 3.60E-07 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3062.3062.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 3133 2165 1 0 1 717.8869 1433.7593 2 1433.7626 -0.0034 1 29.76 0.0016 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3397.3397.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 3324 1107 1 0 1 747.37 1492.7254 2 1492.727 -0.0015 1 52.18 2.60E-05 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2222.2222.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 3325 1102 1 0 1 498.5829 1492.7267 3 1492.727 -0.0002 1 22.04 0.047 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2216.2216.3.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 3893 2856 1 0 1 854.3889 1706.7633 2 1706.7649 -0.0016 0 126.64 8.50E-13 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4154.4154.2.dta 20 2 K1C10_HUMAN "Keratin, type I cytoskeletal 10 OS=Homo sapiens GN=KRT10 PE=1 SV=6" 468 59020 14 14 12 12 4805 3218 1 0 1 1041.9833 2081.952 2 2081.9575 -0.0055 0 87.91 7.00E-09 R AETECQNTEYQQLLDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4528.4528.2.dta 20 3 K1C14_HUMAN "Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4" 175 51872 7 7 7 7 417 1792 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 39.29 0.0011 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2982.2982.2.dta 20 3 K1C14_HUMAN "Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4" 175 51872 7 7 7 7 422 1685 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 23.29 0.031 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2863.2863.2.dta 20 3 K1C14_HUMAN "Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4" 175 51872 7 7 7 7 1221 2831 1 0 1 515.3005 1028.5864 2 1028.5866 -0.0002 0 56.95 1.40E-05 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4128.4128.2.dta 20 3 K1C14_HUMAN "Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4" 175 51872 7 7 7 7 1367 1883 1 0 0 532.8088 1063.603 2 1063.6026 0.0004 1 54.32 1.30E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3083.3083.2.dta 20 3 K1C14_HUMAN "Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4" 175 51872 7 7 7 7 1537 617 1 0 0 553.7655 1105.5165 2 1105.5186 -0.0021 0 45.55 0.00024 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1677.1677.2.dta 20 3 K1C14_HUMAN "Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4" 175 51872 7 7 7 7 1540 1647 1 0 1 553.7848 1105.555 2 1105.555 0 0 41.92 0.00055 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2820.2820.2.dta 20 3 K1C14_HUMAN "Keratin, type I cytoskeletal 14 OS=Homo sapiens GN=KRT14 PE=1 SV=4" 175 51872 7 7 7 7 2570 2009 1 0 1 651.3327 1300.6509 2 1300.651 -0.0002 0 39.54 0.00087 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3223.3223.2.dta 20 K1C15_HUMAN "Keratin, type I cytoskeletal 15 OS=Homo sapiens GN=KRT15 PE=1 SV=3" 131 49409 5 5 5 5 417 1792 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 39.29 0.0011 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2982.2982.2.dta 20 K1C15_HUMAN "Keratin, type I cytoskeletal 15 OS=Homo sapiens GN=KRT15 PE=1 SV=3" 131 49409 5 5 5 5 422 1685 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 23.29 0.031 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2863.2863.2.dta 20 K1C15_HUMAN "Keratin, type I cytoskeletal 15 OS=Homo sapiens GN=KRT15 PE=1 SV=3" 131 49409 5 5 5 5 1221 2831 1 0 1 515.3005 1028.5864 2 1028.5866 -0.0002 0 56.95 1.40E-05 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4128.4128.2.dta 20 K1C15_HUMAN "Keratin, type I cytoskeletal 15 OS=Homo sapiens GN=KRT15 PE=1 SV=3" 131 49409 5 5 5 5 1367 1883 1 0 0 532.8088 1063.603 2 1063.6026 0.0004 1 54.32 1.30E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3083.3083.2.dta 20 K1C15_HUMAN "Keratin, type I cytoskeletal 15 OS=Homo sapiens GN=KRT15 PE=1 SV=3" 131 49409 5 5 5 5 2570 2009 1 0 1 651.3327 1300.6509 2 1300.651 -0.0002 0 39.54 0.00087 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3223.3223.2.dta 20 K1C17_HUMAN "Keratin, type I cytoskeletal 17 OS=Homo sapiens GN=KRT17 PE=1 SV=2" 112 48361 4 4 4 4 417 1792 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 39.29 0.0011 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2982.2982.2.dta 20 K1C17_HUMAN "Keratin, type I cytoskeletal 17 OS=Homo sapiens GN=KRT17 PE=1 SV=2" 112 48361 4 4 4 4 422 1685 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 23.29 0.031 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2863.2863.2.dta 20 K1C17_HUMAN "Keratin, type I cytoskeletal 17 OS=Homo sapiens GN=KRT17 PE=1 SV=2" 112 48361 4 4 4 4 1221 2831 1 0 1 515.3005 1028.5864 2 1028.5866 -0.0002 0 56.95 1.40E-05 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4128.4128.2.dta 20 K1C17_HUMAN "Keratin, type I cytoskeletal 17 OS=Homo sapiens GN=KRT17 PE=1 SV=2" 112 48361 4 4 4 4 1367 1883 1 0 0 532.8088 1063.603 2 1063.6026 0.0004 1 54.32 1.30E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3083.3083.2.dta 20 K1C28_HUMAN "Keratin, type I cytoskeletal 28 OS=Homo sapiens GN=KRT28 PE=1 SV=2" 63 51163 2 2 2 2 417 1792 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 39.29 0.0011 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2982.2982.2.dta 20 K1C28_HUMAN "Keratin, type I cytoskeletal 28 OS=Homo sapiens GN=KRT28 PE=1 SV=2" 63 51163 2 2 2 2 1537 617 1 0 0 553.7655 1105.5165 2 1105.5186 -0.0021 0 45.55 0.00024 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1677.1677.2.dta 20 K1C12_HUMAN "Keratin, type I cytoskeletal 12 OS=Homo sapiens GN=KRT12 PE=1 SV=1" 58 53592 2 2 2 2 422 1685 1 0 0 405.2239 808.4332 2 808.433 0.0002 0 23.29 0.031 R LASYLDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2863.2863.2.dta 20 K1C12_HUMAN "Keratin, type I cytoskeletal 12 OS=Homo sapiens GN=KRT12 PE=1 SV=1" 58 53592 2 2 2 2 1367 1883 1 0 0 532.8088 1063.603 2 1063.6026 0.0004 1 54.32 1.30E-05 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3083.3083.2.dta 20 K1C13_HUMAN "Keratin, type I cytoskeletal 13 OS=Homo sapiens GN=KRT13 PE=1 SV=4" 57 49900 2 2 2 2 417 1792 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 39.29 0.0011 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2982.2982.2.dta 20 K1C13_HUMAN "Keratin, type I cytoskeletal 13 OS=Homo sapiens GN=KRT13 PE=1 SV=4" 57 49900 2 2 2 2 2570 2009 1 0 1 651.3327 1300.6509 2 1300.651 -0.0002 0 39.54 0.00087 R ALEEANADLEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3223.3223.2.dta 20 K1C25_HUMAN "Keratin, type I cytoskeletal 25 OS=Homo sapiens GN=KRT25 PE=1 SV=1" 46 49858 1 1 1 1 1537 617 1 0 0 553.7655 1105.5165 2 1105.5186 -0.0021 0 45.55 0.00024 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1677.1677.2.dta 20 K1C18_HUMAN "Keratin, type I cytoskeletal 18 OS=Homo sapiens GN=KRT18 PE=1 SV=2" 39 48029 1 1 1 1 417 1792 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 39.29 0.0011 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2982.2982.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 47 974 1 1 1 315.2026 628.3907 2 628.3908 -0.0001 0 39 0.0017 R LGQLAK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2074.2074.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 288 264 1 1 1 376.7061 751.3976 2 751.3977 -0.0001 0 20.36 0.042 K ETIHPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1290.1290.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 317 2347 1 1 1 382.2392 762.4638 2 762.464 -0.0001 0 28.09 0.0049 R VYLGALK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3598.3598.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 415 3086 1 1 1 403.2444 804.4742 2 804.4745 -0.0003 0 39.73 0.00023 K FGDLILK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4393.4393.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 433 878 1 1 1 406.7659 811.5172 2 811.5167 0.0005 0 18.92 0.013 K VILKPDK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1967.1967.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 578 658 1 1 1 424.219 846.4234 2 846.4236 -0.0002 0 30.09 0.0099 R HTLAYDK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1723.1723.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 679 3508 1 1 1 439.7424 877.4702 2 877.4698 0.0004 0 31.4 0.0068 R AVFWDIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4833.4833.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 708 1920 1 1 1 448.2261 894.4376 2 894.4382 -0.0006 0 34.42 0.0024 R TAQCFLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3124.3124.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 877 938 1 1 1 313.1831 936.5275 3 936.528 -0.0005 1 23.09 0.02 R LKEAYSVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2034.2034.3.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 878 937 1 1 1 469.2713 936.5281 2 936.528 0.0001 1 20.18 0.034 R LKEAYSVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2033.2033.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 888 3799 1 1 1 470.8133 939.6121 2 939.6117 0.0004 0 45.39 2.90E-05 K LLILALER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5137.5137.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 943 3258 1 1 1 479.29 956.5654 2 956.5655 -0.0001 0 44.42 0.00018 K IDLTLLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4570.4570.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 1022 3041 1 1 1 492.2817 982.5488 2 982.5487 0.0001 0 23.03 0.02 K YYVLNALK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4344.4344.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 1056 4221 1 1 1 495.3107 988.6068 2 988.6069 -0.0001 0 40.36 0.00012 K ISLIQIFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5574.5574.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 1165 2964 1 1 1 508.7974 1015.5802 2 1015.5814 -0.0012 0 37.24 0.00093 K ANPALYVLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4264.4264.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 1184 3163 1 1 1 512.2686 1022.5226 2 1022.5219 0.0007 0 37.59 0.0017 K FICISDLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4472.4472.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 1193 2597 1 1 1 512.8292 1023.6438 2 1023.644 -0.0003 1 40.45 9.00E-05 R RALDIPLVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3876.3876.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 1375 2058 1 1 1 355.8769 1064.6088 3 1064.609 -0.0002 0 18.64 0.042 R AISAANLHLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3278.3278.3.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 1455 261 1 1 1 543.2937 1084.5729 2 1084.5737 -0.0009 1 47.11 0.00015 K RQEAIAQNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1288.1288.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 1808 2360 1 1 1 583.2852 1164.5558 2 1164.5564 -0.0006 0 26.37 0.014 K LTPSGYEWGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3613.3613.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 1865 1798 1 1 1 391.8719 1172.594 3 1172.5938 0.0002 0 21.27 0.033 K QTDVGITHFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2988.2988.3.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 2103 1565 1 1 1 608.3274 1214.6402 2 1214.6408 -0.0005 0 33.86 0.00067 K LVVDSHVQYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2728.2728.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 2326 811 1 1 1 631.8195 1261.6245 2 1261.6262 -0.0018 0 51.09 7.20E-05 K EQSQLTATQTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1893.1893.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 3042 2998 1 1 1 701.8522 1401.6899 2 1401.6888 0.0011 0 38.56 0.001 K DGVWNLQNEVTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4299.4299.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 3483 2564 1 1 1 772.9036 1543.7927 2 1543.7954 -0.0027 0 59.75 2.50E-06 K NNVNVASLTQSEIR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3839.3839.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 4009 2183 1 1 1 868.9981 1735.9817 2 1735.9832 -0.0016 1 69.85 1.70E-07 R SLPVEEQPKQIIVTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3417.3417.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 4185 3570 1 1 1 899.4246 1796.8347 2 1796.8369 -0.0023 0 55.02 1.60E-05 R YIQPWESEFIDSQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4899.4899.2.dta 21 1 PRP8_HUMAN Pre-mRNA-processing-splicing factor 8 OS=Homo sapiens GN=PRPF8 PE=1 SV=2 559 274738 28 28 27 27 4693 3045 1 1 1 1009.0215 2016.0284 2 2016.0316 -0.0032 0 78.83 5.90E-08 R AQIAGYLYGVSPPDNPQVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4348.4348.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 81 1386 2 0 1 324.6999 647.3852 2 647.3854 -0.0002 0 24.2 0.023 K SLISTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2532.2532.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 363 2130 1 1 1 393.2476 784.4806 2 784.4807 -0.0001 0 30.45 0.0034 K VAVLEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3358.3358.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 377 551 1 1 1 395.2268 788.4391 2 788.4392 -0.0001 0 29 0.013 K TVQNLSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1604.1604.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 1029 5196 1 1 1 492.7521 983.4897 2 983.4897 0.0001 1 24.04 0.022 R RTHTANER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.727.727.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 1210 1799 1 1 1 514.2947 1026.5748 2 1026.5749 -0.0001 1 19.99 0.042 K KLEYIYAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2989.2989.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 1387 2587 1 1 1 534.8238 1067.633 2 1067.6339 -0.0008 0 36.92 0.00046 K ITLGLLHSSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3865.3865.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 1661 364 1 1 1 566.783 1131.5514 2 1131.552 -0.0006 0 68.18 1.20E-06 K LGNSGASPSSAGK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1398.1398.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 1707 860 1 1 1 572.3213 1142.6281 2 1142.6295 -0.0014 1 35.74 0.0022 K LGDVKVEQQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1947.1947.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 1708 869 1 1 1 381.884 1142.6302 3 1142.6295 0.0006 1 32.91 0.0051 K LGDVKVEQQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1957.1957.3.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 2387 3416 1 1 1 639.3474 1276.6802 2 1276.6816 -0.0014 0 49.69 7.60E-05 K GLPFYAGLSPAGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4737.4737.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 2480 3050 1 1 1 644.3557 1286.6969 2 1286.6983 -0.0014 0 63.14 3.50E-06 R ISNPSAFSIVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4353.4353.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 2683 3804 1 1 1 660.3689 1318.7232 2 1318.7245 -0.0012 0 70.09 6.50E-07 K VGSFIIELASQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5142.5142.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 2743 2403 1 1 1 668.8326 1335.6507 2 1335.6526 -0.0019 0 73.72 1.30E-07 R LGCVCSSLALEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3660.3660.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 2978 3250 1 1 1 694.4005 1386.7865 2 1386.7871 -0.0006 0 46.91 6.20E-05 R VTLGPTQVFLANK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4562.4562.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 2982 1003 1 1 1 694.8348 1387.6551 2 1387.6579 -0.0028 0 58.4 6.70E-06 K VANPSSDADGQSLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2106.2106.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 3397 2708 1 1 1 761.8721 1521.7297 2 1521.7311 -0.0014 0 66.98 5.20E-07 R AFSEIQGLTDQADK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3997.3997.2.dta 22 1 MGAP_HUMAN MAX gene-associated protein OS=Homo sapiens GN=MGA PE=1 SV=3 492 333798 17 17 16 16 5112 3585 1 1 1 1198.5541 2395.0936 2 2395.0962 -0.0026 0 74.58 1.40E-07 K TCQENSDVFQQEQGISDLLGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4914.4914.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 743 1304 1 1 1 451.2348 900.455 2 900.4553 -0.0003 0 45.54 0.0002 K ADIDVSGPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2440.2440.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 1102 771 1 1 1 501.2722 1000.5298 2 1000.5302 -0.0004 0 58.07 1.60E-05 K VGGSGVNVNAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1848.1848.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 2225 2273 1 1 1 620.3139 1238.6133 2 1238.6143 -0.001 0 51.5 5.50E-05 K GEGPDVDVNLPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3517.3517.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 2279 2326 1 1 1 627.3213 1252.6281 2 1252.6299 -0.0018 0 56.08 9.70E-06 K GEGPEVDVNLPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3575.3575.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 2341 2324 1 1 1 634.3294 1266.6443 2 1266.6456 -0.0013 0 58.4 8.30E-06 K AEGPEVDVNLPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3573.3573.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 2751 1746 1 1 1 669.3617 1336.7088 2 1336.7099 -0.0011 1 32.43 0.00091 R RVTAYTVDVTGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2930.2930.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 3687 2935 1 1 1 805.9216 1609.8286 2 1609.8311 -0.0026 0 83.49 3.10E-08 K VNVEAPDVNLEGLGGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4235.4235.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 3743 2847 1 1 1 819.4214 1636.8282 2 1636.8308 -0.0026 0 40.93 0.00059 K VGVEVPDVNIEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4144.4144.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 3750 2385 1 1 1 821.4009 1640.7872 2 1640.7893 -0.0021 0 59.25 2.80E-06 K VDTNAPDLSLEGPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3640.3640.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 3877 2608 1 1 1 849.9231 1697.8316 2 1697.836 -0.0043 0 50.62 1.80E-05 K IDVTAPDVSIEEPEGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3888.3888.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 3910 3118 1 1 1 856.4455 1710.8764 2 1710.8788 -0.0024 0 86.98 7.00E-09 R VDIETPNLEGTLTGPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4425.4425.2.dta 23 1 AHNK_HUMAN Neuroblast differentiation-associated protein AHNAK OS=Homo sapiens GN=AHNAK PE=1 SV=2 482 629213 12 12 12 12 4287 3208 1 1 1 919.486 1836.9574 2 1836.9581 -0.0007 0 69.24 6.00E-07 K VQANLGAPDINIEGLDAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4518.4518.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 325 2 1 1 0 385.6898 769.365 2 769.3653 -0.0004 0 20.03 0.044 K LCANHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1003.1003.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 597 586 1 1 1 428.7057 855.3969 2 855.3974 -0.0005 0 30.01 0.0032 K FGTSETSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1643.1643.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 928 622 1 1 0 317.8626 950.5659 3 950.5661 -0.0002 1 44.26 9.70E-05 R KVEHLAVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1683.1683.3.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 1125 1141 1 1 0 504.2609 1006.5073 2 1006.5083 -0.001 0 31.48 0.0069 K ILQNYDNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2259.2259.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 1748 625 1 1 1 576.798 1151.5814 2 1151.5822 -0.0009 1 40.17 0.00054 K FGTSETSKAPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1686.1686.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 2025 2755 1 1 0 601.3429 1200.6712 2 1200.6714 -0.0002 0 67.32 1.40E-06 K IAVAVLEETTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4048.4048.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 2036 1823 1 1 0 603.2929 1204.5713 2 1204.5724 -0.0011 0 35.81 0.001 K FGISEPGNQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3016.3016.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 2394 1654 1 1 1 641.3156 1280.6166 2 1280.615 0.0016 0 50.68 5.70E-05 K SGSSFVHQASFK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2828.2828.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 2742 2266 1 1 0 668.39 1334.7654 2 1334.767 -0.0017 0 46.8 6.20E-05 R LLVQHEINTLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3509.3509.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 2842 3393 1 1 0 677.3372 1352.6598 2 1352.6612 -0.0015 0 21.41 0.021 K EGFSIPVSADGFK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4714.4714.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 2879 1474 1 1 1 681.853 1361.6915 2 1361.6939 -0.0024 0 63.06 3.60E-06 R YIASVQGSTPSPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2629.2629.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 2906 3564 1 1 0 685.3708 1368.7271 2 1368.7289 -0.0018 0 41.21 0.00054 K NSIPEPIDPLFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4893.4893.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 3044 2158 1 1 1 702.864 1403.7135 2 1403.7144 -0.0009 0 55.73 5.90E-06 K IIDDSDSNLSVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3389.3389.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 3256 3657 1 1 1 734.8398 1467.665 2 1467.6671 -0.0021 0 35.93 0.0011 R FGESTTGFNFSFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4990.4990.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 3363 2820 1 1 1 754.8345 1507.6545 2 1507.6548 -0.0003 0 57.46 4.30E-06 K EGQWDCSVCLVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4116.4116.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 3442 271 1 1 1 512.5839 1534.7299 3 1534.731 -0.0011 1 31.38 0.0051 R LKDAVAHCHEAER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1298.1298.3.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 4129 3644 1 1 0 893.4312 1784.8478 2 1784.8581 -0.0103 0 54.23 8.20E-06 K SGQSALYDALFSSQSPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4977.4977.2.dta 24 1 RBP2_HUMAN E3 SUMO-protein ligase RanBP2 OS=Homo sapiens GN=RANBP2 PE=1 SV=2 469 362365 18 18 18 18 4255 833 1 1 1 912.434 1822.8534 2 1822.8545 -0.0011 0 63.96 2.00E-06 K QNQTTSAVSTPASSETSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1917.1917.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 325 2 1 0 0 385.6898 769.365 2 769.3653 -0.0004 0 20.03 0.044 K LCANHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1003.1003.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 928 622 1 0 0 317.8626 950.5659 3 950.5661 -0.0002 1 44.26 9.70E-05 R KVEHLAVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1683.1683.3.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 1125 1141 1 0 0 504.2609 1006.5073 2 1006.5083 -0.001 0 31.48 0.0069 K ILQNYDNK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2259.2259.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 2025 2755 1 0 0 601.3429 1200.6712 2 1200.6714 -0.0002 0 67.32 1.40E-06 K IAVAVLEETTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4048.4048.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 2036 1823 1 0 0 603.2929 1204.5713 2 1204.5724 -0.0011 0 35.81 0.001 K FGISEPGNQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3016.3016.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 2742 2266 1 0 0 668.39 1334.7654 2 1334.767 -0.0017 0 46.8 6.20E-05 R LLVQHEINTLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3509.3509.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 2842 3393 1 0 0 677.3372 1352.6598 2 1352.6612 -0.0015 0 21.41 0.021 K EGFSIPVSADGFK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4714.4714.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 2906 3564 1 0 0 685.3708 1368.7271 2 1368.7289 -0.0018 0 41.21 0.00054 K NSIPEPIDPLFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4893.4893.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 3044 2158 1 0 1 702.864 1403.7135 2 1403.7144 -0.0009 0 55.73 5.90E-06 K ILDDSDSNLSVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3389.3389.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 3456 3646 1 0 1 769.3909 1536.7672 2 1536.7671 0.0001 0 68.31 3.90E-07 R ELLESFDSALQSAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4979.4979.2.dta 24 2 RGPD3_HUMAN RanBP2-like and GRIP domain-containing protein 3 OS=Homo sapiens GN=RGPD3 PE=4 SV=2 303 198732 11 11 11 11 4129 3644 1 0 0 893.4312 1784.8478 2 1784.8581 -0.0103 0 54.23 8.20E-06 K SGQSALYDALFSSQSPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4977.4977.2.dta 24 RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens GN=RGPD1 PE=2 SV=1 231 198022 8 8 8 8 325 2 1 0 0 385.6898 769.365 2 769.3653 -0.0004 0 20.03 0.044 K LCANHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1003.1003.2.dta 24 RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens GN=RGPD1 PE=2 SV=1 231 198022 8 8 8 8 928 622 1 0 0 317.8626 950.5659 3 950.5661 -0.0002 1 44.26 9.70E-05 R KVEHLAVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1683.1683.3.dta 24 RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens GN=RGPD1 PE=2 SV=1 231 198022 8 8 8 8 1125 1141 1 0 0 504.2609 1006.5073 2 1006.5083 -0.001 0 31.48 0.0069 K ILQNYDNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2259.2259.2.dta 24 RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens GN=RGPD1 PE=2 SV=1 231 198022 8 8 8 8 2025 2755 1 0 0 601.3429 1200.6712 2 1200.6714 -0.0002 0 67.32 1.40E-06 K IAVAVLEETTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4048.4048.2.dta 24 RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens GN=RGPD1 PE=2 SV=1 231 198022 8 8 8 8 2036 1823 1 0 0 603.2929 1204.5713 2 1204.5724 -0.0011 0 35.81 0.001 K FGISEPGNQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3016.3016.2.dta 24 RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens GN=RGPD1 PE=2 SV=1 231 198022 8 8 8 8 2906 3564 1 0 0 685.3708 1368.7271 2 1368.7289 -0.0018 0 41.21 0.00054 K NSIPEPIDPLFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4893.4893.2.dta 24 RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens GN=RGPD1 PE=2 SV=1 231 198022 8 8 8 8 3044 2158 1 0 1 702.864 1403.7135 2 1403.7144 -0.0009 0 55.73 5.90E-06 K IIDDSDSNLSVVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3389.3389.2.dta 24 RGPD1_HUMAN RANBP2-like and GRIP domain-containing protein 1 OS=Homo sapiens GN=RGPD1 PE=2 SV=1 231 198022 8 8 8 8 3456 3646 1 0 1 769.3909 1536.7672 2 1536.7671 0.0001 0 68.31 3.90E-07 R ELLESFDSALQSAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4979.4979.2.dta 24 RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 190 200111 9 9 9 9 325 2 1 0 0 385.6898 769.365 2 769.3653 -0.0004 0 20.03 0.044 K LCANHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1003.1003.2.dta 24 RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 190 200111 9 9 9 9 928 622 1 0 0 317.8626 950.5659 3 950.5661 -0.0002 1 44.26 9.70E-05 R KVEHLAVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1683.1683.3.dta 24 RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 190 200111 9 9 9 9 1125 1141 1 0 0 504.2609 1006.5073 2 1006.5083 -0.001 0 31.48 0.0069 K ILQNYDNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2259.2259.2.dta 24 RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 190 200111 9 9 9 9 2036 1823 1 0 0 603.2929 1204.5713 2 1204.5724 -0.0011 0 35.81 0.001 K FGISEPGNQEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3016.3016.2.dta 24 RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 190 200111 9 9 9 9 2742 2266 1 0 0 668.39 1334.7654 2 1334.767 -0.0017 0 46.8 6.20E-05 R LLVQHEINTLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3509.3509.2.dta 24 RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 190 200111 9 9 9 9 2842 3393 1 0 0 677.3372 1352.6598 2 1352.6612 -0.0015 0 21.41 0.021 K EGFSIPVSADGFK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4714.4714.2.dta 24 RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 190 200111 9 9 9 9 2906 3564 1 0 0 685.3708 1368.7271 2 1368.7289 -0.0018 0 41.21 0.00054 K NSIPEPIDPLFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4893.4893.2.dta 24 RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 190 200111 9 9 9 9 3442 271 1 0 1 512.5839 1534.7299 3 1534.731 -0.0011 1 31.38 0.0051 R LKDAVAHCHEAER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1298.1298.3.dta 24 RGPD5_HUMAN RANBP2-like and GRIP domain-containing protein 5/6 OS=Homo sapiens GN=RGPD5 PE=1 SV=3 190 200111 9 9 9 9 3456 3646 1 0 1 769.3909 1536.7672 2 1536.7671 0.0001 0 68.31 3.90E-07 R ELLESFDSALQSAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4979.4979.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 174 992 1 1 1 344.211 686.4075 2 686.4075 0 0 24.6 0.04 K IQSLAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2094.2094.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 279 3008 4 0 1 374.2288 746.4431 2 746.4439 -0.0008 0 26.32 0.018 K IQAFIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4309.4309.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 280 2254 1 1 1 374.2292 746.4438 2 746.4439 -0.0001 0 21.99 0.035 K IQAFIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3496.3496.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 369 544 2 0 1 394.2552 786.4959 2 786.4963 -0.0004 1 23.51 0.014 K IQTGLKK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1596.1596.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 491 2953 1 1 1 414.271 826.5275 2 826.5276 -0.0001 0 22.89 0.0082 R LIVDVIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4253.4253.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 769 2867 1 1 1 455.2448 908.475 2 908.4756 -0.0006 0 37.94 0.00028 K LGNFFSPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4165.4165.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 892 29 1 1 1 471.2561 940.4977 2 940.4978 -0.0001 1 24.02 0.019 R SHKDEVVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1033.1033.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 1153 5337 1 1 1 508.2529 1014.4912 2 1014.4916 -0.0005 0 41.09 0.00041 K MLQHAASNK M Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.986.986.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 1177 1686 1 1 1 511.2527 1020.4909 2 1020.491 0 0 24.78 0.012 K TCLDNLASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2864.2864.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 1202 2481 1 1 1 513.3085 1024.6024 2 1024.6029 -0.0005 0 40.54 0.00019 R ALQSPALGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3747.3747.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 2163 2532 1 1 1 613.8398 1225.665 2 1225.6667 -0.0016 0 54.68 1.90E-05 K ITLQDVVSHSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3804.3804.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 2210 1606 1 1 1 618.8323 1235.65 2 1235.651 -0.001 0 57.85 1.30E-05 K LQQTYAALNSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2774.2774.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 2518 3798 1 1 1 648.4064 1294.7982 2 1294.7972 0.001 0 63.87 4.30E-07 R LAAVALINAAIQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5136.5136.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 2676 2524 1 1 1 659.8348 1317.6551 2 1317.6565 -0.0014 0 79.71 9.50E-08 R ALESGDVNTVWK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3795.3795.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 3077 3407 1 1 1 708.3976 1414.7806 2 1414.782 -0.0014 0 40.18 0.00048 K LGLAPQIQDLYGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4728.4728.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 3259 1975 1 1 1 490.2752 1467.8037 3 1467.8045 -0.0008 1 29.87 0.0041 K NKITLQDVVSHSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3185.3185.3.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 3284 2585 1 1 1 742.3396 1482.6646 2 1482.6667 -0.0021 0 57.78 5.80E-06 K ATFYGEQVDYYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3863.3863.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 3429 2949 1 1 1 766.8661 1531.7177 2 1531.7195 -0.0017 0 23.56 0.026 K IFYPETTDIYDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4249.4249.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 3473 3651 1 1 1 771.9166 1541.8187 2 1541.8202 -0.0015 0 68 1.10E-06 R EQLWLANEGLITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4984.4984.2.dta 25 1 IQGA1_HUMAN Ras GTPase-activating-like protein IQGAP1 OS=Homo sapiens GN=IQGAP1 PE=1 SV=1 427 189761 20 20 19 19 4905 2618 1 1 1 1083.0092 2164.0038 2 2164.0066 -0.0029 0 21.74 0.027 K QLSSSVTGLTNIEEENCQR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3899.3899.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 321 910 1 1 1 383.2399 764.4652 2 764.4657 -0.0005 0 25.25 0.0045 R ALVAHVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2003.2003.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 1246 3035 1 1 1 518.7838 1035.5531 2 1035.5535 -0.0005 0 52.29 4.10E-05 K LISCLGAFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4337.4337.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 1535 3480 1 1 1 553.3159 1104.6172 2 1104.6179 -0.0007 0 48.65 5.70E-05 R EVIAYILER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4805.4805.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 1687 3929 1 1 1 569.313 1136.6114 2 1136.6117 -0.0003 0 54.61 2.40E-05 K LFDLLYPEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5272.5272.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 1753 2048 1 1 1 577.7951 1153.5757 2 1153.5768 -0.0011 0 42.82 0.00033 R YVLEQPYSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3267.3267.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 2347 3912 1 1 1 634.882 1267.7495 2 1267.75 -0.0005 0 70.82 2.00E-07 K EVGNALLNVVLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5255.5255.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 2359 4317 1 1 1 636.4017 1270.7889 2 1270.7901 -0.0011 0 66.05 2.50E-07 K FLTEVLLPIVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5672.5672.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 3547 3275 1 1 1 782.4216 1562.8286 2 1562.8304 -0.0018 0 64.78 2.00E-06 K SSVALAPALVETYSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4588.4588.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 4013 4200 1 1 1 869.4533 1736.8921 2 1736.892 0.0001 0 56.75 1.20E-05 R NACLLPAYFAVTEIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5551.5551.2.dta 26 1 MED23_HUMAN Mediator of RNA polymerase II transcription subunit 23 OS=Homo sapiens GN=MED23 PE=1 SV=2 402 158254 10 10 10 10 4032 2923 1 1 1 873.9721 1745.9297 2 1745.9312 -0.0015 0 85.76 1.30E-08 R LITALGSSEVQPQFTR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4222.4222.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 358 2651 1 1 0 392.2522 782.4898 2 782.4902 -0.0003 0 30.96 0.0011 R LPALLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3935.3935.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 395 323 1 1 1 399.7269 797.4393 2 797.4395 -0.0002 0 30.38 0.004 K SHSIVQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1355.1355.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 579 2424 1 1 0 424.7656 847.5166 2 847.5167 -0.0002 0 27.59 0.0039 K FLQTIVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3684.3684.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 812 1210 1 1 0 461.2266 920.4387 2 920.4386 0.0001 0 56.91 1.60E-05 K ASVESCIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2336.2336.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 822 3390 1 1 1 462.7501 923.4857 2 923.4865 -0.0008 0 35.22 0.0022 K INDFFLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4710.4710.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 852 89 1 1 0 467.2121 932.4097 2 932.41 -0.0003 0 23.8 0.0094 R HSQQDYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1098.1098.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 884 2302 1 1 0 470.3027 938.5909 2 938.5913 -0.0004 1 22.2 0.006 K RLPALLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3549.3549.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 918 3516 1 1 0 474.2401 946.4657 2 946.4661 -0.0004 0 29.76 0.01 R NLDWFPR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4842.4842.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 1192 3437 1 1 0 512.7823 1023.55 2 1023.5501 -0.0001 0 34.74 0.0015 R YQLNLFAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4759.4759.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 1235 409 1 1 1 345.1854 1032.5344 3 1032.5352 -0.0008 0 16.98 0.05 K LHHAADLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1447.1447.3.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 1345 3371 1 1 0 529.8082 1057.6019 2 1057.6019 0 0 20.48 0.05 R EETLLNVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4689.4689.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 1417 238 1 1 1 537.7855 1073.5564 2 1073.5578 -0.0014 1 24.47 0.042 K GTITQNERR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1263.1263.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 1471 2085 1 1 1 545.2924 1088.5703 2 1088.5714 -0.0011 0 21.07 0.037 R SIGDSVVIGDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3308.3308.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 2293 2857 1 1 0 628.7918 1255.5691 2 1255.5689 0.0001 0 42.33 0.00025 K TTCFICGLER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4155.4155.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 3070 3823 1 1 0 707.8702 1413.7259 2 1413.7286 -0.0027 0 42.78 0.00035 K CNSLLPLDDIVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5162.5162.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 3107 1590 1 1 1 713.3546 1424.6946 2 1424.697 -0.0024 0 38.4 0.00069 R VVTHEDCIPEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2756.2756.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 3186 2790 1 1 0 722.3614 1442.7083 2 1442.7088 -0.0005 0 41.56 0.00014 R FLQLLCENHNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4086.4086.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 3187 2788 1 1 0 481.9101 1442.7085 3 1442.7088 -0.0004 0 20.39 0.049 R FLQLLCENHNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4084.4084.3.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 3691 3242 1 1 1 806.4507 1610.8869 2 1610.8879 -0.001 0 95.35 1.10E-09 K AVLNPTNADILIETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4554.4554.2.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 3830 1719 1 1 1 557.6404 1669.8993 3 1669.8999 -0.0006 0 29.77 0.002 K AAKPGANSTTDAVLLNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2900.2900.3.dta 27 1 ITPR1_HUMAN "Inositol 1,4,5-trisphosphate receptor type 1 OS=Homo sapiens GN=ITPR1 PE=1 SV=3" 402 317151 21 21 20 20 4040 2872 1 1 1 875.4534 1748.8922 2 1748.8945 -0.0023 0 82.13 2.00E-08 K QVQLLVTSQDVDNYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4170.4170.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 358 2651 1 0 0 392.2522 782.4898 2 782.4902 -0.0003 0 30.96 0.0011 R LPALLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3935.3935.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 579 2424 1 0 0 424.7656 847.5166 2 847.5167 -0.0002 0 27.59 0.0039 R FLQTIVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3684.3684.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 812 1210 1 0 0 461.2266 920.4387 2 920.4386 0.0001 0 56.91 1.60E-05 K ASVESCIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2336.2336.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 852 89 1 0 0 467.2121 932.4097 2 932.41 -0.0003 0 23.8 0.0094 R HSQQDYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1098.1098.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 884 2302 1 0 0 470.3027 938.5909 2 938.5913 -0.0004 1 22.2 0.006 K RLPALLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3549.3549.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 918 3516 1 0 0 474.2401 946.4657 2 946.4661 -0.0004 0 29.76 0.01 K NLDWFPR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4842.4842.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 1192 3437 1 0 0 512.7823 1023.55 2 1023.5501 -0.0001 0 34.74 0.0015 R YQLNLFAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4759.4759.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 1345 3371 1 0 0 529.8082 1057.6019 2 1057.6019 0 0 20.48 0.05 R EETLLNVIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4689.4689.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 2293 2857 1 0 0 628.7918 1255.5691 2 1255.5689 0.0001 0 42.33 0.00025 K TTCFICGLER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4155.4155.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 2908 3748 1 0 1 685.8417 1369.6689 2 1369.67 -0.0011 0 23.94 0.0057 K LFENFLVDMAR V Oxidation (M) 0.00000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5085.5085.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 3070 3823 1 0 0 707.8702 1413.7259 2 1413.7286 -0.0027 0 42.78 0.00035 K CNSLLPLDDIVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5162.5162.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 3186 2790 1 0 0 722.3614 1442.7083 2 1442.7088 -0.0005 0 41.56 0.00014 R FLQLLCENHNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4086.4086.2.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 3187 2788 1 0 0 481.9101 1442.7085 3 1442.7088 -0.0004 0 20.39 0.049 R FLQLLCENHNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4084.4084.3.dta 27 2 ITPR2_HUMAN "Inositol 1,4,5-trisphosphate receptor type 2 OS=Homo sapiens GN=ITPR2 PE=1 SV=2" 211 311060 14 14 13 13 3381 3690 2 0 1 758.9213 1515.8281 2 1515.8297 -0.0016 0 26.19 0.014 K EAFAIVSVPLSEVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5025.5025.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 339 2844 1 0 1 388.2449 774.4752 2 774.4752 0 0 34.54 0.00083 K LQVFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4140.4140.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 358 2651 1 0 0 392.2522 782.4898 2 782.4902 -0.0003 0 30.96 0.0011 R LPALLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3935.3935.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 435 470 1 0 1 408.2221 814.4296 2 814.4297 -0.0001 0 43.21 0.00031 R QLAQEAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1514.1514.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 884 2302 1 0 0 470.3027 938.5909 2 938.5913 -0.0004 1 22.2 0.006 K RLPALLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3549.3549.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 918 3516 1 0 0 474.2401 946.4657 2 946.4661 -0.0004 0 29.76 0.01 K NLDWFPR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4842.4842.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 1088 2740 1 0 1 499.8157 997.6169 2 997.6172 -0.0003 0 44.67 4.10E-05 K IADVVLLQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4032.4032.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 2293 2857 1 0 0 628.7918 1255.5691 2 1255.5689 0.0001 0 42.33 0.00025 K TTCFICGLER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4155.4155.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 2744 2946 1 0 1 668.8331 1335.6516 2 1335.6493 0.0023 0 24.89 0.019 R IGEQAEAMFGVGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4246.4246.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 2971 3791 1 0 1 693.4045 1384.7944 2 1384.7966 -0.0022 0 23.53 0.014 R LWTEIPTAITIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5129.5129.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 3186 2790 1 0 0 722.3614 1442.7083 2 1442.7088 -0.0005 0 41.56 0.00014 R FLQLLCENHNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4086.4086.2.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 3187 2788 1 0 0 481.9101 1442.7085 3 1442.7088 -0.0004 0 20.39 0.049 R FLQLLCENHNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4084.4084.3.dta 27 3 ITPR3_HUMAN "Inositol 1,4,5-trisphosphate receptor type 3 OS=Homo sapiens GN=ITPR3 PE=1 SV=2" 210 306820 12 12 11 11 3381 3690 1 0 1 758.9213 1515.8281 2 1515.8297 -0.0016 0 44.69 0.0002 K EAFAIVSVPVSEIR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5025.5025.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 375 1106 1 1 1 394.7349 787.4553 2 787.4552 0.0001 0 37.71 0.0013 R SNVVITR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2220.2220.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 813 482 1 1 1 461.2484 920.4822 2 920.4828 -0.0006 1 23.6 0.026 K LRQDYAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1527.1527.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 826 5280 1 1 1 463.2584 924.5023 2 924.5029 -0.0006 1 37.08 0.00072 K VIHEKDGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.914.914.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 933 1410 1 1 1 477.7484 953.4822 2 953.4818 0.0004 0 24.83 0.013 R STYVTEVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2558.2558.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 1085 842 1 1 1 498.808 995.6015 2 995.6015 0 1 27.02 0.002 K KVEPVPVTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1927.1927.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 1271 94 1 1 1 523.2726 1044.5307 2 1044.5312 -0.0005 1 28.62 0.011 K LRTEQNER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1104.1104.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 1453 2991 1 1 1 542.8215 1083.6285 2 1083.6288 -0.0003 0 44.65 0.00011 K VQELQNLLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4292.4292.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 1654 249 1 1 1 565.3135 1128.6125 2 1128.6139 -0.0013 1 29.95 0.0097 K LQQEEVQKK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1275.1275.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 1911 640 1 1 1 592.3007 1182.5869 2 1182.588 -0.0012 0 31.74 0.0023 K QPTPPSEAAASK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1703.1703.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 2252 2233 1 1 1 622.8453 1243.6761 2 1243.6772 -0.0011 0 56.15 2.00E-05 K AQQSLELIQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3473.3473.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 2377 1228 1 1 1 638.8113 1275.608 2 1275.6095 -0.0015 1 32.77 0.0037 R SVEQEENKWK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2356.2356.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 2916 4242 1 1 1 686.8813 1371.7481 2 1371.7497 -0.0015 0 69.41 7.40E-07 K SVEELLEAELLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5595.5595.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 3049 1610 1 1 1 703.8415 1405.6684 2 1405.6685 -0.0001 0 60.48 5.60E-06 R DAVSNTTNQLESK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2778.2778.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 3260 2101 1 1 1 490.9433 1469.8082 3 1469.8089 -0.0008 1 32.66 0.0032 K ALKEEIGNVQLEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3326.3326.3.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 3261 2099 1 1 1 735.912 1469.8095 2 1469.8089 0.0006 1 59.49 7.10E-06 K ALKEEIGNVQLEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3324.3324.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 3502 552 1 1 1 519.2493 1554.7262 3 1554.7274 -0.0012 0 29.58 0.0017 R TAEHEAAQQDLQSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1605.1605.3.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 3801 1618 1 1 1 552.9609 1655.861 3 1655.8631 -0.0021 1 25.72 0.0039 R IGTLEKEHNVFQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2787.2787.3.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 4257 3104 1 1 1 912.5079 1823.0013 2 1823.004 -0.0027 0 58.92 3.70E-06 R EVIDLLKPDQVEGIQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4410.4410.2.dta 28 1 KTN1_HUMAN Kinectin OS=Homo sapiens GN=KTN1 PE=1 SV=1 400 156464 19 19 17 17 4259 3095 1 1 1 608.675 1823.0033 3 1823.004 -0.0007 0 29.25 0.0034 R EVIDLLKPDQVEGIQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4402.4402.3.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 82 2187 1 1 1 324.7068 647.3991 2 647.4006 -0.0016 0 26.52 0.015 R LIFAGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3422.3422.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 320 2495 2 1 1 383.2198 764.4251 2 764.4255 -0.0004 0 24.78 0.033 - MQIFVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3763.3763.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 350 1738 1 1 1 391.2171 780.4197 2 780.4204 -0.0007 0 28.86 0.01 - MQIFVK T Oxidation (M) 0.100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2922.2922.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 1386 2513 1 1 1 356.545 1066.6133 3 1066.6135 -0.0002 0 21.3 0.026 K ESTLHLVLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3783.3783.3.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 1442 1649 1 1 1 541.2798 1080.5451 2 1080.5451 0 0 37.3 0.0013 R TLSDYNIQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2823.2823.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 3401 1422 1 1 1 762.3929 1522.7712 2 1522.774 -0.0027 1 39.9 0.00018 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2572.2572.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 3402 737 1 1 1 762.3932 1522.7719 2 1522.774 -0.002 1 66.83 5.40E-07 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1810.1810.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 3404 731 1 1 1 508.5982 1522.7728 3 1522.774 -0.0012 1 30.49 0.0057 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1804.1804.3.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4134 4511 1 1 1 894.4645 1786.9144 2 1786.92 -0.0056 0 21.74 0.0098 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5894.5894.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4135 4683 1 1 1 894.4647 1786.9149 2 1786.92 -0.0051 0 19.62 0.019 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6120.6120.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4136 2963 1 1 1 894.4661 1786.9176 2 1786.92 -0.0024 0 70.2 6.50E-07 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4263.4263.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4137 4833 1 1 1 894.4666 1786.9187 2 1786.92 -0.0013 0 20.04 0.013 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6364.6364.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4138 4144 1 1 1 894.4666 1786.9187 2 1786.92 -0.0013 0 40.19 0.00024 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5490.5490.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4139 2976 1 1 1 596.647 1786.9193 3 1786.92 -0.0007 0 35.53 0.00047 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4276.4276.3.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4141 4325 1 1 1 894.467 1786.9194 2 1786.92 -0.0006 0 31.91 0.0013 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5680.5680.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4142 3780 1 1 1 894.4681 1786.9216 2 1786.92 0.0016 0 22.22 0.0093 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5118.5118.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4143 4601 1 1 1 894.4681 1786.9217 2 1786.92 0.0017 0 30.22 0.0046 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6009.6009.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4144 4407 1 1 1 894.4705 1786.9264 2 1786.92 0.0064 0 35.3 0.00064 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5770.5770.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4620 2633 1 1 1 994.032 1986.0494 2 1986.0521 -0.0027 1 75.97 7.50E-08 K TITLEVEPSDTIENVKAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3915.3915.2.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 4621 2630 1 1 1 663.0243 1986.051 3 1986.0521 -0.001 1 41.4 0.00037 K TITLEVEPSDTIENVKAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3912.3912.3.dta 29 1 RS27A_HUMAN Ubiquitin-40S ribosomal protein S27a OS=Homo sapiens GN=RPS27A PE=1 SV=2 400 18296 21 21 8 8 5073 2825 1 1 1 763.4116 2287.213 3 2287.2159 -0.0028 1 34.82 0.0014 K TLTGKTITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4122.4122.3.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 26 184 1 1 0 305.7051 609.3956 2 609.3962 -0.0006 0 19.32 0.019 K KPPLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1205.1205.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 42 83 3 1 1 314.1821 626.3497 2 626.35 -0.0003 0 19.58 0.042 K THLTR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1092.1092.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 368 166 1 1 1 394.2372 786.4598 2 786.4599 -0.0001 1 48.69 0.00018 K IKGDVAGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1185.1185.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 590 5312 1 1 1 427.2028 852.391 2 852.3912 -0.0003 0 25.38 0.016 K HPTCPNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.955.955.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 1454 2140 1 1 1 543.2607 1084.5069 2 1084.5077 -0.0007 0 32.85 0.0021 K FFVEESAEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3369.3369.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 1467 86 1 1 1 544.7776 1087.5406 2 1087.541 -0.0004 0 29.48 0.012 R THTGERPYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1095.1095.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 1518 1001 1 1 1 367.5366 1099.588 3 1099.5887 -0.0006 0 33.03 0.0037 K HVELHVNPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2104.2104.3.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 1770 414 1 1 1 386.5439 1156.6098 3 1156.6101 -0.0003 1 37.49 0.0015 R KNNYVQHVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1453.1453.3.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 2085 1829 1 1 1 607.308 1212.6015 2 1212.6026 -0.0011 1 63.93 2.00E-06 K KFFVEESAEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3023.3023.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 2486 3553 1 1 1 644.7758 1287.5371 2 1287.5377 -0.0006 0 36.45 0.00023 K GDFVCIFCDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4882.4882.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 2845 93 1 1 1 451.9171 1352.7295 3 1352.73 -0.0004 1 31.21 0.0047 K SSKPPQKEPVEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1103.1103.3.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 2862 1447 1 1 1 679.7882 1357.5619 2 1357.5642 -0.0024 0 42.23 6.00E-05 K CELCPYSSSQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2599.2599.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 2863 1926 1 1 1 679.8243 1357.634 2 1357.6361 -0.0021 0 21.15 0.038 R EADLPDNITNEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3130.3130.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 3475 1769 1 1 1 771.9325 1541.8504 2 1541.8526 -0.0021 0 58.38 3.40E-06 K KPSNNVSVIQVTTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2956.2956.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 3476 1759 1 1 1 514.9579 1541.852 3 1541.8526 -0.0005 0 27.47 0.0075 K KPSNNVSVIQVTTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2945.2945.3.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 3526 2024 1 1 1 780.3336 1558.6526 2 1558.6544 -0.0019 0 63.19 6.50E-07 R QFNCPVCDYAASK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3239.3239.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 4191 1545 1 1 1 600.67 1798.9883 3 1798.9901 -0.0018 1 19.04 0.041 K EKKPSNNVSVIQVTTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2707.2707.3.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 4345 3395 1 1 1 931.9488 1861.883 2 1861.8846 -0.0016 0 91.57 3.60E-09 R HLVNVYYLEEAAQGQE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4716.4716.2.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 4933 2184 1 1 1 730.0241 2187.0505 3 2187.0542 -0.0038 1 24.67 0.021 R EADLPDNITNEKTEIEQTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3418.3418.3.dta 30 1 REST_HUMAN RE1-silencing transcription factor OS=Homo sapiens GN=REST PE=1 SV=3 398 123164 20 20 19 19 5080 1438 1 1 1 577.7809 2307.0947 4 2307.0979 -0.0032 1 25.96 0.012 R KLEVDSHSLHGPVNDEESSTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2589.2589.4.dta 30 Z705A_HUMAN Zinc finger protein 705A OS=Homo sapiens GN=ZNF705A PE=2 SV=1 29 35567 1 1 1 1 1467 86 1 0 1 544.7776 1087.5406 2 1087.541 -0.0004 0 29.48 0.012 K THTGERPYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1095.1095.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 42 83 4 0 1 314.1821 626.3497 2 626.35 -0.0003 0 18.94 0.049 R HTLTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1092.1092.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 1264 636 1 1 1 522.2823 1042.55 2 1042.5519 -0.0019 1 25.11 0.032 R LRQDLQDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1698.1698.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 1889 2322 1 1 1 589.3195 1176.6245 2 1176.6251 -0.0006 0 30.84 0.0013 R NIAIQSQFTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3570.3570.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 1925 2129 1 1 1 593.8244 1185.6343 2 1185.6353 -0.0011 0 35.8 0.00044 R IQQLTEEIGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3357.3357.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 2369 2435 1 1 1 637.8325 1273.6504 2 1273.6514 -0.001 0 65.2 2.90E-06 K SLESQVENLQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3696.3696.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 2374 705 1 1 1 638.3172 1274.6198 2 1274.6215 -0.0016 0 50.17 6.70E-05 R ASTALSNEQQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1775.1775.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 2666 2605 1 1 1 657.8707 1313.7269 2 1313.7303 -0.0034 1 34.49 0.0015 R NLDVQLLDTKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3885.3885.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 3024 1392 1 1 1 700.3494 1398.6843 2 1398.6851 -0.0008 0 74.49 2.20E-07 R NIEELQQQNQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2538.2538.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 3638 799 1 1 1 531.9165 1592.7277 3 1592.7278 -0.0001 1 20.62 0.046 K SAADDSEAKSNELTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1879.1879.3.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 4084 2945 1 1 1 886.9598 1771.9051 2 1771.9064 -0.0013 0 112.53 3.50E-11 R NLQEQTVQLQSELSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4245.4245.2.dta 31 1 TPR_HUMAN Nucleoprotein TPR OS=Homo sapiens GN=TPR PE=1 SV=3 352 267530 11 11 11 11 5209 2866 1 1 1 899.1418 2694.4037 3 2694.4076 -0.0039 0 75.71 9.10E-08 K RPSTSQTVSTPAPVPVIESTEAIEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4164.4164.3.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 337 1678 1 1 1 387.2293 772.444 2 772.4443 -0.0003 0 32.91 0.0034 R AALLTER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2855.2855.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 482 183 1 1 1 413.2269 824.4392 2 824.4392 0 1 26.84 0.0086 R KSNVSYK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1204.1204.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 1086 1602 1 1 1 499.739 997.4635 2 997.4651 -0.0016 0 20.99 0.045 K SYCSNLVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2769.2769.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 2099 1698 1 1 1 608.3138 1214.6131 2 1214.6142 -0.0011 0 60.31 2.80E-06 K ELAAQLNEEAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2877.2877.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 2850 2966 1 1 1 677.8311 1353.6477 2 1353.6499 -0.0023 0 51.28 1.60E-05 R INFYCPGSALGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4266.4266.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 2912 1499 1 1 1 686.3633 1370.712 2 1370.7153 -0.0033 1 42.77 0.0004 K ELAAQLNEEAKR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2657.2657.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 2998 2434 1 1 1 696.3794 1390.7442 2 1390.7456 -0.0014 1 31.75 0.0011 R GDKVDILYNNIK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3695.3695.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 3106 2658 1 1 1 713.3538 1424.693 2 1424.6936 -0.0006 0 79.7 8.40E-08 K YTEGVQSLNWTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3943.3943.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 3122 520 1 1 1 715.3851 1428.7557 2 1428.7572 -0.0015 1 55.66 2.10E-05 R LTEQKGEQQIQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1569.1569.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 3719 3720 1 1 1 812.4437 1622.8729 2 1622.874 -0.0011 0 77.75 7.10E-08 K GNENANGAPAITLLIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5056.5056.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 3837 3413 1 1 1 838.9167 1675.8189 2 1675.8206 -0.0016 0 17.75 0.034 R NEGNIFPNPEATFVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4734.4734.2.dta 32 1 SP16H_HUMAN FACT complex subunit SPT16 OS=Homo sapiens GN=SUPT16H PE=1 SV=1 351 120409 12 12 12 12 4263 3547 1 1 1 913.4808 1824.947 2 1824.9482 -0.0012 0 56.65 5.50E-06 K APGEQTVPALNLQNAFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4875.4875.2.dta 33 1 SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 313 136575 8 8 8 8 166 1940 1 1 1 343.2336 684.4526 2 684.4534 -0.0008 0 30.1 0.0036 R VLIGVGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3146.3146.2.dta 33 1 SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 313 136575 8 8 8 8 698 2745 1 1 1 445.7764 889.5382 2 889.5385 -0.0003 0 31.96 0.0013 K LVYILNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4037.4037.2.dta 33 1 SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 313 136575 8 8 8 8 1824 1970 1 1 1 584.2852 1166.5558 2 1166.5568 -0.001 0 45.85 6.20E-05 K DYIVVGSDSGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3179.3179.2.dta 33 1 SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 313 136575 8 8 8 8 1953 2600 1 1 1 596.3055 1190.5964 2 1190.5972 -0.0008 0 59.27 1.20E-05 R SVAGGFVYTYK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3879.3879.2.dta 33 1 SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 313 136575 8 8 8 8 2588 3422 1 1 1 652.3715 1302.7284 2 1302.7296 -0.0012 0 63.76 2.20E-06 R FLAVGLVDNTVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4743.4743.2.dta 33 1 SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 313 136575 8 8 8 8 3300 2693 1 1 1 744.8799 1487.7452 2 1487.7468 -0.0016 0 80.66 2.70E-08 R TVLDPVTGDLSDTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3982.3982.2.dta 33 1 SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 313 136575 8 8 8 8 3847 3154 1 1 1 841.4482 1680.8819 2 1680.8835 -0.0016 0 63.93 1.70E-06 K TPVEEVPAAIAPFQGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4462.4462.2.dta 33 1 SF3B3_HUMAN Splicing factor 3B subunit 3 OS=Homo sapiens GN=SF3B3 PE=1 SV=4 313 136575 8 8 8 8 4218 3710 1 1 1 904.9439 1807.8733 2 1807.8741 -0.0008 0 68.01 8.80E-07 R NENQLIIFADDTYPR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5045.5045.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 330 1339 1 1 0 386.7194 771.4242 2 771.4239 0.0003 0 26.63 0.02 R QLLNER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2479.2479.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 390 777 1 1 1 397.7352 793.4558 2 793.4559 -0.0001 0 18.95 0.036 K HNVIVGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1855.1855.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 803 329 1 1 1 458.7455 915.4765 2 915.4774 -0.0008 0 45.93 0.00024 R LAQATQER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1360.1360.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 1799 1959 1 1 1 388.5562 1162.6468 3 1162.6458 0.001 0 26 0.0094 R LALLHEGTGPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3167.3167.3.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 1832 492 1 1 1 584.7823 1167.55 2 1167.552 -0.002 1 40.53 0.0005 R GSQFTSKEER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1538.1538.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 1862 1845 1 1 1 587.2799 1172.5453 2 1172.5462 -0.0009 0 42.59 0.00025 R GALTGGYYDTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3040.3040.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 2234 2721 1 1 1 620.8497 1239.6849 2 1239.6863 -0.0014 1 41.64 0.00027 R KYEAIQLTFK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4010.4010.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 3266 2195 1 1 1 737.8399 1473.6653 2 1473.6695 -0.0043 0 39.39 0.0005 K DLQDELAGNSEQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3430.3430.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 3777 2563 1 1 1 826.912 1651.8095 2 1651.8094 0.0002 0 73.5 3.60E-07 R LFYHIVDSDEVSTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3838.3838.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 3852 2761 1 1 1 841.9218 1681.829 2 1681.8311 -0.0022 1 40.02 0.00019 K ALDQFVNFSEQKEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4055.4055.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 4332 2879 1 1 1 928.9536 1855.8926 2 1855.8952 -0.0026 0 82.78 1.90E-08 R ALEYTIYNQELNETR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4178.4178.2.dta 34 1 SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 309 141853 12 12 12 12 4531 3024 1 1 1 982.9861 1963.9577 2 1963.96 -0.0022 0 36.97 0.00034 R GSGSQSSVPSVDQFTGVGIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4326.4326.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 315 3000 1 1 1 381.7288 761.443 2 761.4436 -0.0005 0 33.07 0.0029 R VFLLDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4300.4300.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 333 748 1 1 1 387.1952 772.3759 2 772.3755 0.0003 0 24.79 0.021 R FTSYQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1823.1823.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 444 812 1 1 1 409.2243 816.4341 2 816.4341 0 0 32.87 0.006 K SVLADQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1894.1894.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 677 497 1 1 1 438.7198 875.4251 2 875.425 0.0002 0 40.87 0.00067 K SFATASHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1544.1544.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 913 558 1 1 1 473.2716 944.5287 2 944.5291 -0.0004 1 32.97 0.0041 R KSVLADQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1612.1612.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 985 819 1 1 1 484.2694 966.5243 2 966.5247 -0.0003 0 38.38 0.00078 K TIAPQNAPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1902.1902.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 1127 787 1 1 1 504.7426 1007.4706 2 1007.4706 0 0 53.09 2.80E-05 K SAAMTLNER F Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1866.1866.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 1829 2390 1 1 1 584.358 1166.7014 2 1166.7023 -0.0009 0 61.27 7.80E-07 R LLASTLVHSVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3646.3646.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 1830 2391 1 1 1 389.9078 1166.7016 3 1166.7023 -0.0007 0 22.73 0.0056 R LLASTLVHSVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3647.3647.3.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 2067 1008 1 1 1 605.8005 1209.5865 2 1209.5877 -0.0012 1 39.22 0.00073 R NTEEEGLKYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2112.2112.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 3218 637 1 1 1 727.8694 1453.7243 2 1453.7273 -0.003 1 18.2 0.02 K TIAPQNAPRDESR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1699.1699.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 3345 1674 1 1 1 751.325 1500.6355 2 1500.6369 -0.0014 0 57.68 3.40E-06 R SSFYPDGGDQETAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2850.2850.2.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 3724 3092 1 1 1 542.9421 1625.8044 3 1625.8049 -0.0005 1 40.57 0.00046 R FTDEESRVFLLDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4399.4399.3.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 3895 1209 1 1 1 569.9801 1706.9185 3 1706.9203 -0.0018 1 33.48 0.001 K LKETGYVVERPSTTK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2335.2335.3.dta 35 1 BCLF1_HUMAN Bcl-2-associated transcription factor 1 OS=Homo sapiens GN=BCLAF1 PE=1 SV=2 290 106173 15 15 14 14 4265 1762 1 1 1 609.9799 1826.9177 3 1826.9196 -0.0019 0 16.08 0.047 K MAPVPLDDSNRPASLTK D Oxidation (M) 0.10000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2948.2948.3.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 825 1770 1 1 1 462.7789 923.5433 2 923.544 -0.0007 0 28.34 0.0023 R HLEAILTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2957.2957.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 1183 1888 1 1 1 511.7796 1021.5447 2 1021.5444 0.0003 0 27.14 0.0056 K TVLAAAYGEK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3088.3088.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 1557 2665 1 1 1 554.8271 1107.6396 2 1107.64 -0.0004 0 42.96 0.00018 R GLVGNPLPSVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3950.3950.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 1961 1068 1 1 1 596.8011 1191.5876 2 1191.5884 -0.0008 1 45.85 0.00021 R LGGEEKFQER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2178.2178.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 2200 3736 1 1 1 617.3209 1232.6273 2 1232.6289 -0.0016 0 39.19 0.001 R DEVASLLFDPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5073.5073.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 2217 4216 1 1 1 618.8865 1235.7585 2 1235.7601 -0.0016 0 30.41 0.00091 K LVPDLLAIVQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5569.5569.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 2345 3884 1 1 1 634.8215 1267.6285 2 1267.6305 -0.0019 0 52.07 2.50E-05 R MLFDLLVNCK N Oxidation (M) 0.1000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5226.5226.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 3102 2356 1 1 1 712.8603 1423.706 2 1423.7096 -0.0035 0 46.25 4.60E-05 K VFAEYPGSSAQLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3608.3608.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 3183 2828 1 1 1 721.8613 1441.708 2 1441.7089 -0.0009 0 77.41 1.30E-07 R LDDTYSFQVINK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4125.4125.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 3470 4406 1 1 1 771.4557 1540.8969 2 1540.8977 -0.0007 0 43.86 6.00E-05 K VSLLNEQFLPLIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5769.5769.2.dta 36 1 HEAT1_HUMAN HEAT repeat-containing protein 1 OS=Homo sapiens GN=HEATR1 PE=1 SV=3 281 244382 11 11 11 11 3814 3282 1 1 1 554.9616 1661.863 3 1661.8624 0.0006 1 17.81 0.021 K EGVDESFIKEAVLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4596.4596.3.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 619 763 1 1 1 429.7557 857.4968 2 857.4971 -0.0003 1 24.11 0.044 R LKDEVVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1839.1839.2.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 1021 1254 1 1 1 492.258 982.5014 2 982.5018 -0.0004 0 25.79 0.015 R HNLLQACK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2385.2385.2.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 1121 2984 1 1 1 503.2842 1004.5538 2 1004.5542 -0.0004 0 35.54 0.0015 K LIEIENFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4285.4285.2.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 1371 3020 1 1 1 533.2822 1064.5498 2 1064.5502 -0.0004 0 57.36 1.20E-05 R TALFEEISR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4322.4322.2.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 1374 1904 1 1 1 533.3065 1064.5985 2 1064.5978 0.0007 0 28.88 0.0058 R HLALNLQEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3106.3106.2.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 1964 3100 1 1 1 596.8322 1191.6498 2 1191.6499 -0.0002 0 36.14 0.0016 K TVALDGTLFQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4407.4407.2.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 2089 1507 1 1 1 607.8273 1213.6401 2 1213.6415 -0.0014 0 61.5 4.80E-06 K LNEQQSVLQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2666.2666.2.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 2102 2225 1 1 1 608.3231 1214.6316 2 1214.6329 -0.0013 0 35.83 0.0023 R LIDLCQPTQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3464.3464.2.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 2515 1132 1 1 1 648.3145 1294.6144 2 1294.6153 -0.001 1 31.84 0.0037 R SGELAQEYDKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2249.2249.2.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 3377 1498 1 1 1 505.9503 1514.8292 3 1514.8317 -0.0025 0 26.96 0.0076 R DLIHGAPVGKPAANR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2656.2656.3.dta 37 1 SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 262 143771 11 11 11 11 4915 3274 1 1 1 1088.53 2175.0455 2 2175.0484 -0.0029 1 102.02 2.70E-10 K VLTFDLTKYPDANPNPNEQ - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4587.4587.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 1015 3211 1 1 1 491.3083 980.602 2 980.6018 0.0001 0 50.03 9.90E-06 R IPQLLLER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4520.4520.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 1038 3288 1 1 1 493.2928 984.571 2 984.5716 -0.0007 0 35.93 0.0017 K NLLNSVIGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4603.4603.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 1652 3355 1 1 1 565.3032 1128.5918 2 1128.5927 -0.001 0 42.75 0.00047 R AVAGWEEVLR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4673.4673.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 2009 3006 1 1 1 599.837 1197.6595 2 1197.6605 -0.001 0 36.5 0.0012 R LQSDDILPLGK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4307.4307.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 2043 1536 1 1 1 603.3406 1204.6667 2 1204.6663 0.0004 0 46.58 8.40E-05 K VIQIATSSSTAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2697.2697.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 2078 2517 1 1 1 606.3478 1210.6811 2 1210.6823 -0.0011 0 22.22 0.027 K AIFQQPPVGVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3787.3787.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 2152 3321 1 1 1 613.3601 1224.7057 2 1224.7078 -0.0021 0 51.77 2.20E-05 R TPLENLVLQAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4637.4637.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 2502 3192 1 1 1 645.8478 1289.6811 2 1289.6827 -0.0016 0 38.01 0.0007 R ATISLSDSDLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4500.4500.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 2739 3129 1 1 1 668.3385 1334.6625 2 1334.6653 -0.0028 0 58.68 9.70E-06 K VSCLETVWVSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4436.4436.2.dta 38 1 DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 257 134938 10 10 10 10 4256 3875 1 1 1 912.4612 1822.9078 2 1822.9101 -0.0023 0 45.07 0.00015 R ENYLEENLLYAPSLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5217.5217.2.dta 39 1 RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens GN=RIF1 PE=1 SV=2 252 276461 6 6 6 6 208 822 1 1 0 352.2028 702.391 2 702.3912 -0.0002 0 26.3 0.041 K LNDTIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1905.1905.2.dta 39 1 RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens GN=RIF1 PE=1 SV=2 252 276461 6 6 6 6 2267 2915 1 1 1 624.8372 1247.6599 2 1247.6609 -0.001 0 49.69 2.20E-05 K IGISDISSLSEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4214.4214.2.dta 39 1 RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens GN=RIF1 PE=1 SV=2 252 276461 6 6 6 6 3203 3157 1 1 1 724.8954 1447.7763 2 1447.777 -0.0006 0 72.28 1.70E-07 K TIGDLSTLTASEIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4465.4465.2.dta 39 1 RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens GN=RIF1 PE=1 SV=2 252 276461 6 6 6 6 3928 3787 1 1 1 859.4633 1716.912 2 1716.9145 -0.0025 0 90.83 4.70E-09 K ITSELSEANALELLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5125.5125.2.dta 39 1 RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens GN=RIF1 PE=1 SV=2 252 276461 6 6 6 6 4253 4312 1 1 1 911.5315 1821.0484 2 1821.0499 -0.0015 0 68.19 1.70E-07 R LVSDIIDPVALEIPLSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5668.5668.2.dta 39 1 RIF1_HUMAN Telomere-associated protein RIF1 OS=Homo sapiens GN=RIF1 PE=1 SV=2 252 276461 6 6 6 6 4401 4179 1 1 1 945.985 1889.9554 2 1889.9557 -0.0003 0 32.82 0.00084 K SLIDNFALNPDILCSAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5528.5528.2.dta 40 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 247 91269 8 8 8 8 219 614 1 1 1 356.1872 710.3598 2 710.3599 -0.0001 0 20.44 0.038 R ASYGVSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1674.1674.2.dta 40 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 247 91269 8 8 8 8 334 560 1 1 1 387.2023 772.3901 2 772.3902 -0.0001 0 28.5 0.01 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1614.1614.2.dta 40 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 247 91269 8 8 8 8 454 2292 1 1 1 410.2395 818.4645 2 818.465 -0.0005 0 45.57 0.00014 K FIEIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3538.3538.2.dta 40 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 247 91269 8 8 8 8 896 1086 1 1 1 471.2925 940.5705 2 940.5706 -0.0001 1 31.29 0.0017 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2198.2198.2.dta 40 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 247 91269 8 8 8 8 1712 3143 1 1 1 573.2648 1144.515 2 1144.5158 -0.0008 0 43.87 0.00013 K MCLFAGFQR K Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4450.4450.2.dta 40 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 247 91269 8 8 8 8 3769 2793 1 1 1 824.425 1646.8354 2 1646.8376 -0.0022 0 105.77 2.60E-10 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4089.4089.2.dta 40 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 247 91269 8 8 8 8 3874 2736 1 1 1 849.3927 1696.7708 2 1696.7733 -0.0024 1 51.21 2.60E-05 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4027.4027.2.dta 40 1 HNRPU_HUMAN Heterogeneous nuclear ribonucleoprotein U OS=Homo sapiens GN=HNRNPU PE=1 SV=6 247 91269 8 8 8 8 3921 3506 1 1 1 857.9581 1713.9016 2 1713.905 -0.0034 0 52.27 2.30E-05 K SSGPTSLFAVTVAPPGAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4830.4830.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 492 3155 1 1 1 414.2711 826.5277 2 826.5276 0.0001 0 29.89 0.0016 R LLAEILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4463.4463.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 703 3555 1 1 1 446.7661 891.5176 2 891.5178 -0.0002 0 32.04 0.0027 R SSLLLGFR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4884.4884.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 782 950 1 1 1 456.2053 910.396 2 910.3967 -0.0007 0 31.06 0.0021 K VFNDTCR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2047.2047.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 1187 3088 1 1 1 512.7368 1023.4591 2 1023.4596 -0.0006 0 19.47 0.048 R LQWFCDR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4395.4395.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 1208 1627 1 1 1 513.8188 1025.623 2 1025.6233 -0.0003 1 20.58 0.012 K KIIETPGIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2798.2798.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 1211 2956 1 1 1 514.3104 1026.6063 2 1026.6073 -0.001 0 34.92 0.0013 K LQDAINILK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4256.4256.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 1569 3354 1 1 1 556.2921 1110.5697 2 1110.5709 -0.0013 0 48.71 7.50E-05 K GAYDIFLNAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4672.4672.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 2364 1097 1 1 1 636.8303 1271.6461 2 1271.647 -0.0009 0 68.38 1.20E-06 K TVLDQQQTPSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2210.2210.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 2654 1071 1 1 1 657.3318 1312.649 2 1312.651 -0.002 1 57.13 4.40E-06 K SYVSEKDVTSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2182.2182.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 2952 2062 1 1 1 692.3702 1382.7258 2 1382.7293 -0.0035 0 41.15 0.00045 K VIEEQLEPAVEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3283.3283.2.dta 41 1 LPPRC_HUMAN "Leucine-rich PPR motif-containing protein, mitochondrial OS=Homo sapiens GN=LRPPRC PE=1 SV=3" 245 159003 11 11 11 11 3335 3558 1 1 1 748.8845 1495.7544 2 1495.7558 -0.0015 0 44.23 0.00024 K AGYPQYVSEILEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4887.4887.2.dta 42 1 DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 243 334021 9 9 9 9 179 1022 1 0 0 344.7031 687.3916 2 687.3915 0.0001 0 24.78 0.047 K LLSAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2127.2127.2.dta 42 1 DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 243 334021 9 9 9 9 1409 861 1 1 1 537.2826 1072.5506 2 1072.5513 -0.0006 0 68.31 1.50E-06 R GAGSIAGASASPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1948.1948.2.dta 42 1 DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 243 334021 9 9 9 9 1653 2905 1 1 1 565.3082 1128.6018 2 1128.6026 -0.0008 0 46.68 0.00017 K IEVLEEELR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4204.4204.2.dta 42 1 DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 243 334021 9 9 9 9 2282 3264 1 1 1 627.8033 1253.5921 2 1253.5928 -0.0007 0 45.91 9.80E-05 K AITGFDDPFSGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4577.4577.2.dta 42 1 DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 243 334021 9 9 9 9 2344 718 1 1 1 634.8002 1267.5858 2 1267.5867 -0.0009 1 22.64 0.023 R ALCDYKQDQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1789.1789.2.dta 42 1 DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 243 334021 9 9 9 9 2358 2429 1 1 1 636.3559 1270.6972 2 1270.6993 -0.0021 0 42.62 0.00028 R QLQNIIQATSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3689.3689.2.dta 42 1 DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 243 334021 9 9 9 9 2362 582 1 1 1 636.8299 1271.6452 2 1271.647 -0.0017 1 41.49 0.00057 R RVEEDIQQQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1638.1638.2.dta 42 1 DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 243 334021 9 9 9 9 3462 3177 1 1 1 769.9429 1537.8712 2 1537.8715 -0.0003 0 79.51 2.60E-08 R LLEAQIATGGIIDPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4486.4486.2.dta 42 1 DESP_HUMAN Desmoplakin OS=Homo sapiens GN=DSP PE=1 SV=3 243 334021 9 9 9 9 3665 3854 1 1 1 802.4191 1602.8236 2 1602.8253 -0.0017 0 34.45 0.0027 K SVEEVASEIQPFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5194.5194.2.dta 43 1 AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 241 114135 4 4 4 4 268 1491 1 1 1 372.2239 742.4332 2 742.4337 -0.0005 0 55.49 2.50E-05 R AAEILAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2648.2648.2.dta 43 1 AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 241 114135 4 4 4 4 3392 2560 1 1 1 760.3544 1518.6943 2 1518.695 -0.0007 0 68.02 5.80E-07 R SPDFTNENPLETR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3835.3835.2.dta 43 1 AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 241 114135 4 4 4 4 3603 3256 1 1 1 792.9399 1583.8652 2 1583.8671 -0.0019 0 82.18 2.60E-08 R AVFQANQENLPILK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4568.4568.2.dta 43 1 AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 241 114135 4 4 4 4 4274 3121 1 1 1 915.4659 1828.9173 2 1828.9167 0.0007 0 94.98 2.10E-09 K GVGIISEGNETVEDIAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4428.4428.2.dta 43 AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 95 113505 1 1 1 1 4274 3121 1 0 1 915.4659 1828.9173 2 1828.9167 0.0007 0 94.98 2.10E-09 K GVGIISEGNETVEDIAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4428.4428.2.dta 43 AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 55 116292 1 1 1 1 268 1491 1 0 1 372.2239 742.4332 2 742.4337 -0.0005 0 55.49 2.50E-05 R AAELLAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2648.2648.2.dta 44 1 NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 228 156697 6 6 6 6 565 1765 4 0 1 422.2377 842.4609 2 842.461 -0.0001 0 32.24 0.0054 K ANELLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2952.2952.2.dta 44 1 NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 228 156697 6 6 6 6 2343 3966 1 1 1 634.35 1266.6854 2 1266.686 -0.0006 0 50.23 4.70E-05 R LLEVYDQLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5309.5309.2.dta 44 1 NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 228 156697 6 6 6 6 3771 3757 1 1 1 824.9131 1647.8117 2 1647.8138 -0.002 0 72.23 5.00E-07 K CITDTLQELVNQSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5095.5095.2.dta 44 1 NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 228 156697 6 6 6 6 3942 2076 1 1 1 575.2915 1722.8527 3 1722.8537 -0.001 0 32.95 0.0023 R HLLVSNVGGDGEEIER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3298.3298.3.dta 44 1 NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 228 156697 6 6 6 6 3966 2883 1 1 1 864.4722 1726.9299 2 1726.9326 -0.0027 0 72.7 1.50E-07 R VASVSQNAIVSAAGNIAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4182.4182.2.dta 44 1 NU155_HUMAN Nuclear pore complex protein Nup155 OS=Homo sapiens GN=NUP155 PE=1 SV=1 228 156697 6 6 6 6 4076 2392 1 1 1 883.9274 1765.8402 2 1765.8417 -0.0015 0 63.82 1.00E-06 K ISNQVDLSNVCAQYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3648.3648.2.dta 45 1 PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens GN=NUP210 PE=1 SV=3 227 205895 5 5 4 4 1500 3070 1 1 1 548.3293 1094.6441 2 1094.6448 -0.0006 0 53.1 1.10E-05 R VGQALELPLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4375.4375.2.dta 45 1 PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens GN=NUP210 PE=1 SV=3 227 205895 5 5 4 4 3197 2613 1 1 1 724.3795 1446.7445 2 1446.7467 -0.0022 0 72.23 5.10E-07 K AVDPTSGQLYGLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3894.3894.2.dta 45 1 PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens GN=NUP210 PE=1 SV=3 227 205895 5 5 4 4 3202 3605 1 1 1 724.8793 1447.744 2 1447.7446 -0.0006 0 59.4 9.40E-06 R ELYLEDSPLELK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4935.4935.2.dta 45 1 PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens GN=NUP210 PE=1 SV=3 227 205895 5 5 4 4 3479 3914 1 1 1 772.4203 1542.8261 2 1542.8293 -0.0032 0 89.02 8.10E-09 R VFGAPEVLENLEVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5257.5257.2.dta 45 1 PO210_HUMAN Nuclear pore membrane glycoprotein 210 OS=Homo sapiens GN=NUP210 PE=1 SV=3 227 205895 5 5 4 4 3480 3946 1 1 1 772.4204 1542.8263 2 1542.8293 -0.0031 0 31.55 0.0019 R VFGAPEVLENLEVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5289.5289.2.dta 46 1 SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 223 133196 4 4 4 4 821 704 1 1 1 462.7484 923.4822 2 923.4825 -0.0002 0 26.76 0.014 K HLAAVEER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1774.1774.2.dta 46 1 SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 223 133196 4 4 4 4 2810 3820 1 1 1 674.3809 1346.7473 2 1346.7479 -0.0006 0 47.01 9.80E-05 K SLVALLVETQMK K Oxidation (M) 0.000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5159.5159.2.dta 46 1 SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 223 133196 4 4 4 4 4179 2757 1 1 1 896.4125 1790.8104 2 1790.8111 -0.0007 0 88.78 5.30E-09 K YYEAADTVTQFDNVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4050.4050.2.dta 46 1 SMRC2_HUMAN SWI/SNF complex subunit SMARCC2 OS=Homo sapiens GN=SMARCC2 PE=1 SV=1 223 133196 4 4 4 4 4387 3950 1 1 1 943.0034 1883.9922 2 1883.9952 -0.003 0 120.05 5.30E-12 R DIGEGNLSTAAAAALAAAAVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5293.5293.2.dta 46 SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 62 123303 3 3 3 3 87 1108 1 0 1 326.1765 650.3385 2 650.3387 -0.0002 0 29.26 0.011 K YAELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2223.2223.2.dta 46 SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 62 123303 3 3 3 3 821 704 1 0 1 462.7484 923.4822 2 923.4825 -0.0002 0 26.76 0.014 K HLAAVEER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1774.1774.2.dta 46 SMRC1_HUMAN SWI/SNF complex subunit SMARCC1 OS=Homo sapiens GN=SMARCC1 PE=1 SV=3 62 123303 3 3 3 3 2810 3820 1 0 1 674.3809 1346.7473 2 1346.7479 -0.0006 0 47.01 9.80E-05 K SLVALLVETQMK K Oxidation (M) 0.000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5159.5159.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 165 2139 1 1 1 342.736 683.4574 2 683.4581 -0.0008 0 16.14 0.024 R LTPILK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3368.3368.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 588 872 1 1 1 426.7142 851.4139 2 851.4137 0.0002 0 45.65 0.00024 R GAEYVSAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1960.1960.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 797 1838 1 1 1 458.2665 914.5185 2 914.5185 0 0 70.14 1.00E-06 K VGAAEIISR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3033.3033.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 1044 3936 1 1 1 493.8069 985.5992 2 985.5994 -0.0002 0 37.17 0.00088 R EVMLILIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5279.5279.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 1100 1640 1 1 1 501.272 1000.5294 2 1000.5301 -0.0007 0 37.3 0.0019 R QQAADLISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2813.2813.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 1466 350 1 1 1 544.7646 1087.5146 2 1087.5146 0.0001 0 38.8 0.00033 K GSETPGATPGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1384.1384.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 1484 3910 1 1 1 546.3105 1090.6065 2 1090.6063 0.0003 0 23.08 0.037 K TEILPPFFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5253.5253.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 2296 1425 1 1 1 628.8555 1255.6964 2 1255.6997 -0.0033 1 18.64 0.019 K VRQQAADLISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2575.2575.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 2476 185 1 1 1 644.33 1286.6455 2 1286.6466 -0.0012 1 46.01 0.0001 R AKGSETPGATPGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1206.1206.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 2919 1155 1 1 1 687.3301 1372.6457 2 1372.647 -0.0013 0 39.4 0.00048 R GGDSIGETPTPGASK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2275.2275.2.dta 47 1 SF3B1_HUMAN Splicing factor 3B subunit 1 OS=Homo sapiens GN=SF3B1 PE=1 SV=3 223 146479 11 11 11 11 3997 165 1 1 1 578.6025 1732.7858 3 1732.7878 -0.002 0 38.37 0.00055 R GDTPGHATPGHGGATSSAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1184.1184.3.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 190 465 1 1 1 348.219 694.4234 2 694.4238 -0.0005 1 19.56 0.02 R RGPPLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1508.1508.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 445 1995 1 1 1 409.2255 816.4365 2 816.4341 0.0024 0 30.21 0.01 K SLEDVVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3207.3207.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 833 859 1 1 1 464.2268 926.4391 2 926.4392 -0.0002 0 33.22 0.0019 R HCDLQVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1946.1946.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 993 1994 1 1 1 486.7775 971.5404 2 971.54 0.0005 0 40.08 0.00097 R LESLNIQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3206.3206.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 1045 2357 1 1 1 494.2388 986.463 2 986.4644 -0.0013 0 20.7 0.049 K FCLQYTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3609.3609.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 1057 936 1 1 1 495.7699 989.5253 2 989.5254 -0.0001 1 30.08 0.013 R RLGDSSLSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2032.2032.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 1688 1014 1 1 1 569.3161 1136.6177 2 1136.6189 -0.0013 0 32.07 0.003 R ILQEHEQIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2118.2118.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 2255 3499 1 1 1 623.3412 1244.6678 2 1244.6686 -0.0008 0 52.11 4.50E-05 R LLDMDGIIVEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4824.4824.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 2733 2065 1 1 1 667.3486 1332.6827 2 1332.6826 0.0001 0 27.67 0.016 R LYHDIAQQAFK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3286.3286.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 2832 3378 1 1 1 675.9079 1349.8012 2 1349.8031 -0.0018 0 32.26 0.00071 R LATLLGLQAPPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4697.4697.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 3130 1977 1 1 1 478.5891 1432.7454 3 1432.7463 -0.0008 0 18.54 0.018 M PAYFQRPENALK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3187.3187.3.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 3136 4203 1 1 1 717.9028 1433.7911 2 1433.7919 -0.0007 0 43.7 0.00015 R FNVLQYVVPEVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5554.5554.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 3399 3930 1 1 1 761.9628 1521.9111 2 1521.913 -0.0019 0 45.05 3.10E-05 R VLLATLSIPITPER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5273.5273.2.dta 48 1 EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens GN=EIF3A PE=1 SV=1 215 166867 14 14 14 14 4006 4562 1 1 1 867.9748 1733.935 2 1733.9352 -0.0002 0 28.69 0.002 R LTSLVPFVDAFQLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5955.5955.2.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 126 1733 1 1 0 336.2444 670.4742 2 670.4741 0 1 27.31 0.0039 R IKLGLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2916.2916.2.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 428 615 1 1 0 406.2001 810.3857 2 810.3872 -0.0015 0 24.33 0.016 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1675.1675.2.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 505 5304 1 1 0 416.2377 830.4609 2 830.461 -0.0001 1 32.55 0.0063 K AVAASKER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.945.945.2.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 569 5308 1 1 1 422.7481 843.4817 2 843.4814 0.0003 1 52.14 7.00E-05 K KATGAATPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.950.950.2.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 996 1851 1 1 0 487.3057 972.5969 2 972.5968 0.0001 1 46.88 3.70E-05 R SGVSLAALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3047.3047.2.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 2008 2576 1 1 0 599.837 1197.6595 2 1197.6605 -0.001 0 29.24 0.0062 K ASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3853.3853.2.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 2708 2121 1 1 0 442.925 1325.7533 3 1325.7554 -0.0021 1 42.86 0.00019 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3348.3348.3.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 2709 2117 1 1 0 663.884 1325.7535 2 1325.7554 -0.0019 1 56.08 1.20E-05 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3344.3344.2.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 3588 1388 1 1 0 526.9332 1577.7777 3 1577.7797 -0.0021 1 22.39 0.016 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2534.2534.3.dta 49 1 H14_HUMAN Histone H1.4 OS=Homo sapiens GN=HIST1H1E PE=1 SV=2 213 21852 10 10 8 8 3589 1389 1 1 0 789.8961 1577.7777 2 1577.7797 -0.0021 1 45.24 5.70E-05 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2535.2535.2.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 126 1733 1 0 0 336.2444 670.4742 2 670.4741 0 1 27.31 0.0039 R IKLGLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2916.2916.2.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 428 615 1 0 0 406.2001 810.3857 2 810.3872 -0.0015 0 24.33 0.016 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1675.1675.2.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 505 5304 1 0 0 416.2377 830.4609 2 830.461 -0.0001 1 32.55 0.0063 K AVAASKER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.945.945.2.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 691 128 1 0 1 443.7714 885.5282 2 885.5284 -0.0001 0 31.11 0.0057 K KPAAATVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1142.1142.2.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 996 1851 1 0 0 487.3057 972.5969 2 972.5968 0.0001 1 46.88 3.70E-05 R SGVSLAALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3047.3047.2.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 2008 2576 1 0 0 599.837 1197.6595 2 1197.6605 -0.001 0 29.24 0.0062 K ASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3853.3853.2.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 2708 2121 1 0 0 442.925 1325.7533 3 1325.7554 -0.0021 1 42.86 0.00019 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3348.3348.3.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 2709 2117 1 0 0 663.884 1325.7535 2 1325.7554 -0.0019 1 56.08 1.20E-05 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3344.3344.2.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 3588 1388 1 0 0 526.9332 1577.7777 3 1577.7797 -0.0021 1 22.39 0.016 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2534.2534.3.dta 49 2 H12_HUMAN Histone H1.2 OS=Homo sapiens GN=HIST1H1C PE=1 SV=2 193 21352 10 10 8 8 3589 1389 1 0 0 789.8961 1577.7777 2 1577.7797 -0.0021 1 45.24 5.70E-05 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2535.2535.2.dta 49 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 183 22336 9 9 7 7 126 1733 1 0 0 336.2444 670.4742 2 670.4741 0 1 27.31 0.0039 R IKLGLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2916.2916.2.dta 49 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 183 22336 9 9 7 7 428 615 1 0 0 406.2001 810.3857 2 810.3872 -0.0015 0 24.33 0.016 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1675.1675.2.dta 49 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 183 22336 9 9 7 7 505 5304 1 0 0 416.2377 830.4609 2 830.461 -0.0001 1 32.55 0.0063 K AVAASKER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.945.945.2.dta 49 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 183 22336 9 9 7 7 996 1851 1 0 0 487.3057 972.5969 2 972.5968 0.0001 1 46.88 3.70E-05 R SGVSLAALKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3047.3047.2.dta 49 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 183 22336 9 9 7 7 2008 2576 1 0 0 599.837 1197.6595 2 1197.6605 -0.001 0 29.24 0.0062 K ASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3853.3853.2.dta 49 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 183 22336 9 9 7 7 2708 2121 1 0 0 442.925 1325.7533 3 1325.7554 -0.0021 1 42.86 0.00019 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3348.3348.3.dta 49 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 183 22336 9 9 7 7 2709 2117 1 0 0 663.884 1325.7535 2 1325.7554 -0.0019 1 56.08 1.20E-05 R KASGPPVSELITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3344.3344.2.dta 49 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 183 22336 9 9 7 7 3588 1388 1 0 0 526.9332 1577.7777 3 1577.7797 -0.0021 1 22.39 0.016 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2534.2534.3.dta 49 H13_HUMAN Histone H1.3 OS=Homo sapiens GN=HIST1H1D PE=1 SV=2 183 22336 9 9 7 7 3589 1389 1 0 0 789.8961 1577.7777 2 1577.7797 -0.0021 1 45.24 5.70E-05 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2535.2535.2.dta 49 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 69 21829 4 4 3 3 126 1733 1 0 1 336.2444 670.4742 2 670.4741 0 1 27.31 0.0039 R IKLGIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2916.2916.2.dta 49 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 69 21829 4 4 3 3 428 615 1 0 0 406.2001 810.3857 2 810.3872 -0.0015 0 24.33 0.016 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1675.1675.2.dta 49 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 69 21829 4 4 3 3 3588 1388 1 0 0 526.9332 1577.7777 3 1577.7797 -0.0021 1 22.39 0.016 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2534.2534.3.dta 49 H11_HUMAN Histone H1.1 OS=Homo sapiens GN=HIST1H1A PE=1 SV=3 69 21829 4 4 3 3 3589 1389 1 0 0 789.8961 1577.7777 2 1577.7797 -0.0021 1 45.24 5.70E-05 K ALAAAGYDVEKNNSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2535.2535.2.dta 49 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 46 22566 3 3 3 3 126 1733 1 0 0 336.2444 670.4742 2 670.4741 0 1 27.31 0.0039 R IKLGLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2916.2916.2.dta 49 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 46 22566 3 3 3 3 428 615 1 0 0 406.2001 810.3857 2 810.3872 -0.0015 0 24.33 0.016 K GTGASGSFK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1675.1675.2.dta 49 H15_HUMAN Histone H1.5 OS=Homo sapiens GN=HIST1H1B PE=1 SV=3 46 22566 3 3 3 3 505 5304 1 0 0 416.2377 830.4609 2 830.461 -0.0001 1 32.55 0.0063 K AVAASKER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.945.945.2.dta 50 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 200 283140 7 7 7 7 291 67 1 1 1 377.7014 753.3882 2 753.3882 0 0 38.64 0.00062 R QSLGHGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1074.1074.2.dta 50 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 200 283140 7 7 7 7 388 410 1 1 1 397.6931 793.3716 2 793.3719 -0.0002 0 22.22 0.041 R QSPSYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1448.1448.2.dta 50 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 200 283140 7 7 7 7 919 5286 1 1 1 474.7177 947.4208 2 947.4209 -0.0002 0 48.19 6.10E-05 R YGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.923.923.2.dta 50 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 200 283140 7 7 7 7 1630 335 1 1 1 563.2668 1124.519 2 1124.521 -0.002 1 38.5 0.00074 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1367.1367.2.dta 50 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 200 283140 7 7 7 7 2229 5346 1 1 1 620.7867 1239.5589 2 1239.5592 -0.0003 0 52.95 1.80E-05 R HGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.996.996.2.dta 50 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 200 283140 7 7 7 7 2760 5265 1 1 1 670.3079 1338.6012 2 1338.6025 -0.0013 0 64.47 1.60E-06 R QGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.893.893.2.dta 50 1 HORN_HUMAN Hornerin OS=Homo sapiens GN=HRNR PE=1 SV=2 200 283140 7 7 7 7 4217 7 1 1 1 603.5889 1807.745 3 1807.747 -0.002 0 48.22 3.20E-05 R HGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1008.1008.3.dta 51 1 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 192 116336 6 6 6 6 167 66 1 1 1 343.6736 685.3327 2 685.333 -0.0002 0 24.67 0.018 R CTHIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1073.1073.2.dta 51 1 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 192 116336 6 6 6 6 1002 985 1 1 1 488.7477 975.4808 2 975.4807 0.0001 0 29.77 0.0089 R ANACNSVIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2086.2086.2.dta 51 1 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 192 116336 6 6 6 6 1212 3223 1 1 1 514.7564 1027.4983 2 1027.4975 0.0008 0 32.12 0.0029 K EFTLEFSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4534.4534.2.dta 51 1 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 192 116336 6 6 6 6 1401 2365 1 1 1 536.7847 1071.5549 2 1071.556 -0.0011 0 39.76 0.00071 R NAENAIEALK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3618.3618.2.dta 51 1 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 192 116336 6 6 6 6 3055 2959 1 1 1 704.8514 1407.6882 2 1407.6882 0 0 64.26 9.50E-07 R IGIFGQDEDVTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4259.4259.2.dta 51 1 AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 192 116336 6 6 6 6 3710 3161 1 1 1 810.9106 1619.8066 2 1619.8076 -0.001 0 100.95 5.60E-10 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4469.4469.2.dta 51 AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 113 115444 2 2 2 2 1212 3223 1 0 1 514.7564 1027.4983 2 1027.4975 0.0008 0 32.12 0.0029 K EFTLEFSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4534.4534.2.dta 51 AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 113 115444 2 2 2 2 3710 3161 1 0 1 810.9106 1619.8066 2 1619.8076 -0.001 0 100.95 5.60E-10 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4469.4469.2.dta 51 AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 52 111550 2 2 2 2 1212 3223 1 0 1 514.7564 1027.4983 2 1027.4975 0.0008 0 32.12 0.0029 K EFTLEFSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4534.4534.2.dta 51 AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 52 111550 2 2 2 2 1401 2365 1 0 1 536.7847 1071.5549 2 1071.556 -0.0011 0 39.76 0.00071 R NAENAIEALK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3618.3618.2.dta 52 1 RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 181 218567 6 6 6 6 2566 3977 1 1 1 650.3923 1298.77 2 1298.7711 -0.0011 0 41.38 0.0001 R NLAIVFGPTLVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5322.5322.2.dta 52 1 RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 181 218567 6 6 6 6 2883 4286 1 1 1 682.3818 1362.749 2 1362.7507 -0.0017 0 74.17 1.70E-07 R ELLVSSIFAAASR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5641.5641.2.dta 52 1 RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 181 218567 6 6 6 6 3006 3909 1 1 1 697.3638 1392.713 2 1392.7145 -0.0015 0 38.43 0.0013 R YIPLIVDICCK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5252.5252.2.dta 52 1 RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 181 218567 6 6 6 6 3096 4395 1 1 1 711.8654 1421.7163 2 1421.7191 -0.0028 0 43.39 0.00039 R DATEISVLNFWK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5757.5757.2.dta 52 1 RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 181 218567 6 6 6 6 3445 2383 1 1 1 768.84 1535.6654 2 1535.6675 -0.0021 0 44.67 7.80E-05 K EGGPAFEAGLCTGDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3638.3638.2.dta 52 1 RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 181 218567 6 6 6 6 3712 3856 2 1 1 811.386 1620.7575 2 1620.7566 0.001 0 32.41 0.0028 K CSAQDLSISDWLAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5196.5196.2.dta 52 RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 41 163347 1 1 1 1 2566 3977 1 0 1 650.3923 1298.77 2 1298.7711 -0.0011 0 41.38 0.0001 R NLALVFGPTLVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5322.5322.2.dta 53 1 RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 176 209939 6 6 6 6 408 3793 1 1 1 401.2648 800.5151 2 800.516 -0.0009 0 25.24 0.0093 R AFLPLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5130.5130.2.dta 53 1 RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 176 209939 6 6 6 6 1838 3479 1 1 1 585.3478 1168.6811 2 1168.6816 -0.0004 0 50.28 3.00E-05 K AINIGQLVDVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4804.4804.2.dta 53 1 RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 176 209939 6 6 6 6 2190 4423 1 1 1 616.3853 1230.756 2 1230.7587 -0.0028 0 40.9 8.10E-05 R IPLLLTSLSFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5788.5788.2.dta 53 1 RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 176 209939 6 6 6 6 2949 2892 1 1 1 692.3612 1382.7079 2 1382.7082 -0.0003 0 30.53 0.0073 K AIFENTLSTYPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4190.4190.2.dta 53 1 RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 176 209939 6 6 6 6 3636 3683 1 1 1 796.9183 1591.8221 2 1591.8246 -0.0025 0 48.35 4.40E-05 K VTPNEGLTVSFPFGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5018.5018.2.dta 53 1 RRP5_HUMAN Protein RRP5 homolog OS=Homo sapiens GN=PDCD11 PE=1 SV=3 176 209939 6 6 6 6 4258 4098 1 1 1 912.5082 1823.0018 2 1823.004 -0.0022 0 67.85 4.60E-07 K TTEPGVTGLLLAVEGPAAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5445.5445.2.dta 54 1 NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens GN=NUP205 PE=1 SV=3 172 230171 7 7 7 7 197 884 1 1 1 350.2111 698.4076 2 698.4075 0 0 30.99 0.0042 R TGPVAVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1974.1974.2.dta 54 1 NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens GN=NUP205 PE=1 SV=3 172 230171 7 7 7 7 916 2525 1 1 1 473.7605 945.5064 2 945.5066 -0.0002 0 24.85 0.035 R QCLGLLSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3796.3796.2.dta 54 1 NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens GN=NUP205 PE=1 SV=3 172 230171 7 7 7 7 1511 1308 1 1 1 550.314 1098.6135 2 1098.6145 -0.001 1 41.75 0.00048 K KADNVVNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2445.2445.2.dta 54 1 NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens GN=NUP205 PE=1 SV=3 172 230171 7 7 7 7 1695 3140 1 1 1 570.84 1139.6655 2 1139.6662 -0.0007 0 43.75 0.00012 K IQQGALELLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4448.4448.2.dta 54 1 NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens GN=NUP205 PE=1 SV=3 172 230171 7 7 7 7 1742 3486 1 1 1 575.821 1149.6274 2 1149.6281 -0.0007 0 43.24 0.00024 K LLDIEGLYSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4810.4810.2.dta 54 1 NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens GN=NUP205 PE=1 SV=3 172 230171 7 7 7 7 1820 4307 1 1 1 583.7967 1165.5788 2 1165.5801 -0.0013 0 16.61 0.028 K ENLFMDLLR E Oxidation (M) 0.000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5662.5662.2.dta 54 1 NU205_HUMAN Nuclear pore complex protein Nup205 OS=Homo sapiens GN=NUP205 PE=1 SV=3 172 230171 7 7 7 7 3352 1111 1 1 1 751.8807 1501.7468 2 1501.7485 -0.0017 0 87.33 1.30E-08 K ASTEGVAIQGQQGTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2226.2226.2.dta 55 1 NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 170 73560 9 9 9 9 134 662 1 1 1 337.2156 672.4166 2 672.417 -0.0004 0 27.57 0.016 K AAVVVSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1727.1727.2.dta 55 1 NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 170 73560 9 9 9 9 164 34 1 1 1 342.7237 683.4328 2 683.433 -0.0001 1 24.3 0.0067 K KAAVPAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1038.1038.2.dta 55 1 NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 170 73560 9 9 9 9 248 5295 1 1 1 364.2264 726.4382 2 726.4388 -0.0006 0 27.45 0.0074 K GVKPQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.935.935.2.dta 55 1 NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 170 73560 9 9 9 9 412 5335 1 1 1 402.2116 802.4087 2 802.4086 0.0002 1 22.65 0.046 K SFRHEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.984.984.2.dta 55 1 NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 170 73560 9 9 9 9 778 5331 1 1 1 455.7714 909.5282 2 909.5284 -0.0002 0 30.87 0.0011 K ATTKPPPAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.977.977.2.dta 55 1 NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 170 73560 9 9 9 9 1249 446 1 1 1 518.8109 1035.6072 2 1035.6077 -0.0005 0 45.48 5.90E-05 K SPAVKPAAAPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1487.1487.2.dta 55 1 NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 170 73560 9 9 9 9 1719 120 1 1 1 573.809 1145.6034 2 1145.604 -0.0007 0 59.58 1.10E-05 K NSSNKPAVTTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1133.1133.2.dta 55 1 NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 170 73560 9 9 9 9 2076 192 1 1 1 606.3403 1210.666 2 1210.667 -0.001 0 45.62 0.00016 K VAGGAAPSKPASAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1214.1214.2.dta 55 1 NOLC1_HUMAN Nucleolar and coiled-body phosphoprotein 1 OS=Homo sapiens GN=NOLC1 PE=1 SV=2 170 73560 9 9 9 9 2871 1282 1 1 1 680.8377 1359.6609 2 1359.663 -0.0021 1 38.89 0.00085 R VREEEIEVDSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2416.2416.2.dta 56 1 BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 169 146571 7 7 7 7 613 1601 1 1 1 429.258 856.5015 2 856.5018 -0.0003 0 32.69 0.0027 R GPVTIVSGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2768.2768.2.dta 56 1 BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 169 146571 7 7 7 7 922 1911 1 1 1 474.7666 947.5186 2 947.5189 -0.0003 0 46.67 0.00015 K AFAVQSAVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3114.3114.2.dta 56 1 BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 169 146571 7 7 7 7 1201 949 1 1 1 513.2777 1024.5409 2 1024.5414 -0.0005 0 32.67 0.0013 R QQQAAPNLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2046.2046.2.dta 56 1 BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 169 146571 7 7 7 7 1529 3658 1 1 1 552.3156 1102.6167 2 1102.6169 -0.0002 0 47.4 0.00011 K STLIQCLIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4992.4992.2.dta 56 1 BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 169 146571 7 7 7 7 1714 69 1 1 1 573.2714 1144.5282 2 1144.5295 -0.0013 1 36.05 0.00092 R VNQPDRECK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1076.1076.2.dta 56 1 BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 169 146571 7 7 7 7 2091 3059 1 1 1 607.8532 1213.6919 2 1213.6918 0.0001 0 66.98 1.20E-06 R IAATGVVLDLDK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4363.4363.2.dta 56 1 BMS1_HUMAN Ribosome biogenesis protein BMS1 homolog OS=Homo sapiens GN=BMS1 PE=1 SV=1 169 146571 7 7 7 7 2730 2319 2 1 1 666.8123 1331.61 2 1331.6027 0.0073 0 21.81 0.036 R MEDLTNPEDIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3567.3567.2.dta 57 1 MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens GN=MSH6 PE=1 SV=2 166 154514 5 5 5 5 898 3924 1 1 1 471.815 941.6155 2 941.6161 -0.0006 1 14.81 0.033 K LLTLIKEL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5267.5267.2.dta 57 1 MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens GN=MSH6 PE=1 SV=2 166 154514 5 5 5 5 2281 2623 1 1 1 627.3582 1252.7019 2 1252.7027 -0.0008 0 36.96 0.00063 R LANLPEEVIQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3905.3905.2.dta 57 1 MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens GN=MSH6 PE=1 SV=2 166 154514 5 5 5 5 3094 4265 1 1 1 711.3707 1420.7269 2 1420.7272 -0.0003 0 48.51 2.90E-05 K IIGIMEEVADGFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5619.5619.2.dta 57 1 MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens GN=MSH6 PE=1 SV=2 166 154514 5 5 5 5 3194 2572 1 1 1 724.351 1446.6874 2 1446.6892 -0.0019 0 52.48 1.20E-05 R VHVQFFDDSPTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3848.3848.2.dta 57 1 MSH6_HUMAN DNA mismatch repair protein Msh6 OS=Homo sapiens GN=MSH6 PE=1 SV=2 166 154514 5 5 5 5 4914 3627 1 1 1 1088.5212 2175.0279 2 2175.0307 -0.0027 0 77.82 6.60E-08 R SVAPAAPTSCDFSPGDLVWAK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4958.4958.2.dta 58 1 GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens GN=GTF2I PE=1 SV=2 153 112859 7 7 7 7 399 1260 1 1 1 400.243 798.4714 2 798.4712 0.0002 0 32.21 0.0023 K IIQVGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2392.2392.2.dta 58 1 GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens GN=GTF2I PE=1 SV=2 153 112859 7 7 7 7 457 509 1 1 1 411.2479 820.4812 2 820.4807 0.0005 1 22.31 0.025 R KYAQAIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1557.1557.2.dta 58 1 GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens GN=GTF2I PE=1 SV=2 153 112859 7 7 7 7 1242 2861 1 1 1 518.2896 1034.5647 2 1034.5648 -0.0001 0 40.2 0.00049 R ILDSAEFIK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4159.4159.2.dta 58 1 GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens GN=GTF2I PE=1 SV=2 153 112859 7 7 7 7 1607 2153 1 1 1 559.8078 1117.601 2 1117.6019 -0.0009 0 28.12 0.011 K STVVPVPYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3384.3384.2.dta 58 1 GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens GN=GTF2I PE=1 SV=2 153 112859 7 7 7 7 1627 1680 1 1 1 562.2845 1122.5544 2 1122.5557 -0.0013 0 67.19 1.40E-06 K FAEALGSTEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2857.2857.2.dta 58 1 GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens GN=GTF2I PE=1 SV=2 153 112859 7 7 7 7 2264 2832 1 1 1 624.353 1246.6914 2 1246.6921 -0.0007 0 55.72 1.30E-05 K FAQALGLTEAVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4129.4129.2.dta 58 1 GTF2I_HUMAN General transcription factor II-I OS=Homo sapiens GN=GTF2I PE=1 SV=2 153 112859 7 7 7 7 2365 2340 1 1 1 636.8339 1271.6532 2 1271.6544 -0.0012 0 27.27 0.016 R SILSPGGSCGPIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3590.3590.2.dta 59 1 MYOF_HUMAN Myoferlin OS=Homo sapiens GN=MYOF PE=1 SV=1 151 236100 5 5 5 5 1739 1083 1 1 1 575.7881 1149.5617 2 1149.5626 -0.0008 0 57.31 4.60E-06 K DLTQTASSTAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2195.2195.2.dta 59 1 MYOF_HUMAN Myoferlin OS=Homo sapiens GN=MYOF PE=1 SV=1 151 236100 5 5 5 5 2070 1382 1 1 1 605.83 1209.6455 2 1209.6466 -0.0011 0 41.34 0.00048 R SLSQIHEAAVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2527.2527.2.dta 59 1 MYOF_HUMAN Myoferlin OS=Homo sapiens GN=MYOF PE=1 SV=1 151 236100 5 5 5 5 2437 1867 1 1 1 642.8479 1283.6812 2 1283.6834 -0.0021 0 52.57 2.80E-05 K GPVGTVSEAQLAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3065.3065.2.dta 59 1 MYOF_HUMAN Myoferlin OS=Homo sapiens GN=MYOF PE=1 SV=1 151 236100 5 5 5 5 3081 4329 1 1 1 708.8791 1415.7437 2 1415.7442 -0.0005 0 21.19 0.01 R LDAVNTLLAMAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5684.5684.2.dta 59 1 MYOF_HUMAN Myoferlin OS=Homo sapiens GN=MYOF PE=1 SV=1 151 236100 5 5 5 5 3395 4082 1 1 1 761.3999 1520.7853 2 1520.7875 -0.0023 0 48.25 3.00E-05 K NLVDPFVEVSFAGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5429.5429.2.dta 59 DYSF_HUMAN Dysferlin OS=Homo sapiens GN=DYSF PE=1 SV=1 48 239254 1 1 1 1 3395 4082 1 0 1 761.3999 1520.7853 2 1520.7875 -0.0023 0 48.25 3.00E-05 K NLVDPFVEVSFAGK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5429.5429.2.dta 60 1 CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 150 219407 6 6 6 6 249 2801 1 1 0 364.2574 726.5002 2 726.5003 -0.0001 0 20.66 0.0086 K LLLLQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4097.4097.2.dta 60 1 CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 150 219407 6 6 6 6 456 2839 1 1 1 410.7319 819.4493 2 819.449 0.0003 0 30.25 0.0068 R GNFLEIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4136.4136.2.dta 60 1 CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 150 219407 6 6 6 6 860 1956 1 1 1 467.7409 933.4673 2 933.4668 0.0005 0 34.93 0.0035 R NFEALNAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3164.3164.2.dta 60 1 CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 150 219407 6 6 6 6 2795 3222 1 1 1 673.3642 1344.7138 2 1344.715 -0.0012 0 60.08 2.30E-06 R VGGNIEVLGFNAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4533.4533.2.dta 60 1 CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 150 219407 6 6 6 6 3498 605 1 1 1 518.5734 1552.6983 3 1552.7018 -0.0036 0 39.74 0.00046 R HHYEQQQEDLAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1664.1664.3.dta 60 1 CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 150 219407 6 6 6 6 4375 1408 1 1 1 938.4862 1874.9579 2 1874.9599 -0.002 1 57.83 1.00E-05 R LANRAPEPTPQQVAQQQ - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2556.2556.2.dta 60 CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 82 224506 2 2 2 2 2795 3222 1 0 1 673.3642 1344.7138 2 1344.715 -0.0012 0 60.08 2.30E-06 R VGGNIEVLGFNAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4533.4533.2.dta 60 CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 82 224506 2 2 2 2 3498 605 1 0 1 518.5734 1552.6983 3 1552.7018 -0.0036 0 39.74 0.00046 R HHYEQQQEDLAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1664.1664.3.dta 60 CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 40 227989 1 1 1 1 3498 605 1 0 1 518.5734 1552.6983 3 1552.7018 -0.0036 0 39.74 0.00046 R HHYEQQQEDLAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1664.1664.3.dta 61 1 TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens GN=TOP2A PE=1 SV=3 149 175017 4 4 4 4 1648 2830 1 1 1 564.8399 1127.6653 2 1127.6663 -0.001 0 57.99 8.80E-06 K TLAVSGLGVVGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4127.4127.2.dta 61 1 TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens GN=TOP2A PE=1 SV=3 149 175017 4 4 4 4 2741 4027 1 1 1 668.3804 1334.7462 2 1334.7486 -0.0024 0 33.77 0.002 R FLEEFITPIVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5372.5372.2.dta 61 1 TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens GN=TOP2A PE=1 SV=3 149 175017 4 4 4 4 3140 3309 1 1 0 718.8544 1435.6943 2 1435.6943 0 0 46.03 0.00011 K ELILFSNSDNER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4625.4625.2.dta 61 1 TOP2A_HUMAN DNA topoisomerase 2-alpha OS=Homo sapiens GN=TOP2A PE=1 SV=3 149 175017 4 4 4 4 3243 3386 1 1 0 731.3818 1460.749 2 1460.7511 -0.0021 0 70.84 6.60E-07 K IFDEILVNAADNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4706.4706.2.dta 61 2 TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens GN=TOP2B PE=1 SV=3 112 184122 3 3 3 3 2861 4058 1 0 1 679.389 1356.7634 2 1356.7653 -0.0019 0 35.51 0.0013 R LLFPAVDDNLLK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5404.5404.2.dta 61 2 TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens GN=TOP2B PE=1 SV=3 112 184122 3 3 3 3 3140 3309 1 0 0 718.8544 1435.6943 2 1435.6943 0 0 46.03 0.00011 K ELILFSNSDNER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4625.4625.2.dta 61 2 TOP2B_HUMAN DNA topoisomerase 2-beta OS=Homo sapiens GN=TOP2B PE=1 SV=3 112 184122 3 3 3 3 3243 3386 1 0 0 731.3818 1460.749 2 1460.7511 -0.0021 0 70.84 6.60E-07 K IFDEILVNAADNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4706.4706.2.dta 62 1 NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 148 164355 7 7 7 7 359 44 1 1 1 392.7192 783.4239 2 783.4239 0 0 36.31 0.0012 R LTAGTGHK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1049.1049.2.dta 62 1 NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 148 164355 7 7 7 7 766 2810 1 1 1 454.2444 906.4742 2 906.4745 -0.0003 0 38.01 0.0013 K ALQIFCR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4106.4106.2.dta 62 1 NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 148 164355 7 7 7 7 1498 2355 1 1 1 547.7769 1093.5393 2 1093.5404 -0.0011 0 38.42 0.00075 R SFVELSGAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3607.3607.2.dta 62 1 NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 148 164355 7 7 7 7 1584 2821 1 1 1 558.3152 1114.6158 2 1114.6169 -0.0011 0 33.68 0.0031 R QLVVVLCER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4117.4117.2.dta 62 1 NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 148 164355 7 7 7 7 2278 2969 1 1 1 626.7916 1251.5686 2 1251.5706 -0.0021 0 25.85 0.011 R NLQQEFWCK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4269.4269.2.dta 62 1 NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 148 164355 7 7 7 7 3125 4398 1 1 1 716.415 1430.8155 2 1430.8173 -0.0018 0 59.78 3.20E-06 K LPLTPVFEGLAFK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5760.5760.2.dta 62 1 NU160_HUMAN Nuclear pore complex protein Nup160 OS=Homo sapiens GN=NUP160 PE=1 SV=3 148 164355 7 7 7 7 3494 3501 1 1 1 776.8699 1551.7252 2 1551.7286 -0.0034 0 29.97 0.0015 K QGNCYLAALNCLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4826.4826.2.dta 63 1 CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2 148 162036 5 5 5 5 1335 3445 1 1 1 528.8238 1055.633 2 1055.6339 -0.0008 0 69.52 3.40E-07 K EVLLVALGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4767.4767.2.dta 63 1 CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2 148 162036 5 5 5 5 1701 2938 1 1 1 571.8115 1141.6084 2 1141.6091 -0.0007 0 41.5 0.00051 R NVLDGELLNR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4238.4238.2.dta 63 1 CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2 148 162036 5 5 5 5 2125 3112 1 1 1 610.8474 1219.6803 2 1219.6812 -0.0009 1 34.07 0.00082 R DALLLSFKDAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4419.4419.2.dta 63 1 CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2 148 162036 5 5 5 5 2254 3349 1 1 1 622.8714 1243.7282 2 1243.7289 -0.0006 0 27.41 0.0031 R YIVQVSPLGIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4666.4666.2.dta 63 1 CPSF1_HUMAN Cleavage and polyadenylation specificity factor subunit 1 OS=Homo sapiens GN=CPSF1 PE=1 SV=2 148 162036 5 5 5 5 3012 3967 1 1 1 698.8768 1395.739 2 1395.7398 -0.0008 0 46.23 0.00015 R SSFLPSYIIDVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5310.5310.2.dta 64 1 NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens GN=NUMA1 PE=1 SV=2 147 239199 8 8 8 8 372 686 1 1 1 394.7163 787.4181 2 787.4188 -0.0007 0 26.83 0.027 R VASENLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1754.1754.2.dta 64 1 NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens GN=NUMA1 PE=1 SV=2 147 239199 8 8 8 8 464 574 1 1 1 412.7404 823.4662 2 823.4664 -0.0002 0 27.48 0.0075 R HLTAQVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1629.1629.2.dta 64 1 NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens GN=NUMA1 PE=1 SV=2 147 239199 8 8 8 8 1255 3490 1 1 1 520.3107 1038.6068 2 1038.6073 -0.0005 0 36.92 0.00035 R ELGELIPLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4815.4815.2.dta 64 1 NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens GN=NUMA1 PE=1 SV=2 147 239199 8 8 8 8 1760 149 1 1 1 578.2908 1154.5671 2 1154.568 -0.0008 1 21.86 0.041 R HREELEQSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1166.1166.2.dta 64 1 NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens GN=NUMA1 PE=1 SV=2 147 239199 8 8 8 8 2196 2198 1 1 1 616.8199 1231.6253 2 1231.6296 -0.0042 0 39.19 0.0011 K LADDLSTLQEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3434.3434.2.dta 64 1 NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens GN=NUMA1 PE=1 SV=2 147 239199 8 8 8 8 2295 3865 1 1 1 628.8201 1255.6257 2 1255.6271 -0.0014 0 39.51 0.00078 R LDFVCSFLQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5206.5206.2.dta 64 1 NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens GN=NUMA1 PE=1 SV=2 147 239199 8 8 8 8 2319 1178 1 1 1 630.8299 1259.6452 2 1259.6469 -0.0017 0 62.74 5.20E-06 R LLQAETASNSAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2300.2300.2.dta 64 1 NUMA1_HUMAN Nuclear mitotic apparatus protein 1 OS=Homo sapiens GN=NUMA1 PE=1 SV=2 147 239199 8 8 8 8 2714 952 1 1 1 664.3699 1326.7252 2 1326.7255 -0.0003 1 34.39 0.0014 R ALQQVQEKEVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2049.2049.2.dta 65 1 SYIC_HUMAN "Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=IARS PE=1 SV=2" 141 145718 3 3 3 3 1869 3194 1 1 1 587.3524 1172.6902 2 1172.6917 -0.0016 0 36.04 0.00044 R LYLINSPVVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4503.4503.2.dta 65 1 SYIC_HUMAN "Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=IARS PE=1 SV=2" 141 145718 3 3 3 3 3062 4149 1 1 1 706.8679 1411.7213 2 1411.7235 -0.0022 0 33.26 0.0016 K TVYVSVLPTTADF - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5496.5496.2.dta 65 1 SYIC_HUMAN "Isoleucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=IARS PE=1 SV=2" 141 145718 3 3 3 3 4856 3609 1 1 1 1059.5509 2117.0873 2 2117.0892 -0.0019 0 106.97 1.20E-10 K LFLNETQTQEITEDIPVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4939.4939.2.dta 66 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 136 76625 6 6 6 6 21 2060 1 1 0 304.194 606.3734 2 606.3741 -0.0007 0 25.35 0.014 K TLFVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3280.3280.2.dta 66 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 136 76625 6 6 6 6 278 5336 1 1 1 373.7238 745.4331 2 745.4334 -0.0003 1 21.28 0.033 R LVSKDGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.985.985.2.dta 66 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 136 76625 6 6 6 6 876 2738 1 1 1 469.2531 936.4916 2 936.4917 -0.0001 0 23.81 0.011 K TGISDVFAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4029.4029.2.dta 66 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 136 76625 6 6 6 6 1962 276 1 1 1 596.8115 1191.6085 2 1191.6095 -0.001 1 45.6 0.00022 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1304.1304.2.dta 66 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 136 76625 6 6 6 6 3529 3521 1 1 1 781.3428 1560.6711 2 1560.6733 -0.0022 0 65.95 3.20E-07 K GFGFVDFNSEEDAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4847.4847.2.dta 66 1 NUCL_HUMAN Nucleolin OS=Homo sapiens GN=NCL PE=1 SV=3 136 76625 6 6 6 6 4456 3514 1 1 1 640.3459 1918.016 3 1918.016 0 1 41.06 0.00014 K TGISDVFAKNDLAVVDVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4839.4839.3.dta 67 1 NU133_HUMAN Nuclear pore complex protein Nup133 OS=Homo sapiens GN=NUP133 PE=1 SV=2 131 129924 3 3 3 3 1236 2059 1 1 1 517.2852 1032.5558 2 1032.5564 -0.0006 0 57.75 1.30E-05 R NSGLVSITSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3279.3279.2.dta 67 1 NU133_HUMAN Nuclear pore complex protein Nup133 OS=Homo sapiens GN=NUP133 PE=1 SV=2 131 129924 3 3 3 3 4290 3926 1 1 1 920.5193 1839.0241 2 1839.0255 -0.0013 0 66.71 4.60E-07 K GLPLGSAVSSPVLFSPVGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5269.5269.2.dta 67 1 NU133_HUMAN Nuclear pore complex protein Nup133 OS=Homo sapiens GN=NUP133 PE=1 SV=2 131 129924 3 3 3 3 4411 4253 1 1 1 949.4673 1896.92 2 1896.9258 -0.0058 0 41.23 0.00014 R EYEIPSNLTPADVFFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5606.5606.2.dta 68 1 ACTB_HUMAN "Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1" 123 42052 3 3 3 3 1001 1252 1 1 1 488.7276 975.4407 2 975.441 -0.0003 0 55.62 9.70E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2383.2383.2.dta 68 1 ACTB_HUMAN "Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1" 123 42052 3 3 3 3 4176 3319 1 1 1 895.9487 1789.8829 2 1789.8846 -0.0017 0 66.14 9.10E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4635.4635.2.dta 68 1 ACTB_HUMAN "Actin, cytoplasmic 1 OS=Homo sapiens GN=ACTB PE=1 SV=1" 123 42052 3 3 3 3 4508 2726 1 1 1 652.0256 1953.0551 3 1953.0571 -0.002 0 36.38 0.00071 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4016.4016.3.dta 68 ACTA_HUMAN "Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1" 104 42381 2 2 2 2 1001 1252 1 0 1 488.7276 975.4407 2 975.441 -0.0003 0 55.62 9.70E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2383.2383.2.dta 68 ACTA_HUMAN "Actin, aortic smooth muscle OS=Homo sapiens GN=ACTA2 PE=1 SV=1" 104 42381 2 2 2 2 4176 3319 1 0 1 895.9487 1789.8829 2 1789.8846 -0.0017 0 66.14 9.10E-07 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4635.4635.2.dta 68 ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens GN=ACTBL2 PE=1 SV=2 79 42318 2 2 2 2 4176 3319 1 0 1 895.9487 1789.8829 2 1789.8846 -0.0017 0 66.14 9.10E-07 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4635.4635.2.dta 68 ACTBL_HUMAN Beta-actin-like protein 2 OS=Homo sapiens GN=ACTBL2 PE=1 SV=2 79 42318 2 2 2 2 4508 2726 2 0 1 652.0256 1953.0551 3 1953.0571 -0.002 0 29.88 0.0032 R VAPDEHPILLTEAPLNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4016.4016.3.dta 68 POTEI_HUMAN POTE ankyrin domain family member I OS=Homo sapiens GN=POTEI PE=3 SV=1 56 122858 1 1 1 1 1001 1252 1 0 1 488.7276 975.4407 2 975.441 -0.0003 0 55.62 9.70E-06 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2383.2383.2.dta 69 1 SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 118 185100 6 6 6 6 463 374 1 1 1 412.7347 823.4549 2 823.4552 -0.0002 0 27.47 0.0065 R HIIENAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1409.1409.2.dta 69 1 SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 118 185100 6 6 6 6 900 546 1 1 1 472.2514 942.4883 2 942.4883 0 0 48.91 6.20E-05 R IGQQNEVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1598.1598.2.dta 69 1 SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 118 185100 6 6 6 6 1895 1245 1 1 1 589.7886 1177.5627 2 1177.5649 -0.0022 0 31.58 0.0022 R LCTVNSVEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2375.2375.2.dta 69 1 SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 118 185100 6 6 6 6 2346 3566 1 1 1 634.8456 1267.6767 2 1267.6772 -0.0005 0 47.84 8.70E-05 R GLDPVEILQER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4895.4895.2.dta 69 1 SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 118 185100 6 6 6 6 2700 3544 1 1 1 662.8422 1323.6699 2 1323.671 -0.0011 0 33.35 0.001 K ELPEYYELIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4872.4872.2.dta 69 1 SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 118 185100 6 6 6 6 3369 2023 1 1 1 504.6158 1510.8256 3 1510.8256 0 0 19.88 0.046 K LTQVLNTHYVAPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3238.3238.3.dta 69 SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 80 181794 4 4 4 4 900 546 1 0 1 472.2514 942.4883 2 942.4883 0 0 48.91 6.20E-05 R IGQQNEVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1598.1598.2.dta 69 SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 80 181794 4 4 4 4 1895 1245 1 0 1 589.7886 1177.5627 2 1177.5649 -0.0022 0 31.58 0.0022 R LCTVNSVEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2375.2375.2.dta 69 SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 80 181794 4 4 4 4 2700 3544 1 0 1 662.8422 1323.6699 2 1323.671 -0.0011 0 33.35 0.001 K ELPEYYELIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4872.4872.2.dta 69 SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 80 181794 4 4 4 4 3369 2023 1 0 1 504.6158 1510.8256 3 1510.8256 0 0 19.88 0.046 K LTQVLNTHYVAPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3238.3238.3.dta 69 AZIN2_HUMAN Antizyme inhibitor 2 OS=Homo sapiens GN=AZIN2 PE=1 SV=1 27 50973 1 1 1 1 463 374 1 0 1 412.7347 823.4549 2 823.4552 -0.0002 0 27.47 0.0065 R HLLENAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1409.1409.2.dta 70 1 ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens GN=ZFR PE=1 SV=2 116 118079 4 4 4 4 790 881 1 1 1 457.7335 913.4524 2 913.4518 0.0006 0 21.95 0.034 R FNIHNNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1970.1970.2.dta 70 1 ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens GN=ZFR PE=1 SV=2 116 118079 4 4 4 4 1111 3225 1 1 1 501.774 1001.5334 2 1001.5328 0.0006 0 43.05 0.00055 K CLDALAALR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4536.4536.2.dta 70 1 ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens GN=ZFR PE=1 SV=2 116 118079 4 4 4 4 3477 1628 1 1 1 772.3883 1542.7621 2 1542.7638 -0.0017 0 52.33 1.30E-05 K AISSASSPQSPGDALR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2799.2799.2.dta 70 1 ZFR_HUMAN Zinc finger RNA-binding protein OS=Homo sapiens GN=ZFR PE=1 SV=2 116 118079 4 4 4 4 3656 2746 1 1 1 800.9386 1599.8626 2 1599.8654 -0.0028 0 57.74 1.00E-05 R NVNLVLLCSEKPSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4038.4038.2.dta 71 1 SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4 113 103036 6 6 6 6 232 51 1 1 1 359.7138 717.4131 2 717.4133 -0.0003 1 31.58 0.004 R STNLKR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1057.1057.2.dta 71 1 SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4 113 103036 6 6 6 6 859 1038 1 1 1 467.7406 933.4666 2 933.4668 -0.0002 0 24.68 0.037 R RPYDLDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2145.2145.2.dta 71 1 SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4 113 103036 6 6 6 6 1684 2682 1 1 1 568.8185 1135.6225 2 1135.6237 -0.0012 1 42.34 0.00029 R ATDLKNLFSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3969.3969.2.dta 71 1 SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4 113 103036 6 6 6 6 1980 1492 1 1 1 599.2675 1196.5205 2 1196.5211 -0.0006 1 37.95 0.00046 R DGWGGYGSDKR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2649.2649.2.dta 71 1 SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4 113 103036 6 6 6 6 2852 3329 1 1 1 677.8408 1353.667 2 1353.6677 -0.0008 0 48.05 9.00E-05 R NFWVSGLSSTTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4645.4645.2.dta 71 1 SAFB1_HUMAN Scaffold attachment factor B1 OS=Homo sapiens GN=SAFB PE=1 SV=4 113 103036 6 6 6 6 5031 1892 1 1 1 749.0203 2244.039 3 2244.0393 -0.0004 1 26.08 0.0095 K AIEDEGGNPDEIEITSEGNKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3093.3093.3.dta 71 SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens GN=SAFB2 PE=1 SV=1 66 107921 3 3 3 3 859 1038 1 0 1 467.7406 933.4666 2 933.4668 -0.0002 0 24.68 0.037 R RPYDLDR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2145.2145.2.dta 71 SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens GN=SAFB2 PE=1 SV=1 66 107921 3 3 3 3 1684 2682 1 0 1 568.8185 1135.6225 2 1135.6237 -0.0012 1 42.34 0.00029 R ATDLKNLFSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3969.3969.2.dta 71 SAFB2_HUMAN Scaffold attachment factor B2 OS=Homo sapiens GN=SAFB2 PE=1 SV=1 66 107921 3 3 3 3 1980 1492 1 0 1 599.2675 1196.5205 2 1196.5211 -0.0006 1 37.95 0.00046 R DGWGGYGSDKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2649.2649.2.dta 72 1 PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens GN=PDS5A PE=1 SV=1 113 152274 2 2 2 2 2726 1058 1 1 1 665.8518 1329.6891 2 1329.6888 0.0002 0 81.15 6.70E-08 R TVTAAGAENIQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2167.2167.2.dta 72 1 PDS5A_HUMAN Sister chromatid cohesion protein PDS5 homolog A OS=Homo sapiens GN=PDS5A PE=1 SV=1 113 152274 2 2 2 2 3420 4168 1 1 1 765.4178 1528.8211 2 1528.8249 -0.0038 0 52.46 3.30E-05 K EVQLAQIFEPLSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5516.5516.2.dta 73 1 UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens GN=UBR5 PE=1 SV=2 111 312352 2 2 2 2 3972 3713 1 1 1 864.9854 1727.9563 2 1727.957 -0.0007 0 67.37 7.10E-07 R NVAIFTAGQESPIILR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5048.5048.2.dta 73 1 UBR5_HUMAN E3 ubiquitin-protein ligase UBR5 OS=Homo sapiens GN=UBR5 PE=1 SV=2 111 312352 2 2 2 2 4017 3751 1 1 1 870.4147 1738.8149 2 1738.8162 -0.0013 0 60.43 2.20E-06 R TSDSPWFLSGSETLGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5088.5088.2.dta 74 1 RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens GN=RRBP1 PE=1 SV=4 106 152780 2 2 2 2 1604 26 1 1 1 559.7932 1117.5718 2 1117.5727 -0.001 1 47.63 0.00018 K KADSVANQGTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1029.1029.2.dta 74 1 RRBP1_HUMAN Ribosome-binding protein 1 OS=Homo sapiens GN=RRBP1 PE=1 SV=4 106 152780 2 2 2 2 2301 3291 1 1 1 629.3425 1256.6704 2 1256.6724 -0.002 0 80.82 7.20E-08 R SIEALLEAGQAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4606.4606.2.dta 75 1 RAI3_HUMAN Retinoic acid-induced protein 3 OS=Homo sapiens GN=GPRC5A PE=1 SV=2 105 40624 2 2 2 2 462 774 1 1 1 412.6986 823.3826 2 823.3824 0.0002 0 39.52 0.00063 K SYGVENR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1852.1852.2.dta 75 1 RAI3_HUMAN Retinoic acid-induced protein 3 OS=Homo sapiens GN=GPRC5A PE=1 SV=2 105 40624 2 2 2 2 3129 3382 1 1 1 717.3721 1432.7296 2 1432.731 -0.0014 0 84.19 1.30E-08 R TNVNVFSELSAPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4702.4702.2.dta 76 1 F120A_HUMAN Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens GN=FAM120A PE=1 SV=2 105 123008 4 4 4 4 895 2363 1 1 1 471.2923 940.57 2 940.5706 -0.0006 0 18.96 0.032 R GVISTPVIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3616.3616.2.dta 76 1 F120A_HUMAN Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens GN=FAM120A PE=1 SV=2 105 123008 4 4 4 4 2762 1096 1 1 1 670.3508 1338.687 2 1338.6892 -0.0022 0 14.38 0.045 K SQGGVQPIPSQGGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2209.2209.2.dta 76 1 F120A_HUMAN Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens GN=FAM120A PE=1 SV=2 105 123008 4 4 4 4 2973 2624 1 1 1 693.8584 1385.7022 2 1385.7038 -0.0015 1 67.42 1.30E-06 R EAALEAAVLNKEE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3906.3906.2.dta 76 1 F120A_HUMAN Constitutive coactivator of PPAR-gamma-like protein 1 OS=Homo sapiens GN=FAM120A PE=1 SV=2 105 123008 4 4 4 4 3519 3913 1 1 1 779.4171 1556.8196 2 1556.8198 -0.0003 0 53.33 1.00E-05 K SPQTPELVEALAFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5256.5256.2.dta 77 1 E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens GN=EIF2AK3 PE=1 SV=3 99 126164 3 3 3 3 1868 3473 1 1 1 587.3448 1172.6751 2 1172.6765 -0.0013 0 56.17 8.90E-06 R SLVIISTLDGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4798.4798.2.dta 77 1 E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens GN=EIF2AK3 PE=1 SV=3 99 126164 3 3 3 3 2612 2580 1 1 1 653.8296 1305.6446 2 1305.6453 -0.0006 0 45.82 0.0001 R TPVLVGSDEFDK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3857.3857.2.dta 77 1 E2AK3_HUMAN Eukaryotic translation initiation factor 2-alpha kinase 3 OS=Homo sapiens GN=EIF2AK3 PE=1 SV=3 99 126164 3 3 3 3 4464 3723 1 1 1 962.0429 1922.0713 2 1922.0724 -0.0011 0 32.01 0.0014 K ALESVTNENAIIPLPTIK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5059.5059.2.dta 78 1 MAP1B_HUMAN Microtubule-associated protein 1B OS=Homo sapiens GN=MAP1B PE=1 SV=2 98 271665 1 1 1 1 3424 3816 1 1 1 765.9293 1529.8441 2 1529.8454 -0.0013 0 98.18 7.30E-10 R SVGNTIDPVILFQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5155.5155.2.dta 79 1 SPB1_HUMAN pre-rRNA processing protein FTSJ3 OS=Homo sapiens GN=FTSJ3 PE=1 SV=2 97 96898 1 1 1 1 3788 4174 1 1 1 827.4744 1652.9343 2 1652.9349 -0.0006 0 97.49 3.20E-10 R ILDPEGLALGAVIASSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5523.5523.2.dta 80 1 ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=2 96 152170 6 6 5 5 1597 1338 1 1 1 559.2774 1116.5403 2 1116.5411 -0.0008 0 30.57 0.0063 R SQEQEVLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2478.2478.2.dta 80 1 ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=2 96 152170 6 6 5 5 1710 387 1 1 1 572.801 1143.5874 2 1143.5884 -0.001 1 44.16 0.00035 R RLSQPESAEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1423.1423.2.dta 80 1 ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=2 96 152170 6 6 5 5 2090 1578 1 1 1 607.84 1213.6654 2 1213.6666 -0.0013 0 25.61 0.021 R GLLVDRPSETK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2743.2743.2.dta 80 1 ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=2 96 152170 6 6 5 5 2307 2689 1 1 1 629.8343 1257.654 2 1257.6565 -0.0025 0 50.51 7.10E-05 K SGVSITIDDPVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3977.3977.2.dta 80 1 ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=2 96 152170 6 6 5 5 3932 3738 1 1 1 574.3448 1720.0125 3 1720.0134 -0.0009 1 14.92 0.032 R SAQPLPLKIEELALAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5075.5075.3.dta 80 1 ACINU_HUMAN Apoptotic chromatin condensation inducer in the nucleus OS=Homo sapiens GN=ACIN1 PE=1 SV=2 96 152170 6 6 5 5 3933 3741 1 1 1 861.0139 1720.0133 2 1720.0134 -0.0001 1 23.85 0.0041 R SAQPLPLKIEELALAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5078.5078.2.dta 81 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 94 13403 2 2 2 2 2582 2359 1 1 1 652.3114 1302.6083 2 1302.6092 -0.001 0 67.37 1.20E-06 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3612.3612.2.dta 81 1 KVD26_HUMAN Immunoglobulin kappa variable 2D-26 OS=Homo sapiens GN=IGKV2D-26 PE=3 SV=1 94 13403 2 2 2 2 4782 2797 1 1 1 688.0002 2060.9789 3 2060.9804 -0.0015 1 46.61 7.70E-05 R FSGVPDRFSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4093.4093.3.dta 81 KV228_HUMAN Immunoglobulin kappa variable 2-28 OS=Homo sapiens GN=IGKV2-28 PE=3 SV=1 67 13062 1 1 1 1 2582 2359 1 0 1 652.3114 1302.6083 2 1302.6092 -0.001 0 67.37 1.20E-06 R FSGSGSGTDFTLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3612.3612.2.dta 82 1 SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 93 122513 4 4 4 4 783 2848 1 1 1 456.2345 910.4544 2 910.4549 -0.0004 0 30.25 0.0068 R DFNQFIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4145.4145.2.dta 82 1 SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 93 122513 4 4 4 4 2137 1800 1 1 1 612.2982 1222.5819 2 1222.583 -0.0011 0 46.55 0.00013 R FITDNTVEER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2990.2990.2.dta 82 1 SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 93 122513 4 4 4 4 2592 1529 1 1 1 652.8348 1303.655 2 1303.6554 -0.0004 1 42.29 0.00058 R SVCLIGDKEQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2689.2689.2.dta 82 1 SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 93 122513 4 4 4 4 2671 2465 1 1 1 659.3315 1316.6485 2 1316.6513 -0.0028 1 32.27 0.00094 R KANYAVDAYFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3729.3729.2.dta 82 SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 45 123211 2 2 2 2 783 2848 1 0 1 456.2345 910.4544 2 910.4549 -0.0004 0 30.25 0.0068 R DFNQFIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4145.4145.2.dta 82 SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 45 123211 2 2 2 2 2671 2465 1 0 1 659.3315 1316.6485 2 1316.6513 -0.0028 1 32.27 0.00094 R KANYAVDAYFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3729.3729.2.dta 83 1 SYMPK_HUMAN Symplekin OS=Homo sapiens GN=SYMPK PE=1 SV=2 89 141915 1 1 1 1 4288 4272 1 1 1 919.5336 1837.0526 2 1837.056 -0.0035 0 89.17 1.70E-09 K VVLEAPLITESALEVVR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5627.5627.2.dta 84 1 TF3C1_HUMAN General transcription factor 3C polypeptide 1 OS=Homo sapiens GN=GTF3C1 PE=1 SV=4 86 241062 3 3 3 3 1227 2508 1 1 1 515.7799 1029.5453 2 1029.5454 -0.0002 0 36.87 0.0019 R NLSEEGLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3777.3777.2.dta 84 1 TF3C1_HUMAN General transcription factor 3C polypeptide 1 OS=Homo sapiens GN=GTF3C1 PE=1 SV=4 86 241062 3 3 3 3 1959 3711 1 1 1 596.3525 1190.6904 2 1190.6911 -0.0007 0 40.4 0.00022 R LIESLFTIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5046.5046.2.dta 84 1 TF3C1_HUMAN General transcription factor 3C polypeptide 1 OS=Homo sapiens GN=GTF3C1 PE=1 SV=4 86 241062 3 3 3 3 2291 4030 1 1 1 628.3722 1254.7298 2 1254.7296 0.0003 0 46.99 8.20E-05 R NLIIEAVTNLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5375.5375.2.dta 85 1 SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens GN=EPRS PE=1 SV=5 86 172080 3 3 3 3 980 1836 1 1 1 483.7448 965.475 2 965.4753 -0.0003 0 31.8 0.0057 K SCQFVAVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3030.3030.2.dta 85 1 SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens GN=EPRS PE=1 SV=5 86 172080 3 3 3 3 1365 1312 1 1 1 532.777 1063.5394 2 1063.541 -0.0016 0 51.69 5.90E-05 K QFIAAQGSSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2449.2449.2.dta 85 1 SYEP_HUMAN Bifunctional glutamate/proline--tRNA ligase OS=Homo sapiens GN=EPRS PE=1 SV=5 86 172080 3 3 3 3 1585 2445 1 1 1 558.324 1114.6335 2 1114.6346 -0.0011 0 46.05 0.00017 R LNLNNTVLSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3707.3707.2.dta 86 1 INT1_HUMAN Integrator complex subunit 1 OS=Homo sapiens GN=INTS1 PE=1 SV=2 86 246366 2 2 2 2 2270 3540 1 1 1 624.8505 1247.6864 2 1247.6874 -0.001 0 26.44 0.0033 K LVIFNELSSAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4868.4868.2.dta 86 1 INT1_HUMAN Integrator complex subunit 1 OS=Homo sapiens GN=INTS1 PE=1 SV=2 86 246366 2 2 2 2 2755 3372 1 1 1 669.8481 1337.6816 2 1337.6827 -0.0011 0 77.59 1.50E-07 R FITLLADTSDSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4690.4690.2.dta 87 1 LAMC1_HUMAN Laminin subunit gamma-1 OS=Homo sapiens GN=LAMC1 PE=1 SV=3 86 183191 1 1 1 1 3184 3806 1 1 1 721.8954 1441.7763 2 1441.7776 -0.0013 0 86.02 1.70E-08 R LSAEDLVLEGAGLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5144.5144.2.dta 88 1 MBB1A_HUMAN Myb-binding protein 1A OS=Homo sapiens GN=MYBBP1A PE=1 SV=2 82 149731 2 2 2 2 1563 3915 1 1 1 555.3673 1108.7201 2 1108.722 -0.0019 0 27.56 0.0018 R LLGAALPLLTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5258.5258.2.dta 88 1 MBB1A_HUMAN Myb-binding protein 1A OS=Homo sapiens GN=MYBBP1A PE=1 SV=2 82 149731 2 2 2 2 2173 4369 1 1 1 614.381 1226.7475 2 1226.7486 -0.0011 0 67.41 2.00E-07 R VLDLVEVLVTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5729.5729.2.dta 89 1 THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens GN=THOC2 PE=1 SV=2 81 184541 2 2 2 2 1504 2447 1 1 1 549.2716 1096.5287 2 1096.5302 -0.0015 0 36.73 0.0012 K AEGGYFGQIR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3709.3709.2.dta 89 1 THOC2_HUMAN THO complex subunit 2 OS=Homo sapiens GN=THOC2 PE=1 SV=2 81 184541 2 2 2 2 3112 3902 1 1 1 714.4028 1426.7911 2 1426.7919 -0.0008 0 65.05 2.20E-06 R LDPETLESLGLIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5244.5244.2.dta 90 1 PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 81 194080 2 2 2 2 742 933 1 1 1 450.7482 899.4819 2 899.4825 -0.0005 0 37.32 0.0011 R TPSNLAAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2028.2028.2.dta 90 1 PB1_HUMAN Protein polybromo-1 OS=Homo sapiens GN=PBRM1 PE=1 SV=1 81 194080 2 2 2 2 2675 3246 1 1 1 659.819 1317.6235 2 1317.6241 -0.0006 0 61.46 1.70E-06 K VVDDEIYYFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4558.4558.2.dta 91 1 NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens GN=NUP214 PE=1 SV=2 79 214230 4 4 4 4 802 157 1 1 1 458.7403 915.4661 2 915.4662 -0.0001 0 25.86 0.019 K TTIESHTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1175.1175.2.dta 91 1 NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens GN=NUP214 PE=1 SV=2 79 214230 4 4 4 4 2872 63 1 1 1 680.8381 1359.6616 2 1359.663 -0.0014 0 47.78 0.00014 R VGQADDSTKPTNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1069.1069.2.dta 91 1 NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens GN=NUP214 PE=1 SV=2 79 214230 4 4 4 4 2894 2641 1 1 1 683.8871 1365.7596 2 1365.7616 -0.002 0 40.76 0.00037 K NVPQVVNVQELK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3924.3924.2.dta 91 1 NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens GN=NUP214 PE=1 SV=2 79 214230 4 4 4 4 4093 3579 1 1 1 888.4678 1774.9211 2 1774.9254 -0.0043 0 23.31 0.01 K TSGVPSGFNFTAPPVLGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4908.4908.2.dta 92 1 SR140_HUMAN U2 snRNP-associated SURP motif-containing protein OS=Homo sapiens GN=U2SURP PE=1 SV=2 73 118675 1 1 1 1 3577 3698 1 1 1 786.4185 1570.8225 2 1570.8242 -0.0018 0 73.15 1.40E-07 R LYLVSDVLYNSSAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5033.5033.2.dta 93 1 DJC13_HUMAN DnaJ homolog subfamily C member 13 OS=Homo sapiens GN=DNAJC13 PE=1 SV=5 71 256533 3 3 3 3 1965 3876 1 1 1 596.8394 1191.6643 2 1191.6652 -0.0009 0 20.62 0.042 K AGFLAFTQLPK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5218.5218.2.dta 93 1 DJC13_HUMAN DnaJ homolog subfamily C member 13 OS=Homo sapiens GN=DNAJC13 PE=1 SV=5 71 256533 3 3 3 3 2104 1284 2 0 1 608.3373 1214.66 2 1214.6506 0.0094 0 25.61 0.026 K EQSELVAQALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2418.2418.2.dta 93 1 DJC13_HUMAN DnaJ homolog subfamily C member 13 OS=Homo sapiens GN=DNAJC13 PE=1 SV=5 71 256533 3 3 3 3 3772 4332 1 1 1 824.9786 1647.9426 2 1647.9447 -0.0021 0 61.18 7.60E-07 K IVDGPDPENIILILK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5688.5688.2.dta 94 1 RPB1_HUMAN DNA-directed RNA polymerase II subunit RPB1 OS=Homo sapiens GN=POLR2A PE=1 SV=2 71 218408 1 1 1 1 4458 3167 1 1 1 961.0217 1920.0289 2 1920.0317 -0.0028 0 71.21 3.00E-07 R TVITPDPNLSIDQVGVPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4476.4476.2.dta 95 1 SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens GN=SRSF6 PE=1 SV=2 71 39677 2 2 2 2 644 554 1 1 1 435.7556 869.4967 2 869.497 -0.0003 0 41.1 0.00024 R LIEDKPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1607.1607.2.dta 95 1 SRSF6_HUMAN Serine/arginine-rich splicing factor 6 OS=Homo sapiens GN=SRSF6 PE=1 SV=2 71 39677 2 2 2 2 1364 2451 1 1 1 532.772 1063.5295 2 1063.5298 -0.0003 0 49.49 9.80E-05 R TNEGVIEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3714.3714.2.dta 96 1 SMHD1_HUMAN Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens GN=SMCHD1 PE=1 SV=2 70 227942 2 2 2 2 2388 4246 1 1 1 639.3541 1276.6936 2 1276.6928 0.0008 0 34.44 0.0025 R ANLGVFSVFAPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5599.5599.2.dta 96 1 SMHD1_HUMAN Structural maintenance of chromosomes flexible hinge domain-containing protein 1 OS=Homo sapiens GN=SMCHD1 PE=1 SV=2 70 227942 2 2 2 2 3185 3180 1 1 1 722.3592 1442.7038 2 1442.7042 -0.0003 0 54.25 8.20E-06 R SLNSDISYFGVGGK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4489.4489.2.dta 97 1 RPOM_HUMAN "DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens GN=POLRMT PE=1 SV=2" 66 140300 2 2 2 2 50 1276 1 0 0 315.6944 629.3743 2 629.3748 -0.0005 0 25.51 0.038 R LQIEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2409.2409.2.dta 97 1 RPOM_HUMAN "DNA-directed RNA polymerase, mitochondrial OS=Homo sapiens GN=POLRMT PE=1 SV=2" 66 140300 2 2 2 2 2198 3464 1 1 1 616.8527 1231.6908 2 1231.6925 -0.0017 0 62.51 2.90E-06 R VAQVLEGFITR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4788.4788.2.dta 98 1 HNRPR_HUMAN Heterogeneous nuclear ribonucleoprotein R OS=Homo sapiens GN=HNRNPR PE=1 SV=1 66 71184 1 1 1 1 3237 4048 1 1 1 730.8948 1459.7751 2 1459.777 -0.0018 0 65.88 2.00E-06 R NLATTVTEEILEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5394.5394.2.dta 99 1 SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 65 27578 2 2 2 2 1408 2865 1 1 1 537.2743 1072.534 2 1072.5342 -0.0001 0 40.64 0.00082 R AFSYYGPLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4163.4163.2.dta 99 1 SRSF7_HUMAN Serine/arginine-rich splicing factor 7 OS=Homo sapiens GN=SRSF7 PE=1 SV=1 65 27578 2 2 2 2 3712 3856 1 0 1 811.386 1620.7575 2 1620.7573 0.0003 0 44.86 0.00016 R NPPGFAFVEFEDPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5196.5196.2.dta 99 SRSF3_HUMAN Serine/arginine-rich splicing factor 3 OS=Homo sapiens GN=SRSF3 PE=1 SV=1 45 19546 1 1 1 1 3712 3856 1 0 1 811.386 1620.7575 2 1620.7573 0.0003 0 44.86 0.00016 R NPPGFAFVEFEDPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5196.5196.2.dta 100 1 DOCK9_HUMAN Dedicator of cytokinesis protein 9 OS=Homo sapiens GN=DOCK9 PE=1 SV=2 64 238519 1 1 1 1 3832 3551 1 1 1 836.9602 1671.9059 2 1671.9083 -0.0025 0 64.27 9.40E-07 K LIEPLDYENVIVQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4879.4879.2.dta 101 1 NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens GN=NUP153 PE=1 SV=2 64 155440 3 3 3 3 1977 2700 1 1 1 598.8108 1195.607 2 1195.6085 -0.0014 0 24.49 0.0079 K SSFNLGTIETK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3989.3989.2.dta 101 1 NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens GN=NUP153 PE=1 SV=2 64 155440 3 3 3 3 2730 2319 1 0 1 666.8123 1331.61 2 1331.6106 -0.0006 0 39.77 0.00057 K NVFSSSGTSFSGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3567.3567.2.dta 101 1 NU153_HUMAN Nuclear pore complex protein Nup153 OS=Homo sapiens GN=NUP153 PE=1 SV=2 64 155440 3 3 3 3 3010 2562 1 1 1 698.8397 1395.6649 2 1395.6671 -0.0022 0 36.83 0.0012 K TSQLGDSPFYPGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3837.3837.2.dta 102 1 RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4 63 128688 1 1 1 1 2955 4243 1 1 1 692.3953 1382.776 2 1382.7769 -0.0009 0 63.45 2.10E-06 K IIDEDGLLNLIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5596.5596.2.dta 103 1 L1CAM_HUMAN Neural cell adhesion molecule L1 OS=Homo sapiens GN=L1CAM PE=1 SV=2 63 140885 1 1 1 1 2985 2853 1 1 1 695.4134 1388.8122 2 1388.814 -0.0018 0 62.8 9.20E-07 R AQLLVVGSPGPVPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4150.4150.2.dta 104 1 INF2_HUMAN Inverted formin-2 OS=Homo sapiens GN=INF2 PE=1 SV=2 62 136851 1 1 1 1 3048 4099 1 1 1 703.3631 1404.7116 2 1404.7136 -0.002 0 62.33 5.10E-06 R ALDELFEAIEQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5446.5446.2.dta 105 1 RL18_HUMAN 60S ribosomal protein L18 OS=Homo sapiens GN=RPL18 PE=1 SV=2 62 21735 1 1 1 1 3240 3759 1 1 1 730.9027 1459.7909 2 1459.7922 -0.0014 0 61.6 4.80E-06 K ILTFDQLALDSPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5097.5097.2.dta 106 1 NOMO1_HUMAN Nodal modulator 1 OS=Homo sapiens GN=NOMO1 PE=1 SV=5 61 135209 1 1 1 1 3411 3524 1 1 1 763.4256 1524.8366 2 1524.8399 -0.0033 0 61.49 3.70E-06 K SSIDSEPALVLGPLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4850.4850.2.dta 107 1 LARP1_HUMAN La-related protein 1 OS=Homo sapiens GN=LARP1 PE=1 SV=2 61 123833 3 3 3 3 389 5178 1 1 1 397.7042 793.3938 2 793.3943 -0.0005 1 20.72 0.017 R RHPGGDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.700.700.2.dta 107 1 LARP1_HUMAN La-related protein 1 OS=Homo sapiens GN=LARP1 PE=1 SV=2 61 123833 3 3 3 3 1336 3817 1 1 1 529.2604 1056.5063 2 1056.5062 0.0001 0 53.13 2.50E-05 R YGLECLFR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5156.5156.2.dta 107 1 LARP1_HUMAN La-related protein 1 OS=Homo sapiens GN=LARP1 PE=1 SV=2 61 123833 3 3 3 3 1692 273 1 1 1 570.2807 1138.5468 2 1138.548 -0.0011 0 19.95 0.013 R HSVVAGGGGGEGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1300.1300.2.dta 107 LAR1B_HUMAN La-related protein 1B OS=Homo sapiens GN=LARP1B PE=1 SV=2 53 105771 1 1 1 1 1336 3817 1 0 1 529.2604 1056.5063 2 1056.5062 0.0001 0 53.13 2.50E-05 R YGLECLFR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5156.5156.2.dta 108 1 SON_HUMAN Protein SON OS=Homo sapiens GN=SON PE=1 SV=4 61 264063 1 1 1 1 4333 3809 1 1 1 929.039 1856.0635 2 1856.0659 -0.0024 0 60.51 1.50E-06 K ILDSFAAAPVPTTTLVLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5147.5147.2.dta 109 1 FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 60 275877 1 1 1 1 3717 3494 1 1 1 811.9706 1621.9266 2 1621.9291 -0.0024 0 60.11 1.50E-06 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4819.4819.2.dta 110 1 DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens GN=DIDO1 PE=1 SV=5 59 245434 2 2 2 2 2074 716 1 1 1 606.3224 1210.6303 2 1210.6306 -0.0002 0 17.91 0.026 R QAGPAPAAATAASK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1787.1787.2.dta 110 1 DIDO1_HUMAN Death-inducer obliterator 1 OS=Homo sapiens GN=DIDO1 PE=1 SV=5 59 245434 2 2 2 2 4051 3819 1 1 1 878.4802 1754.9459 2 1754.9454 0.0005 0 57.87 5.70E-06 K DLYLIPLSAQDPVPSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5158.5158.2.dta 111 1 DAPLE_HUMAN Protein Daple OS=Homo sapiens GN=CCDC88C PE=1 SV=3 59 229231 1 1 1 1 1798 3652 1 1 1 582.3239 1162.6333 2 1162.6346 -0.0013 0 59.08 6.20E-06 R AFSLASADLLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4985.4985.2.dta 112 1 SRS11_HUMAN Serine/arginine-rich splicing factor 11 OS=Homo sapiens GN=SRSF11 PE=1 SV=1 57 53624 1 1 1 1 4120 3755 1 1 1 892.4947 1782.9748 2 1782.9767 -0.0019 0 57.14 6.80E-06 R ALIVVPYAEGVIPDEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5093.5093.2.dta 113 1 SRRT_HUMAN Serrate RNA effector molecule homolog OS=Homo sapiens GN=SRRT PE=1 SV=1 57 101060 1 1 1 1 3373 4156 1 1 1 758.3777 1514.7409 2 1514.7405 0.0004 0 56.75 6.80E-06 K EVAFFNNFLTDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5503.5503.2.dta 114 1 D19L1_HUMAN Probable C-mannosyltransferase DPY19L1 OS=Homo sapiens GN=DPY19L1 PE=2 SV=1 55 78180 2 2 2 2 436 1807 1 1 1 408.2473 814.48 2 814.48 -0.0001 1 31.07 0.0034 K VLEVVKE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2998.2998.2.dta 114 1 D19L1_HUMAN Probable C-mannosyltransferase DPY19L1 OS=Homo sapiens GN=DPY19L1 PE=2 SV=1 55 78180 2 2 2 2 1341 3060 1 1 1 529.3071 1056.5997 2 1056.6001 -0.0004 0 44.37 0.00027 K TPLCNLLVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4364.4364.2.dta 115 1 CEBPZ_HUMAN CCAAT/enhancer-binding protein zeta OS=Homo sapiens GN=CEBPZ PE=1 SV=3 55 121526 2 2 2 2 3061 4199 1 1 1 706.3924 1410.7702 2 1410.7718 -0.0016 0 50.37 2.50E-05 K ELLITDLLPDNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5550.5550.2.dta 115 1 CEBPZ_HUMAN CCAAT/enhancer-binding protein zeta OS=Homo sapiens GN=CEBPZ PE=1 SV=3 55 121526 2 2 2 2 4572 2202 1 1 1 661.0057 1979.9952 3 1979.9986 -0.0034 0 20.06 0.013 R ALTVAHELLCNKPEEEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3438.3438.3.dta 116 1 CNOT1_HUMAN CCR4-NOT transcription complex subunit 1 OS=Homo sapiens GN=CNOT1 PE=1 SV=2 55 269106 1 1 1 1 1673 3753 1 1 1 567.811 1133.6074 2 1133.6081 -0.0007 0 54.66 2.40E-05 R SPVTFLSDLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5090.5090.2.dta 117 1 HNRPK_HUMAN Heterogeneous nuclear ribonucleoprotein K OS=Homo sapiens GN=HNRNPK PE=1 SV=1 54 51230 1 1 1 1 2769 4038 1 1 1 670.9052 1339.7959 2 1339.7962 -0.0004 0 54.5 5.50E-06 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5384.5384.2.dta 118 1 RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens GN=RBBP6 PE=1 SV=1 53 202354 1 1 1 1 3703 3190 1 1 1 810.4274 1618.8403 2 1618.8414 -0.001 0 52.53 3.40E-05 K AIDDSSASISLAQLTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4499.4499.2.dta 119 1 VPP3_HUMAN V-type proton ATPase 116 kDa subunit a isoform 3 OS=Homo sapiens GN=TCIRG1 PE=1 SV=3 52 93650 1 1 1 1 1662 3682 1 1 1 566.8217 1131.6289 2 1131.6288 0.0001 0 52.3 3.70E-05 R LGELGLVEFR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5017.5017.2.dta 120 1 MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens GN=MYO18A PE=1 SV=3 49 234168 2 2 2 2 1966 3127 1 1 1 597.3077 1192.6008 2 1192.6023 -0.0015 0 45.19 0.00021 R NLTLFQAACR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4434.4434.2.dta 120 1 MY18A_HUMAN Unconventional myosin-XVIIIa OS=Homo sapiens GN=MYO18A PE=1 SV=3 49 234168 2 2 2 2 3306 2764 1 1 1 745.3962 1488.7779 2 1488.7784 -0.0005 0 22.57 0.012 R QDQSIILLGSSGSGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4058.4058.2.dta 121 1 RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 48 59628 1 1 1 1 3493 3496 1 1 1 776.4584 1550.9022 2 1550.9032 -0.001 0 48.29 3.30E-05 R VLGVPIIVQASQAEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4820.4820.2.dta 122 1 GOGA2_HUMAN Golgin subfamily A member 2 OS=Homo sapiens GN=GOLGA2 PE=1 SV=3 48 113644 1 1 1 1 2977 3133 1 1 1 694.3729 1386.7312 2 1386.7354 -0.0043 0 48.01 0.00012 R VQELETSLAELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4440.4440.2.dta 123 1 YLPM1_HUMAN YLP motif-containing protein 1 OS=Homo sapiens GN=YLPM1 PE=1 SV=3 46 220077 1 1 1 1 2976 1255 1 1 1 694.3564 1386.6982 2 1386.6991 -0.0009 0 45.55 0.00017 K TTVQQEPLESGAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2386.2386.2.dta 124 1 SF3B2_HUMAN Splicing factor 3B subunit 2 OS=Homo sapiens GN=SF3B2 PE=1 SV=2 45 100279 2 2 2 2 2665 1879 1 1 1 657.83 1313.6455 2 1313.6463 -0.0008 0 42.93 0.00037 R VGEPVALSEEER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3078.3078.2.dta 124 1 SF3B2_HUMAN Splicing factor 3B subunit 2 OS=Homo sapiens GN=SF3B2 PE=1 SV=2 45 100279 2 2 2 2 4627 2377 1 1 1 665.3597 1993.0574 3 1993.0592 -0.0018 1 21.62 0.033 K LAEIGAPIQGNREELVER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3632.3632.3.dta 125 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 44 39125 7 7 1 1 4955 4860 1 1 1 737.7048 2210.0925 3 2210.0862 0.0063 1 14.16 0.047 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6403.6403.3.dta 125 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 44 39125 7 7 1 1 4956 3346 1 1 1 737.7048 2210.0925 3 2210.0862 0.0063 1 21.56 0.013 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4663.4663.3.dta 125 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 44 39125 7 7 1 1 4961 4782 1 1 1 737.7052 2210.0938 3 2210.0862 0.0076 1 14.43 0.044 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6277.6277.3.dta 125 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 44 39125 7 7 1 1 4962 4095 1 1 1 737.7053 2210.094 3 2210.0862 0.0077 1 17.35 0.024 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5442.5442.3.dta 125 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 44 39125 7 7 1 1 4972 3814 1 1 1 737.7058 2210.0954 3 2210.0862 0.0092 1 19.46 0.015 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5153.5153.3.dta 125 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 44 39125 7 7 1 1 4973 4231 1 1 1 737.7059 2210.0958 3 2210.0862 0.0096 1 25.17 0.0044 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5584.5584.3.dta 125 1 CASPC_HUMAN Inactive caspase-12 OS=Homo sapiens GN=CASP12 PE=2 SV=2 44 39125 7 7 1 1 4978 4708 1 1 1 737.7062 2210.0967 3 2210.0862 0.0105 1 16.81 0.045 K AGADTHGRLLQGNICNDAVTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.6155.6155.3.dta 126 1 PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 43 141270 1 1 1 1 1997 4167 1 1 1 599.381 1196.7475 2 1196.7492 -0.0017 0 43.46 4.50E-05 R TNLANVVLLLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5515.5515.2.dta 127 1 NU188_HUMAN Nucleoporin NUP188 homolog OS=Homo sapiens GN=NUP188 PE=1 SV=1 42 198369 4 4 4 4 1418 1942 1 1 1 537.7895 1073.5645 2 1073.5652 -0.0006 0 29.49 0.013 R TLQCLNAVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3148.3148.2.dta 127 1 NU188_HUMAN Nucleoporin NUP188 homolog OS=Homo sapiens GN=NUP188 PE=1 SV=1 42 198369 4 4 4 4 1521 3272 1 1 1 550.8317 1099.6489 2 1099.639 0.0099 0 17.77 0.048 R ELWTILLGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4585.4585.2.dta 127 1 NU188_HUMAN Nucleoporin NUP188 homolog OS=Homo sapiens GN=NUP188 PE=1 SV=1 42 198369 4 4 4 4 2269 3997 1 1 1 624.8453 1247.676 2 1247.6762 -0.0002 0 34.47 0.0031 R QLFLDVLDGTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5342.5342.2.dta 127 1 NU188_HUMAN Nucleoporin NUP188 homolog OS=Homo sapiens GN=NUP188 PE=1 SV=1 42 198369 4 4 4 4 2805 3178 1 1 1 674.3389 1346.6632 2 1346.6619 0.0013 0 21.35 0.033 K SLDAPSWPGVYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4487.4487.2.dta 128 1 CHERP_HUMAN Calcium homeostasis endoplasmic reticulum protein OS=Homo sapiens GN=CHERP PE=1 SV=3 39 104150 1 1 1 1 2781 2444 1 1 1 672.3698 1342.725 2 1342.7278 -0.0029 0 39.42 0.0002 K LALEQQQLICK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3706.3706.2.dta 129 1 TC1D3_HUMAN Tctex1 domain-containing protein 3 OS=Homo sapiens GN=TCTE3 PE=1 SV=1 39 23161 1 1 1 1 1070 3076 1 1 1 497.2767 992.5388 2 992.5291 0.0097 0 38.99 0.0011 K EAYTQILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4382.4382.2.dta 130 1 VPP1_HUMAN V-type proton ATPase 116 kDa subunit a isoform 1 OS=Homo sapiens GN=ATP6V0A1 PE=1 SV=3 38 97148 1 1 1 1 1541 3749 1 1 1 553.8083 1105.602 2 1105.6019 0.0001 0 38.11 0.0008 R NFLELTELK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5086.5086.2.dta 131 1 POGZ_HUMAN Pogo transposable element with ZNF domain OS=Homo sapiens GN=POGZ PE=1 SV=2 38 157355 1 1 1 1 4739 3701 1 1 1 1021.0383 2040.0621 2 2040.064 -0.0019 0 38.05 0.00086 R SFLVASVLPGPDGNINSPTR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5036.5036.2.dta 132 1 MATR3_HUMAN Matrin-3 OS=Homo sapiens GN=MATR3 PE=1 SV=2 38 95078 1 1 1 1 4547 3737 1 1 1 985.041 1968.0675 2 1968.0721 -0.0046 0 37.95 0.00038 R IGPYQPNVPVGIDYVIPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5074.5074.2.dta 133 1 DOCK4_HUMAN Dedicator of cytokinesis protein 4 OS=Homo sapiens GN=DOCK4 PE=1 SV=3 37 226888 1 1 1 1 1539 1285 1 1 1 553.7845 1105.5545 2 1105.555 -0.0004 0 37.35 0.002 K TLISQCQTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2419.2419.2.dta 134 1 AQR_HUMAN Intron-binding protein aquarius OS=Homo sapiens GN=AQR PE=1 SV=4 37 172270 1 1 1 1 2707 2471 1 1 1 663.8538 1325.6931 2 1325.694 -0.0009 0 37.24 0.00038 R VGVPTVDLDAQGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3736.3736.2.dta 135 1 SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens GN=SMC4 PE=1 SV=2 37 147775 1 1 1 1 2208 1548 1 1 1 618.2996 1234.5846 2 1234.5863 -0.0018 0 37.21 0.0012 K QLDECASAITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2710.2710.2.dta 136 1 MT21A_HUMAN Protein N-lysine methyltransferase METTL21A OS=Homo sapiens GN=METTL21A PE=1 SV=2 34 24699 1 1 1 1 2305 5342 1 1 1 420.2215 1257.6427 3 1257.6466 -0.0039 1 33.79 0.0033 K DVHIYEAQKR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.992.992.3.dta 137 1 HCFC1_HUMAN Host cell factor 1 OS=Homo sapiens GN=HCFC1 PE=1 SV=2 32 210598 1 1 1 1 3646 3428 1 1 1 798.9507 1595.8868 2 1595.8883 -0.0014 0 31.86 0.0018 K SPISVPGGSALISNLGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4749.4749.2.dta 138 1 JAK1_HUMAN Tyrosine-protein kinase JAK1 OS=Homo sapiens GN=JAK1 PE=1 SV=2 30 135016 1 1 1 1 2898 3433 1 1 1 684.3968 1366.7791 2 1366.782 -0.0029 0 30.35 0.0018 K LSDPGIPITVLSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4755.4755.2.dta 139 1 IF4G1_HUMAN Eukaryotic translation initiation factor 4 gamma 1 OS=Homo sapiens GN=EIF4G1 PE=1 SV=4 30 176124 1 1 1 1 1888 4031 1 1 1 589.3084 1176.6023 2 1176.6026 -0.0004 0 30.2 0.0015 K EAVGDLLDAFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5376.5376.2.dta 140 1 SNAB_HUMAN Beta-soluble NSF attachment protein OS=Homo sapiens GN=NAPB PE=1 SV=2 30 33878 1 1 1 1 443 956 1 1 1 409.2194 816.4242 2 816.4242 -0.0001 0 29.67 0.0077 K ASHSFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2054.2054.2.dta 141 1 CAF1A_HUMAN Chromatin assembly factor 1 subunit A OS=Homo sapiens GN=CHAF1A PE=1 SV=2 29 108057 1 1 1 1 3626 3381 1 1 1 795.9082 1589.8019 2 1589.8049 -0.0031 0 29.36 0.0058 R NADIFNSDVVIVER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4700.4700.2.dta 142 1 RENT1_HUMAN Regulator of nonsense transcripts 1 OS=Homo sapiens GN=UPF1 PE=1 SV=2 29 125578 1 1 1 1 1546 2882 1 1 1 554.2933 1106.572 2 1106.572 0 0 29.33 0.0071 K AGLSQSLFER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4180.4180.2.dta 143 1 PININ_HUMAN Pinin OS=Homo sapiens GN=PNN PE=1 SV=4 29 81679 2 2 2 2 673 745 1 1 1 437.7354 873.4563 2 873.4556 0.0008 0 27.33 0.024 K LIEESQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1819.1819.2.dta 143 1 PININ_HUMAN Pinin OS=Homo sapiens GN=PNN PE=1 SV=4 29 81679 2 2 2 2 2263 1939 1 1 1 624.34 1246.6654 2 1246.6669 -0.0016 1 24.55 0.029 R RIEFAEQINK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3145.3145.2.dta 144 1 CCAR1_HUMAN Cell division cycle and apoptosis regulator protein 1 OS=Homo sapiens GN=CCAR1 PE=1 SV=2 29 133423 1 1 1 1 1080 619 1 1 1 498.2853 994.5561 2 994.556 0.0002 0 28.72 0.0049 R IVSQPQPAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1679.1679.2.dta 145 1 ADA22_HUMAN Disintegrin and metalloproteinase domain-containing protein 22 OS=Homo sapiens GN=ADAM22 PE=1 SV=1 28 102991 1 1 1 1 1302 1196 1 1 1 349.8509 1046.5308 3 1046.5397 -0.0089 0 28.11 0.014 R QLPQGDYVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2320.2320.3.dta 146 1 FANCI_HUMAN Fanconi anemia group I protein OS=Homo sapiens GN=FANCI PE=1 SV=4 27 150769 1 1 1 1 2114 3841 1 1 1 609.8391 1217.6637 2 1217.6656 -0.0019 0 26.92 0.018 R FQDQVLDLLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5180.5180.2.dta 147 1 RRP12_HUMAN RRP12-like protein OS=Homo sapiens GN=RRP12 PE=1 SV=2 27 145037 1 1 1 1 1079 914 1 1 1 498.2847 994.5548 2 994.556 -0.0011 0 26.77 0.008 R VLATQPGPGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2007.2007.2.dta 148 1 DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens GN=DYNC1H1 PE=1 SV=5 27 534809 2 2 2 2 2180 3543 1 1 1 615.3495 1228.6844 2 1228.6856 -0.0012 0 24.59 0.024 R IFVFEPPPGVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4870.4870.2.dta 148 1 DYHC1_HUMAN Cytoplasmic dynein 1 heavy chain 1 OS=Homo sapiens GN=DYNC1H1 PE=1 SV=5 27 534809 2 2 2 2 2923 4284 1 1 1 687.4049 1372.7953 2 1372.7966 -0.0013 0 20.6 0.022 K VNFLPEIITLSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5639.5639.2.dta 149 1 SYNEM_HUMAN Synemin OS=Homo sapiens GN=SYNM PE=1 SV=2 26 173005 1 1 1 1 789 3315 1 1 1 457.2773 912.5401 2 912.5392 0.0008 0 26.17 0.0094 R AALEALLGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4630.4630.2.dta 150 1 IF2P_HUMAN Eukaryotic translation initiation factor 5B OS=Homo sapiens GN=EIF5B PE=1 SV=4 26 139198 1 1 1 1 369 544 1 0 1 394.2552 786.4959 2 786.4963 -0.0004 1 26.1 0.0077 K IKTVAQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1596.1596.2.dta 151 1 SLTM_HUMAN SAFB-like transcription modulator OS=Homo sapiens GN=SLTM PE=1 SV=2 26 117364 1 1 1 1 1874 5294 1 1 1 588.3033 1174.592 2 1174.5942 -0.0022 1 25.7 0.013 K KGPSSTGASGQAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.934.934.2.dta 152 1 RHG09_HUMAN Rho GTPase-activating protein 9 OS=Homo sapiens GN=ARHGAP9 PE=1 SV=2 25 83892 1 1 1 1 1615 1614 1 1 1 374.1924 1119.5555 3 1119.556 -0.0005 0 25.39 0.027 R EGDTVPSFLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2783.2783.3.dta 153 1 TBR1_HUMAN T-box brain protein 1 OS=Homo sapiens GN=TBR1 PE=2 SV=1 25 74520 1 1 1 1 2443 4277 1 1 1 642.8611 1283.7076 2 1283.7085 -0.0009 0 25 0.019 K LSPVLDGVSELR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5632.5632.2.dta 154 1 JMJD7_HUMAN JmjC domain-containing protein 7 OS=Homo sapiens GN=JMJD7 PE=1 SV=1 25 36308 1 1 1 1 837 1232 1 1 1 465.254 928.4934 2 928.4978 -0.0043 0 24.54 0.031 M AEAALEAVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2360.2360.2.dta 155 1 UBR4_HUMAN E3 ubiquitin-protein ligase UBR4 OS=Homo sapiens GN=UBR4 PE=1 SV=1 24 580547 1 1 1 1 912 776 1 1 1 473.2661 944.5177 2 944.5113 0.0064 0 24.2 0.035 K IQDMVAIR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1854.1854.2.dta 156 1 RAD50_HUMAN DNA repair protein RAD50 OS=Homo sapiens GN=RAD50 PE=1 SV=1 23 154823 1 1 1 1 696 2031 1 1 1 444.761 887.5074 2 887.5076 -0.0003 0 23.35 0.036 K TLEGVITR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3248.3248.2.dta 157 1 HIF1N_HUMAN Hypoxia-inducible factor 1-alpha inhibitor OS=Homo sapiens GN=HIF1AN PE=1 SV=2 23 40431 1 1 1 1 3630 4023 1 1 1 796.3799 1590.7453 2 1590.7308 0.0146 0 22.72 0.024 - MAATAAEAVASGSGEPR E Oxidation (M) 0.10000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5368.5368.2.dta 158 1 TAF1_HUMAN Transcription initiation factor TFIID subunit 1 OS=Homo sapiens GN=TAF1 PE=1 SV=2 23 213969 1 1 1 1 1363 948 1 1 1 532.2799 1062.5453 2 1062.5418 0.0035 1 22.72 0.049 K TSSQLSRER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.2045.2045.2.dta 159 1 DYH7_HUMAN "Dynein heavy chain 7, axonemal OS=Homo sapiens GN=DNAH7 PE=1 SV=2" 22 464398 1 1 1 1 2720 3234 1 1 1 664.863 1327.7114 2 1327.7169 -0.0055 1 22.46 0.039 K EAMKNLLPTPAK S Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4546.4546.2.dta 160 1 COPA_HUMAN Coatomer subunit alpha OS=Homo sapiens GN=COPA PE=1 SV=2 22 139797 1 1 1 1 1939 3517 1 1 1 595.8423 1189.6701 2 1189.6707 -0.0005 0 22.43 0.028 R TLDLPIYVTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4843.4843.2.dta 161 1 FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 22 146142 1 1 1 1 1594 4118 1 1 1 558.8241 1115.6336 2 1115.6339 -0.0002 0 22.43 0.029 K ADLTALFLPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5465.5465.2.dta 162 1 KI67_HUMAN Proliferation marker protein Ki-67 OS=Homo sapiens GN=MKI67 PE=1 SV=2 22 360698 3 3 3 3 26 184 2 0 1 305.7051 609.3956 2 609.3962 -0.0006 0 16.72 0.035 R KPIPR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1205.1205.2.dta 162 1 KI67_HUMAN Proliferation marker protein Ki-67 OS=Homo sapiens GN=MKI67 PE=1 SV=2 22 360698 3 3 3 3 1637 3447 1 1 1 563.826 1125.6375 2 1125.6394 -0.0018 0 19.42 0.042 K LDLLGNLPGSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4769.4769.2.dta 162 1 KI67_HUMAN Proliferation marker protein Ki-67 OS=Homo sapiens GN=MKI67 PE=1 SV=2 22 360698 3 3 3 3 3209 3446 1 1 1 725.8547 1449.6948 2 1449.6987 -0.0039 0 17.23 0.028 K EEAQALEDLTGFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4768.4768.2.dta 163 1 TENA_HUMAN Tenascin OS=Homo sapiens GN=TNC PE=1 SV=3 22 246345 1 1 1 1 936 2068 1 1 1 478.7798 955.5451 2 955.5451 0 0 21.98 0.033 R NLTVPGSLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3289.3289.2.dta 164 1 MROH6_HUMAN Maestro heat-like repeat-containing protein family member 6 OS=Homo sapiens GN=MROH6 PE=4 SV=2 22 77936 1 1 1 1 204 5272 1 1 1 351.6874 701.3603 2 701.3609 -0.0006 0 21.66 0.035 M AGGVWGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.903.903.2.dta 165 1 KDM8_HUMAN Lysine-specific demethylase 8 OS=Homo sapiens GN=KDM8 PE=1 SV=1 21 47867 1 1 1 1 560 2214 1 1 1 421.7586 841.5027 2 841.5021 0.0006 1 21.29 0.031 K LEKTVPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3452.3452.2.dta 166 1 BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens GN=BCR PE=1 SV=2 21 143756 1 1 1 1 1899 2226 1 1 1 590.2889 1178.5633 2 1178.5527 0.0106 1 21.24 0.049 R SQSTSEQEKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3465.3465.2.dta 167 1 LT4R2_HUMAN Leukotriene B4 receptor 2 OS=Homo sapiens GN=LTB4R2 PE=2 SV=1 21 42011 1 1 1 1 400 838 1 1 1 400.7225 799.4304 2 799.43 0.0004 0 21.23 0.044 K LGGAGQAAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1923.1923.2.dta 168 1 YETS2_HUMAN YEATS domain-containing protein 2 OS=Homo sapiens GN=YEATS2 PE=1 SV=2 21 151601 1 1 1 1 2052 3938 1 1 1 603.9003 1205.786 2 1205.786 0 0 20.61 0.0087 K LLLIPQGAILR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5280.5280.2.dta 169 1 H2B1A_HUMAN Histone H2B type 1-A OS=Homo sapiens GN=HIST1H2BA PE=1 SV=3 21 14159 1 1 1 1 932 3111 1 1 1 477.305 952.5954 2 952.5957 -0.0003 0 20.56 0.011 R LLLPGELAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4418.4418.2.dta 170 1 ACSS3_HUMAN "Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens GN=ACSS3 PE=1 SV=1" 20 75358 1 1 1 1 3135 3519 1 1 1 717.8955 1433.7765 2 1433.7766 -0.0001 0 20.34 0.036 K IAIIYDSPVTNTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4845.4845.2.dta 171 1 PRSR3_HUMAN Proline and serine-rich protein 3 OS=Homo sapiens GN=PROSER3 PE=2 SV=1 20 51158 1 1 1 1 1930 59 1 1 1 594.7973 1187.5801 2 1187.5894 -0.0094 1 20.28 0.03 K LEQAQGSKGDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1065.1065.2.dta 172 1 IMA7_HUMAN Importin subunit alpha-7 OS=Homo sapiens GN=KPNA6 PE=1 SV=1 20 60733 1 1 1 1 221 1996 1 1 1 357.2187 712.4229 2 712.4232 -0.0003 0 20.23 0.04 K VASPALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3208.3208.2.dta 173 1 EXOC1_HUMAN Exocyst complex component 1 OS=Homo sapiens GN=EXOC1 PE=1 SV=4 20 102772 1 1 1 1 1836 4543 1 1 1 584.8371 1167.6596 2 1167.6546 0.005 1 19.78 0.03 - MTAIKHALQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5933.5933.2.dta 174 1 FNDC1_HUMAN Fibronectin type III domain-containing protein 1 OS=Homo sapiens GN=FNDC1 PE=2 SV=4 19 205889 1 1 1 1 640 2942 1 1 1 434.7557 867.4969 2 867.4926 0.0042 0 19.42 0.049 K ILANGGAPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4242.4242.2.dta 175 1 LIPA1_HUMAN Liprin-alpha-1 OS=Homo sapiens GN=PPFIA1 PE=1 SV=1 19 136265 1 1 1 1 3355 2622 1 1 1 752.3912 1502.7679 2 1502.7762 -0.0083 1 19.07 0.027 K ELMILKEQNNQK K Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3904.3904.2.dta 176 1 CKAP5_HUMAN Cytoskeleton-associated protein 5 OS=Homo sapiens GN=CKAP5 PE=1 SV=3 19 227062 1 1 1 1 3167 4288 1 1 1 720.4262 1438.8379 2 1438.8395 -0.0017 0 19.04 0.025 K NLGIPIITVLGDSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5643.5643.2.dta 177 1 STK36_HUMAN Serine/threonine-protein kinase 36 OS=Homo sapiens GN=STK36 PE=1 SV=2 19 145728 1 1 1 1 610 2863 1 1 1 428.7664 855.5182 2 855.5178 0.0004 0 18.95 0.046 K EAALIALR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4160.4160.2.dta 178 1 WDR33_HUMAN pre-mRNA 3~ end processing protein WDR33 OS=Homo sapiens GN=WDR33 PE=1 SV=2 18 146198 1 1 1 1 1737 2204 1 1 1 575.3112 1148.6079 2 1148.6077 0.0002 0 18.07 0.027 K TIDYNPSVIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3440.3440.2.dta 179 1 VP13D_HUMAN Vacuolar protein sorting-associated protein 13D OS=Homo sapiens GN=VPS13D PE=1 SV=2 18 495369 1 1 1 1 717 2660 1 1 1 449.7713 897.5281 2 897.5283 -0.0003 0 17.95 0.045 K LLAESLPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3945.3945.2.dta 180 1 GANP_HUMAN Germinal-center associated nuclear protein OS=Homo sapiens GN=MCM3AP PE=1 SV=2 17 220662 1 1 1 1 2031 3686 1 1 1 602.3395 1202.6645 2 1202.6659 -0.0014 0 17.08 0.031 R STIFPLDGVVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.5020.5020.2.dta 181 1 UBP6_HUMAN Ubiquitin carboxyl-terminal hydrolase 6 OS=Homo sapiens GN=USP6 PE=1 SV=2 16 160781 1 1 1 1 5341 5348 1 1 1 1275.2625 3822.7655 3 3822.7764 -0.0109 0 16.32 0.043 K GATGLSNLGNTCFMNSSIQCVSNTQPLTQYFISGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.998.998.3.dta 182 1 CADH7_HUMAN Cadherin-7 OS=Homo sapiens GN=CDH7 PE=2 SV=2 16 87432 1 1 1 1 3504 2644 1 1 1 778.8871 1555.7597 2 1555.763 -0.0033 1 16.06 0.031 R LDREEQAYYTLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.3927.3927.2.dta 183 1 NADC_HUMAN Nicotinate-nucleotide pyrophosphorylase [carboxylating] OS=Homo sapiens GN=QPRT PE=1 SV=3 15 31168 1 1 1 1 3268 906 1 1 1 492.5814 1474.7224 3 1474.7198 0.0026 0 15.19 0.047 R CSGIASAAAAAVEAAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.1998.1998.3.dta 184 1 RPB2_HUMAN DNA-directed RNA polymerase II subunit RPB2 OS=Homo sapiens GN=POLR2B PE=1 SV=1 15 135236 1 1 1 1 487 3361 1 1 1 413.7786 825.5426 2 825.5436 -0.001 0 14.97 0.048 R LLLAALGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\2032 AE-MF-7\orb_190624_AE-MF-7_#2-1.4679.4679.2.dta