Header -------------------------------------------------------- Search title orb_160916_AE-MF-2_#3-2.raw Timestamp 2016-09-21T07:35:33Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/2016/20160921/F073859.dat Peak list data path D:\data\oda\160916_AE-MF-2\orb_160916_AE-MF-2_#3-2.raw Peak list format Mascot generic Search type MIS Mascot version 2.5.1 Database ipi_HUM_NEW Fasta file ipi_HUM_NEW_3.26.fasta Total sequences 67667 Total residues 28462731 Sequences after taxonomy filter 67667 Number of queries 8287 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter All entries Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 1089 2890 2 1 1 422.2377 842.4609 2 842.461 -0.0001 0 32.16 0.014 R ANELQLR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3768.3768.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 1401 2836 1 1 1 451.2583 900.5021 2 900.5029 -0.0007 0 54.4 9.30E-05 K LAAIGEATR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3709.3709.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 1402 5824 1 1 1 451.2893 900.5641 2 900.5644 -0.0003 0 65.92 1.20E-06 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6913.6913.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 1494 5623 1 1 1 458.2738 914.533 2 914.5338 -0.0008 0 36.62 0.0027 K LLLWSQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6695.6695.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 1874 5764 1 1 1 484.2533 966.492 2 966.4923 -0.0003 0 25.68 0.041 R SWSLATFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6845.6845.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2186 2324 1 1 1 508.2798 1014.545 2 1014.5458 -0.0008 0 93.17 1.10E-08 R LSVAAQEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3144.3144.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2303 2371 1 1 1 516.2902 1030.5658 2 1030.5658 -0.0001 0 57.56 4.60E-05 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3194.3194.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2589 5933 1 1 1 537.3089 1072.6032 2 1072.6029 0.0003 0 24.23 0.04 K SLLAWQSLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7024.7024.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2750 4285 1 1 1 549.7369 1097.4593 2 1097.46 -0.0007 0 39.87 0.00043 K AFCGFEDPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5269.5269.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2762 4007 1 1 1 550.7881 1099.5616 2 1099.5622 -0.0005 0 100.87 1.80E-09 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4975.4975.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2765 1305 1 1 1 551.2861 1100.5577 2 1100.5574 0.0003 0 61.79 1.00E-05 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2050.2050.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2858 1572 1 1 1 559.7931 1117.5716 2 1117.5727 -0.0011 1 49.96 0.00028 R SAEAELQSKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2334.2334.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2859 5258 1 1 1 559.7972 1117.5799 2 1117.5801 -0.0002 0 40.43 0.00058 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6307.6307.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2875 2906 1 1 1 374.5644 1120.6714 3 1120.6717 -0.0002 1 34.46 0.0015 K GLILKDHGIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3785.3785.3.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2933 4502 1 1 1 565.3019 1128.5893 2 1128.5887 0.0006 0 42.07 0.0014 R NLVDNITGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5501.5501.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 2953 3396 1 1 1 378.5377 1132.5912 3 1132.591 0.0002 1 31.06 0.019 R CISELKDIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4325.4325.3.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3095 4188 1 1 1 576.2825 1150.5505 2 1150.5506 -0.0001 0 31.03 0.0053 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5166.5166.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3133 2070 1 1 1 580.7801 1159.5456 2 1159.5469 -0.0013 0 39.69 0.00057 R SDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2873.2873.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3150 2412 1 1 1 388.5401 1162.5986 3 1162.5982 0.0003 1 14.31 0.045 R AQFEQLKDGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3239.3239.3.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3164 5700 1 1 1 582.7979 1163.5813 2 1163.5822 -0.001 0 60.73 1.70E-05 R LTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6777.6777.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3206 4758 1 1 1 585.8219 1169.6292 2 1169.6292 0.0001 0 39.12 0.0015 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5774.5774.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3212 5271 1 1 1 586.3316 1170.6487 2 1170.6496 -0.0009 0 46.91 4.00E-05 R QVEEEILALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6321.6321.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3241 2943 1 1 1 588.2711 1174.5277 2 1174.5288 -0.0012 0 26.03 0.0036 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3827.3827.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3242 5105 1 1 1 588.2739 1174.5332 2 1174.5214 0.0118 0 19.18 0.041 R AETEQGEQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6144.6144.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3328 5595 1 1 1 595.8414 1189.6682 2 1189.6707 -0.0025 0 54.58 4.40E-05 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6665.6665.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3334 5671 1 1 1 596.3251 1190.6357 2 1190.6369 -0.0012 0 51.76 0.0001 R LPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6746.6746.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3756 3327 1 1 1 621.8427 1241.6708 2 1241.6728 -0.002 0 60.39 8.90E-06 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4252.4252.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 3763 5225 1 1 1 622.3354 1242.6562 2 1242.6568 -0.0006 0 36.13 0.0051 R SIQEELQQLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6272.6272.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 4075 5892 1 1 1 642.8613 1283.708 2 1283.7085 -0.0005 0 37.24 0.0024 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6983.6983.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 4086 4642 1 1 1 643.8459 1285.6773 2 1285.6779 -0.0005 0 24.55 0.0083 R WQAVLAQTDVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5650.5650.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 4181 4129 1 1 1 650.3193 1298.624 2 1298.6255 -0.0015 0 30.71 0.0013 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5103.5103.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 4359 5076 1 1 1 660.8485 1319.6825 2 1319.6833 -0.0009 1 29.21 0.0022 R RLTAEDLFEAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6113.6113.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 4434 6391 1 1 1 667.8876 1333.7607 2 1333.7605 0.0002 0 58.65 9.60E-06 R IISLETYNLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7493.7493.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 4595 939 1 1 1 453.5724 1357.6954 3 1357.6949 0.0005 1 20.49 0.031 R LKQSAEEQAQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1662.1662.3.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 4938 2777 1 1 1 470.9156 1409.7251 3 1409.7263 -0.0012 0 32.58 0.0066 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3641.3641.3.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 5497 3986 1 1 1 755.8537 1509.6928 2 1509.6947 -0.0019 0 27.28 0.0028 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4952.4952.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 5576 6687 1 1 1 764.8727 1527.7309 2 1527.7318 -0.0008 0 34.44 0.00059 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7809.7809.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 5642 5380 1 1 1 769.9288 1537.843 2 1537.8464 -0.0034 0 55.22 6.60E-06 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6435.6435.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 5701 5066 1 1 1 778.9169 1555.8193 2 1555.8205 -0.0012 0 85.19 1.00E-08 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6102.6102.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 5710 4143 1 1 1 520.9544 1559.8414 3 1559.842 -0.0006 1 22.54 0.016 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5118.5118.3.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 5732 6020 1 1 1 783.9458 1565.877 2 1565.8777 -0.0006 0 102.99 2.20E-10 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7112.7112.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 5733 6029 1 1 1 522.9664 1565.8773 3 1565.8777 -0.0004 0 39.81 0.00018 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7121.7121.3.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 5745 6074 1 1 1 785.9064 1569.7983 2 1569.7998 -0.0015 0 32.55 0.0014 R DDGTGQLLLPLSDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7167.7167.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 5897 3960 1 1 1 531.6055 1591.7946 3 1591.7954 -0.0008 1 44.8 0.00061 R ARQEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4925.4925.3.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 6686 4796 1 1 1 854.9159 1707.8172 2 1707.8203 -0.0031 0 33.95 0.00092 R LLDPEDVDVPQPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5814.5814.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 6873 3656 1 1 1 877.9317 1753.8489 2 1753.8483 0.0006 0 93 1.90E-09 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4600.4600.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 6935 6451 1 1 1 886.9292 1771.8438 2 1771.8451 -0.0012 0 38.07 0.00027 R DPYSGSTISLFQAMQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7554.7554.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 7088 5867 1 1 1 917.9509 1833.8872 2 1833.8857 0.0015 0 35.95 0.00043 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6958.6958.2.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 7389 6095 1 1 1 643.0153 1926.0239 3 1926.0244 -0.0005 0 18.74 0.017 R CRPDQLTGLSLLPLSEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7189.7189.3.dta 1 1 IPI00186711.3 plectin 1 isoform 6 1228 533462 50 50 49 49 7497 5393 1 1 1 665.7037 1994.0892 3 1994.0909 -0.0017 0 51.38 3.10E-05 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6449.6449.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 1089 2890 2 0 1 422.2377 842.4609 2 842.461 -0.0001 0 32.16 0.014 R ANELQLR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3768.3768.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 1401 2836 1 0 1 451.2583 900.5021 2 900.5029 -0.0007 0 54.4 9.30E-05 K LAAIGEATR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3709.3709.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 1402 5824 1 0 1 451.2893 900.5641 2 900.5644 -0.0003 0 65.92 1.20E-06 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6913.6913.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 1494 5623 1 0 1 458.2738 914.533 2 914.5338 -0.0008 0 36.62 0.0027 K LLLWSQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6695.6695.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 1874 5764 1 0 1 484.2533 966.492 2 966.4923 -0.0003 0 25.68 0.041 R SWSLATFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6845.6845.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2186 2324 1 0 1 508.2798 1014.545 2 1014.5458 -0.0008 0 93.17 1.10E-08 R LSVAAQEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3144.3144.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2303 2371 1 0 1 516.2902 1030.5658 2 1030.5658 -0.0001 0 57.56 4.60E-05 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3194.3194.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2589 5933 1 0 1 537.3089 1072.6032 2 1072.6029 0.0003 0 24.23 0.04 K SLLAWQSLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7024.7024.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2750 4285 1 0 1 549.7369 1097.4593 2 1097.46 -0.0007 0 39.87 0.00043 K AFCGFEDPR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5269.5269.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2762 4007 1 0 1 550.7881 1099.5616 2 1099.5622 -0.0005 0 100.87 1.80E-09 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4975.4975.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2765 1305 1 0 1 551.2861 1100.5577 2 1100.5574 0.0003 0 61.79 1.00E-05 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2050.2050.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2858 1572 1 0 1 559.7931 1117.5716 2 1117.5727 -0.0011 1 49.96 0.00028 R SAEAELQSKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2334.2334.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2859 5258 1 0 1 559.7972 1117.5799 2 1117.5801 -0.0002 0 40.43 0.00058 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6307.6307.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2875 2906 1 0 1 374.5644 1120.6714 3 1120.6717 -0.0002 1 34.46 0.0015 K GLILKDHGIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3785.3785.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2933 4502 1 0 1 565.3019 1128.5893 2 1128.5887 0.0006 0 42.07 0.0014 R NLVDNITGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5501.5501.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 2953 3396 1 0 1 378.5377 1132.5912 3 1132.591 0.0002 1 31.06 0.019 R CISELKDIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4325.4325.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3095 4188 1 0 1 576.2825 1150.5505 2 1150.5506 -0.0001 0 31.03 0.0053 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5166.5166.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3133 2070 1 0 1 580.7801 1159.5456 2 1159.5469 -0.0013 0 39.69 0.00057 R SDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2873.2873.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3150 2412 1 0 1 388.5401 1162.5986 3 1162.5982 0.0003 1 14.31 0.045 R AQFEQLKDGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3239.3239.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3206 4758 1 0 1 585.8219 1169.6292 2 1169.6292 0.0001 0 39.12 0.0015 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5774.5774.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3212 5271 1 0 1 586.3316 1170.6487 2 1170.6496 -0.0009 0 46.91 4.00E-05 R QVEEEILALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6321.6321.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3241 2943 1 0 1 588.2711 1174.5277 2 1174.5288 -0.0012 0 26.03 0.0036 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3827.3827.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3242 5105 1 0 1 588.2739 1174.5332 2 1174.5214 0.0118 0 19.18 0.041 R AETEQGEQQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6144.6144.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3328 5595 1 0 1 595.8414 1189.6682 2 1189.6707 -0.0025 0 54.58 4.40E-05 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6665.6665.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3334 5671 1 0 1 596.3251 1190.6357 2 1190.6369 -0.0012 0 51.76 0.0001 R LPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6746.6746.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3756 3327 1 0 1 621.8427 1241.6708 2 1241.6728 -0.002 0 60.39 8.90E-06 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4252.4252.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 3763 5225 1 0 1 622.3354 1242.6562 2 1242.6568 -0.0006 0 36.13 0.0051 R SIQEELQQLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6272.6272.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 4075 5892 1 0 1 642.8613 1283.708 2 1283.7085 -0.0005 0 37.24 0.0024 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6983.6983.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 4086 4642 1 0 1 643.8459 1285.6773 2 1285.6779 -0.0005 0 24.55 0.0083 R WQAVLAQTDVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5650.5650.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 4181 4129 1 0 1 650.3193 1298.624 2 1298.6255 -0.0015 0 30.71 0.0013 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5103.5103.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 4434 6391 1 0 1 667.8876 1333.7607 2 1333.7605 0.0002 0 58.65 9.60E-06 R IISLETYNLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7493.7493.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 4595 939 1 0 1 453.5724 1357.6954 3 1357.6949 0.0005 1 20.49 0.031 R LKQSAEEQAQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1662.1662.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 4938 2777 1 0 1 470.9156 1409.7251 3 1409.7263 -0.0012 0 32.58 0.0066 R LAQGHTTVDELAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3641.3641.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 5497 3986 1 0 1 755.8537 1509.6928 2 1509.6947 -0.0019 0 27.28 0.0028 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4952.4952.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 5576 6687 1 0 1 764.8727 1527.7309 2 1527.7318 -0.0008 0 34.44 0.00059 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7809.7809.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 5642 5380 1 0 1 769.9288 1537.843 2 1537.8464 -0.0034 0 55.22 6.60E-06 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6435.6435.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 5701 5066 1 0 1 778.9169 1555.8193 2 1555.8205 -0.0012 0 85.19 1.00E-08 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6102.6102.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 5710 4143 1 0 1 520.9544 1559.8414 3 1559.842 -0.0006 1 22.54 0.016 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5118.5118.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 6686 4796 1 0 1 854.9159 1707.8172 2 1707.8203 -0.0031 0 33.95 0.00092 R LLDPEDVDVPQPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5814.5814.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 6873 3656 1 0 1 877.9317 1753.8489 2 1753.8483 0.0006 0 93 1.90E-09 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4600.4600.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 7088 5867 1 0 1 917.9509 1833.8872 2 1833.8857 0.0015 0 35.95 0.00043 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6958.6958.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 7389 6095 1 0 1 643.0153 1926.0239 3 1926.0244 -0.0005 0 18.74 0.017 R CRPDQLTGLSLLPLSEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7189.7189.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 1012 533408 43 43 43 43 7497 5393 1 0 1 665.7037 1994.0892 3 1994.0909 -0.0017 0 51.38 3.10E-05 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6449.6449.3.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 1089 2890 2 0 1 422.2377 842.4609 2 842.461 -0.0001 0 32.16 0.014 R ANELQLR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3768.3768.2.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 1494 5623 1 0 1 458.2738 914.533 2 914.5338 -0.0008 0 36.62 0.0027 K LLLWSQR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6695.6695.2.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 1874 5764 1 0 1 484.2533 966.492 2 966.4923 -0.0003 0 25.68 0.041 R SWSLATFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6845.6845.2.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 2589 5933 1 0 1 537.3089 1072.6032 2 1072.6029 0.0003 0 24.23 0.04 K SLLAWQSLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7024.7024.2.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 2953 3396 1 0 1 378.5377 1132.5912 3 1132.591 0.0002 1 31.06 0.019 R CISELKDIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4325.4325.3.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 3133 2070 1 0 1 580.7801 1159.5456 2 1159.5469 -0.0013 0 39.69 0.00057 R SDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2873.2873.2.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 3328 5595 1 0 1 595.8414 1189.6682 2 1189.6707 -0.0025 0 54.58 4.40E-05 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6665.6665.2.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 3334 5671 1 0 1 596.3251 1190.6357 2 1190.6369 -0.0012 0 51.76 0.0001 R LPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6746.6746.2.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 6686 4796 1 0 1 854.9159 1707.8172 2 1707.8203 -0.0031 0 33.95 0.00092 R LLDPEDVDVPQPDEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5814.5814.2.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 7088 5867 1 0 1 917.9509 1833.8872 2 1833.8857 0.0015 0 35.95 0.00043 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6958.6958.2.dta 1 IPI00740690.1 similar to Plectin-1 200 144727 11 11 11 11 7497 5393 1 0 1 665.7037 1994.0892 3 1994.0909 -0.0017 0 51.38 3.10E-05 K AGVAAPATQVAQVTLQSVQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6449.6449.3.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 21 2896 1 1 1 300.7075 599.4005 2 599.4006 -0.0002 0 31.08 0.013 R VQILK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3774.3774.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 1053 1657 1 1 1 421.1848 840.3551 2 840.3548 0.0003 0 29.79 0.0053 R NCGSFTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2425.2425.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 1333 1785 1 1 1 442.709 883.4034 2 883.4035 -0.0002 0 24.41 0.0051 R TASFSESR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2569.2569.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 1455 1718 1 1 1 454.2296 906.4447 2 906.4447 0 0 29.3 0.012 R YQDTPGVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2499.2499.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 1610 5748 1 1 1 467.7731 933.5316 2 933.5317 -0.0001 0 53.7 4.10E-05 K TILSLMTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6828.6828.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 2507 5031 1 1 1 531.2822 1060.5498 2 1060.5488 0.001 0 29.49 0.014 K AIVWGMQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6065.6065.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 2956 3979 1 1 1 567.3369 1132.6593 2 1132.6604 -0.0012 1 37.11 0.0017 R VQILKDYVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4945.4945.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 2957 3966 1 1 1 378.5607 1132.6602 3 1132.6604 -0.0003 1 35.1 0.0028 R VQILKDYVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4931.4931.3.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 3110 3180 1 1 1 578.2711 1154.5277 2 1154.5278 -0.0001 0 50.52 1.80E-05 K VDATADYICK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4094.4094.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 3151 6118 1 1 1 582.3168 1162.619 2 1162.6234 -0.0044 0 24.61 0.011 K DGVYVLDLAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7213.7213.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 3152 5865 1 1 1 582.3189 1162.6233 2 1162.6234 -0.0001 0 56.2 1.60E-05 K DGVYVLDLAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6956.6956.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 3783 2184 1 1 1 623.8171 1245.6196 2 1245.6214 -0.0018 1 39.72 0.0016 R RGGPNYQEGLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2995.2995.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 4277 3400 1 1 1 655.8288 1309.643 2 1309.6449 -0.0018 0 48.95 3.20E-05 K FICTTSAIQNR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4330.4330.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 4656 3189 1 1 1 684.3771 1366.7396 2 1366.7357 0.0039 0 47.34 3.60E-05 K LYRPGSVAYVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4104.4104.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 4966 7044 1 1 1 709.3484 1416.6823 2 1416.6826 -0.0003 0 20.66 0.015 K WGDIEFPPPFGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8176.8176.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5039 4234 1 1 1 714.9005 1427.7865 2 1427.7885 -0.002 1 72.4 1.70E-07 K NQALKEAGVFVPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5215.5215.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5040 4231 1 1 1 476.9367 1427.7884 3 1427.7885 -0.0001 1 40.08 0.00021 K NQALKEAGVFVPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5212.5212.3.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5372 3676 1 1 1 740.4064 1478.7982 2 1478.798 0.0002 1 69.92 3.80E-07 K AISEQTGKELLYK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4622.4622.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5418 5252 1 1 1 746.363 1490.7115 2 1490.7147 -0.0032 0 95.74 4.50E-09 R SGGMSNELNNIISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6301.6301.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5465 5954 1 1 1 752.3945 1502.7744 2 1502.7763 -0.0019 0 85.12 2.10E-08 K IGNTGGMLDNILASK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7046.7046.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5491 4507 1 1 1 754.3606 1506.7066 2 1506.7096 -0.003 0 66.37 3.20E-06 R SGGMSNELNNIISR T Oxidation (M) 0.00010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5506.5506.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5530 4975 1 1 1 760.3916 1518.7687 2 1518.7712 -0.0025 0 83.9 6.70E-08 K IGNTGGMLDNILASK L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6005.6005.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5650 4206 1 1 1 514.5742 1540.7008 3 1540.7014 -0.0006 0 25.69 0.01 R KPASFMTSICDER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5185.5185.3.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5735 6544 1 1 1 784.3948 1566.775 2 1566.7752 -0.0002 0 51.41 0.00014 K AFDSGIIPMEFVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7654.7654.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5738 6620 1 1 1 784.4561 1566.8976 2 1566.8981 -0.0005 0 66.85 8.80E-07 R TIAIIAEGIPEALTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7734.7734.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 5858 5786 1 1 1 792.3958 1582.7771 2 1582.7701 0.0069 0 60.53 1.50E-05 K AFDSGIIPMEFVNK M Oxidation (M) 0.00000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6873.6873.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 6632 5554 1 1 1 849.3964 1696.7782 2 1696.7831 -0.005 0 45.34 5.60E-05 R EAYPEEAYIADLDAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6621.6621.2.dta 2 1 IPI00021290.5 ATP-citrate synthase 856 121674 28 28 22 22 7222 5019 1 1 1 940.9092 1879.8039 2 1879.808 -0.0041 0 77.6 6.00E-08 R SAYDSTMETMNYAQIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6052.6052.2.dta 2 IPI00794404.1 23 kDa protein 403 23080 8 8 6 6 1455 1718 1 0 1 454.2296 906.4447 2 906.4447 0 0 29.3 0.012 R YQDTPGVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2499.2499.2.dta 2 IPI00794404.1 23 kDa protein 403 23080 8 8 6 6 4656 3189 1 0 1 684.3771 1366.7396 2 1366.7357 0.0039 0 47.34 3.60E-05 K LYRPGSVAYVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4104.4104.2.dta 2 IPI00794404.1 23 kDa protein 403 23080 8 8 6 6 5418 5252 1 0 1 746.363 1490.7115 2 1490.7147 -0.0032 0 95.74 4.50E-09 R SGGMSNELNNIISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6301.6301.2.dta 2 IPI00794404.1 23 kDa protein 403 23080 8 8 6 6 5465 5954 1 0 1 752.3945 1502.7744 2 1502.7763 -0.0019 0 85.12 2.10E-08 K IGNTGGMLDNILASK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7046.7046.2.dta 2 IPI00794404.1 23 kDa protein 403 23080 8 8 6 6 5491 4507 1 0 1 754.3606 1506.7066 2 1506.7096 -0.003 0 66.37 3.20E-06 R SGGMSNELNNIISR T Oxidation (M) 0.00010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5506.5506.2.dta 2 IPI00794404.1 23 kDa protein 403 23080 8 8 6 6 5530 4975 1 0 1 760.3916 1518.7687 2 1518.7712 -0.0025 0 83.9 6.70E-08 K IGNTGGMLDNILASK L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6005.6005.2.dta 2 IPI00794404.1 23 kDa protein 403 23080 8 8 6 6 5738 6620 1 0 1 784.4561 1566.8976 2 1566.8981 -0.0005 0 66.85 8.80E-07 R TIAIIAEGIPEALTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7734.7734.2.dta 2 IPI00794404.1 23 kDa protein 403 23080 8 8 6 6 7222 5019 1 0 1 940.9092 1879.8039 2 1879.808 -0.0041 0 77.6 6.00E-08 R SAYDSTMETMNYAQIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6052.6052.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 315 2827 1 1 1 344.7213 687.4281 2 687.4279 0.0002 0 33.39 0.0077 K LVLTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3700.3700.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 652 1170 1 1 1 387.2296 772.4446 2 772.4443 0.0003 0 27.01 0.028 K VTQQGLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1908.1908.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 858 659 1 1 1 407.7029 813.3913 2 813.3916 -0.0003 0 23.44 0.016 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1367.1367.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 941 3271 1 1 1 414.7508 827.4871 2 827.4865 0.0006 0 43.58 0.00068 K LLEQGLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4192.4192.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 1317 5005 1 1 1 440.2092 878.4038 2 878.4035 0.0003 0 30.91 0.0083 R DGAWGAFR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6037.6037.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 1453 3523 1 1 1 454.2263 906.4381 2 906.4382 0 0 24.16 0.015 R WVCSSLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4461.4461.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 1454 1549 1 1 1 454.2294 906.4443 2 906.4447 -0.0004 0 64.44 2.50E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2310.2310.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 1767 3373 1 1 1 478.7689 955.5232 2 955.5239 -0.0008 0 36.52 0.00081 K HGLYLPTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4301.4301.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 1822 3500 1 1 1 481.2691 960.5237 2 960.524 -0.0003 0 74.65 8.00E-07 K TGTVSLEVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4436.4436.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 2348 5503 1 1 1 519.8323 1037.65 2 1037.6485 0.0015 0 36.3 0.00041 R GTPLISPLIK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6567.6567.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 2381 3177 1 1 1 522.2956 1042.5766 2 1042.5771 -0.0005 0 65.65 5.00E-06 K AQVADVVVSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4089.4089.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 2845 5924 1 1 1 558.3368 1114.659 2 1114.6598 -0.0007 0 64.44 2.10E-06 R SEGVVAVLLTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7015.7015.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 3326 3861 1 1 1 397.5523 1189.6352 3 1189.6343 0.0009 0 22 0.037 R SDEAVKPFGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4820.4820.3.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 3827 5382 1 1 1 626.3105 1250.6065 2 1250.6084 -0.0019 0 61.8 1.40E-05 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6437.6437.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 3937 4583 1 1 1 632.3734 1262.7323 2 1262.7347 -0.0024 0 60.58 2.10E-06 R LQVVDQPLPVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5587.5587.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 4125 4233 1 1 1 645.7904 1289.5663 2 1289.5677 -0.0014 0 39.23 0.00021 K VYQWDDPDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5214.5214.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 4176 3589 1 1 1 649.8389 1297.6633 2 1297.6626 0.0007 0 80.02 8.70E-08 K VGDPQELNGITR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4530.4530.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 4213 4634 1 1 1 651.8396 1301.6646 2 1301.6649 -0.0003 0 79.58 2.60E-07 R AALQEELQLCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5642.5642.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 4548 6191 1 1 1 675.8271 1349.6396 2 1349.6438 -0.0042 0 47.95 8.30E-05 K SFYGSTLFLCR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7287.7287.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 4781 5845 1 1 1 693.8768 1385.739 2 1385.7402 -0.0012 0 94.01 9.40E-09 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6936.6936.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 4930 5132 1 1 1 704.8658 1407.717 2 1407.718 -0.001 0 33.43 0.00073 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6173.6173.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 5024 5506 1 1 1 713.8897 1425.7649 2 1425.765 -0.0001 0 51.72 7.40E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6570.6570.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 5129 4837 1 1 1 721.8867 1441.7588 2 1441.7599 -0.0011 0 47.53 5.10E-05 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5858.5858.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 5972 4029 1 1 1 807.4164 1612.8183 2 1612.8169 0.0015 0 67.03 8.80E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4997.4997.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 6063 5878 1 1 1 811.9717 1621.9288 2 1621.9291 -0.0003 0 48.89 4.50E-05 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6969.6969.2.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 6879 4235 1 1 1 586.6569 1756.9489 3 1756.9505 -0.0016 1 34.81 0.00054 R ALCATRQEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5216.5216.3.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 7201 4220 1 1 1 623.9335 1868.7786 3 1868.7822 -0.0036 0 28.76 0.0045 K FCFTPHTEEGCLSER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5200.5200.3.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 7278 4584 1 1 1 635.6849 1904.033 3 1904.0367 -0.0037 1 19.22 0.016 K LYTLQDKAQVADVVVSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5588.5588.3.dta 3 1 IPI00645907.3 fatty acid synthase 802 275877 29 29 28 28 7646 5895 1 1 1 730.0391 2187.0955 3 2187.0961 -0.0005 0 26.54 0.0083 R RPTPQDSPIFLPVDDTSFR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6986.6986.3.dta 3 2 IPI00002894.2 DNA polymerase delta catalytic subunit 126 125035 5 5 5 5 860 3758 1 0 1 407.7613 813.5081 2 813.5072 0.0009 0 37.78 0.0015 K VVSQLLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4710.4710.2.dta 3 2 IPI00002894.2 DNA polymerase delta catalytic subunit 126 125035 5 5 5 5 941 3271 1 0 1 414.7508 827.4871 2 827.4865 0.0006 0 43.58 0.00068 R LLEQGIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4192.4192.2.dta 3 2 IPI00002894.2 DNA polymerase delta catalytic subunit 126 125035 5 5 5 5 1295 5611 1 0 1 438.2709 874.5272 2 874.5276 -0.0004 0 37.41 0.00045 K VGGLLAFAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6682.6682.2.dta 3 2 IPI00002894.2 DNA polymerase delta catalytic subunit 126 125035 5 5 5 5 2530 6019 1 0 1 532.7981 1063.5816 2 1063.5815 0.0002 0 38.23 0.0023 K VQTFPFLGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7111.7111.2.dta 3 2 IPI00002894.2 DNA polymerase delta catalytic subunit 126 125035 5 5 5 5 3948 5442 1 0 1 633.8099 1265.6053 2 1265.6074 -0.0021 0 53.66 2.60E-05 R VLSFDIECAGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6500.6500.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 315 2827 1 0 1 344.7213 687.4281 2 687.4279 0.0002 0 33.39 0.0077 K LVLTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3700.3700.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 858 659 1 0 1 407.7029 813.3913 2 813.3916 -0.0003 0 23.44 0.016 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1367.1367.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 941 3271 1 0 1 414.7508 827.4871 2 827.4865 0.0006 0 43.58 0.00068 K LLEQGLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4192.4192.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 1317 5005 1 0 1 440.2092 878.4038 2 878.4035 0.0003 0 30.91 0.0083 R DGAWGAFR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6037.6037.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 1453 3523 1 0 1 454.2263 906.4381 2 906.4382 0 0 24.16 0.015 R WVCSSLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4461.4461.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 1454 1549 1 0 1 454.2294 906.4443 2 906.4447 -0.0004 0 64.44 2.50E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2310.2310.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 1767 3373 1 0 1 478.7689 955.5232 2 955.5239 -0.0008 0 36.52 0.00081 K HGLYLPTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4301.4301.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 1822 3500 1 0 1 481.2691 960.5237 2 960.524 -0.0003 0 74.65 8.00E-07 K TGTVSLEVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4436.4436.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 2348 5503 1 0 1 519.8323 1037.65 2 1037.6485 0.0015 0 36.3 0.00041 R GTPLISPLIK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6567.6567.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 2381 3177 1 0 1 522.2956 1042.5766 2 1042.5771 -0.0005 0 65.65 5.00E-06 K AQVADVVVSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4089.4089.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 2845 5924 1 0 1 558.3368 1114.659 2 1114.6598 -0.0007 0 64.44 2.10E-06 R SEGVVAVLLTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7015.7015.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 3326 3861 1 0 1 397.5523 1189.6352 3 1189.6343 0.0009 0 22 0.037 R SDEAVKPFGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4820.4820.3.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 3827 5382 1 0 1 626.3105 1250.6065 2 1250.6084 -0.0019 0 61.8 1.40E-05 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6437.6437.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 3937 4583 1 0 1 632.3734 1262.7323 2 1262.7347 -0.0024 0 60.58 2.10E-06 R LQVVDQPLPVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5587.5587.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 4125 4233 1 0 1 645.7904 1289.5663 2 1289.5677 -0.0014 0 39.23 0.00021 K VYQWDDPDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5214.5214.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 4176 3589 1 0 1 649.8389 1297.6633 2 1297.6626 0.0007 0 80.02 8.70E-08 K VGDPQELNGITR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4530.4530.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 4213 4634 1 0 1 651.8396 1301.6646 2 1301.6649 -0.0003 0 79.58 2.60E-07 R AALQEELQLCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5642.5642.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 4548 6191 1 0 1 675.8271 1349.6396 2 1349.6438 -0.0042 0 47.95 8.30E-05 K SFYGSTLFLCR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7287.7287.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 4781 5845 1 0 1 693.8768 1385.739 2 1385.7402 -0.0012 0 94.01 9.40E-09 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6936.6936.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 4930 5132 1 0 1 704.8658 1407.717 2 1407.718 -0.001 0 33.43 0.00073 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6173.6173.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 5024 5506 1 0 1 713.8897 1425.7649 2 1425.765 -0.0001 0 51.72 7.40E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6570.6570.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 5129 4837 1 0 1 721.8867 1441.7588 2 1441.7599 -0.0011 0 47.53 5.10E-05 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5858.5858.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 5972 4029 1 0 1 807.4164 1612.8183 2 1612.8169 0.0015 0 67.03 8.80E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4997.4997.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 6063 5878 1 0 1 811.9717 1621.9288 2 1621.9291 -0.0003 0 48.89 4.50E-05 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6969.6969.2.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 6879 4235 1 0 1 586.6569 1756.9489 3 1756.9505 -0.0016 1 34.81 0.00054 R ALCATRQEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5216.5216.3.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 7201 4220 1 0 1 623.9335 1868.7786 3 1868.7822 -0.0036 0 28.76 0.0045 K FCFTPHTEEGCLSER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5200.5200.3.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 7278 4584 1 0 1 635.6849 1904.033 3 1904.0367 -0.0037 1 19.22 0.016 K LYTLQDKAQVADVVVSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5588.5588.3.dta 3 IPI00026781.2 Fatty acid synthase 799 275850 28 28 27 27 7646 5895 1 0 1 730.0391 2187.0955 3 2187.0961 -0.0005 0 26.54 0.0083 R RPTPQDSPIFLPVDDTSFR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6986.6986.3.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 652 1170 1 0 1 387.2296 772.4446 2 772.4443 0.0003 0 27.01 0.028 K VTQQGLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1908.1908.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 858 659 1 0 1 407.7029 813.3913 2 813.3916 -0.0003 0 23.44 0.016 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1367.1367.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 1317 5005 1 0 1 440.2092 878.4038 2 878.4035 0.0003 0 30.91 0.0083 R DGAWGAFR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6037.6037.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 1453 3523 1 0 1 454.2263 906.4381 2 906.4382 0 0 24.16 0.015 R WVCSSLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4461.4461.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 1454 1549 1 0 1 454.2294 906.4443 2 906.4447 -0.0004 0 64.44 2.50E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2310.2310.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 4213 4634 1 0 1 651.8396 1301.6646 2 1301.6649 -0.0003 0 79.58 2.60E-07 R AALQEELQLCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5642.5642.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 4548 6191 1 0 1 675.8271 1349.6396 2 1349.6438 -0.0042 0 47.95 8.30E-05 K SFYGSTLFLCR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7287.7287.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 4781 5845 1 0 1 693.8768 1385.739 2 1385.7402 -0.0012 0 94.01 9.40E-09 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6936.6936.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 4930 5132 1 0 1 704.8658 1407.717 2 1407.718 -0.001 0 33.43 0.00073 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6173.6173.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 5024 5506 1 0 1 713.8897 1425.7649 2 1425.765 -0.0001 0 51.72 7.40E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6570.6570.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 5129 4837 1 0 1 721.8867 1441.7588 2 1441.7599 -0.0011 0 47.53 5.10E-05 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5858.5858.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 5972 4029 1 0 1 807.4164 1612.8183 2 1612.8169 0.0015 0 67.03 8.80E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4997.4997.2.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 7201 4220 1 0 1 623.9335 1868.7786 3 1868.7822 -0.0036 0 28.76 0.0045 K FCFTPHTEEGCLSER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5200.5200.3.dta 3 IPI00793768.1 Protein 380 133622 14 14 13 13 7646 5895 1 0 1 730.0391 2187.0955 3 2187.0961 -0.0005 0 26.54 0.0083 R RPTPQDSPIFLPVDDTSFR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6986.6986.3.dta 3 IPI00795589.1 73 kDa protein 228 73882 7 7 6 6 315 2827 1 0 1 344.7213 687.4281 2 687.4279 0.0002 0 33.39 0.0077 K LVLTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3700.3700.2.dta 3 IPI00795589.1 73 kDa protein 228 73882 7 7 6 6 1454 1549 1 0 1 454.2294 906.4443 2 906.4447 -0.0004 0 64.44 2.50E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2310.2310.2.dta 3 IPI00795589.1 73 kDa protein 228 73882 7 7 6 6 4930 5132 1 0 1 704.8658 1407.717 2 1407.718 -0.001 0 33.43 0.00073 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6173.6173.2.dta 3 IPI00795589.1 73 kDa protein 228 73882 7 7 6 6 5024 5506 1 0 1 713.8897 1425.7649 2 1425.765 -0.0001 0 51.72 7.40E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6570.6570.2.dta 3 IPI00795589.1 73 kDa protein 228 73882 7 7 6 6 5129 4837 1 0 1 721.8867 1441.7588 2 1441.7599 -0.0011 0 47.53 5.10E-05 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5858.5858.2.dta 3 IPI00795589.1 73 kDa protein 228 73882 7 7 6 6 5972 4029 1 0 1 807.4164 1612.8183 2 1612.8169 0.0015 0 67.03 8.80E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4997.4997.2.dta 3 IPI00795589.1 73 kDa protein 228 73882 7 7 6 6 6063 5878 1 0 1 811.9717 1621.9288 2 1621.9291 -0.0003 0 48.89 4.50E-05 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6969.6969.2.dta 3 IPI00556021.2 "Polymerase (DNA directed), delta 1, catalytic subunit 125kDa variant" 106 113097 4 4 4 4 860 3758 1 0 1 407.7613 813.5081 2 813.5072 0.0009 0 37.78 0.0015 K VVSQLLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4710.4710.2.dta 3 IPI00556021.2 "Polymerase (DNA directed), delta 1, catalytic subunit 125kDa variant" 106 113097 4 4 4 4 941 3271 1 0 1 414.7508 827.4871 2 827.4865 0.0006 0 43.58 0.00068 R LLEQGIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4192.4192.2.dta 3 IPI00556021.2 "Polymerase (DNA directed), delta 1, catalytic subunit 125kDa variant" 106 113097 4 4 4 4 2530 6019 1 0 1 532.7981 1063.5816 2 1063.5815 0.0002 0 38.23 0.0023 K VQTFPFLGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7111.7111.2.dta 3 IPI00556021.2 "Polymerase (DNA directed), delta 1, catalytic subunit 125kDa variant" 106 113097 4 4 4 4 3948 5442 1 0 1 633.8099 1265.6053 2 1265.6074 -0.0021 0 53.66 2.60E-05 R VLSFDIECAGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6500.6500.2.dta 3 IPI00792768.1 27 kDa protein 95 27705 2 2 2 2 858 659 1 0 1 407.7029 813.3913 2 813.3916 -0.0003 0 23.44 0.016 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1367.1367.2.dta 3 IPI00792768.1 27 kDa protein 95 27705 2 2 2 2 4781 5845 1 0 1 693.8768 1385.739 2 1385.7402 -0.0012 0 94.01 9.40E-09 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6936.6936.2.dta 3 IPI00795588.1 Protein 64 25373 1 1 1 1 1454 1549 1 0 1 454.2294 906.4443 2 906.4447 -0.0004 0 64.44 2.50E-06 R AAEQYTPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2310.2310.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 242 7558 1 1 1 335.6669 669.3193 2 669.3194 -0.0001 0 26.77 0.024 R HGDSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.878.878.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 2074 2733 1 1 1 500.226 998.4374 2 998.4379 -0.0005 0 33.74 0.0027 K DVDGAYMTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3593.3593.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 2316 2998 1 1 1 517.2621 1032.5097 2 1032.5087 0.001 0 45.24 0.00018 R TLLEGEESR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3894.3894.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 2718 942 1 1 1 546.7544 1091.4942 2 1091.4956 -0.0014 0 107.49 2.20E-10 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1666.1666.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 3941 4336 1 1 1 633.3213 1264.6281 2 1264.6299 -0.0018 0 72.11 1.10E-06 R TNAENEFVTIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5324.5324.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 4217 3391 1 1 1 651.8533 1301.692 2 1301.6939 -0.0019 1 42.76 0.0011 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4320.4320.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 4219 6998 1 1 1 651.8606 1301.7066 2 1301.7078 -0.0012 0 67.64 3.30E-06 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8129.8129.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 4462 2155 1 1 1 670.8378 1339.6611 2 1339.6619 -0.0008 1 77.7 2.80E-07 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2964.2964.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 4757 5744 1 1 1 692.3484 1382.6823 2 1382.683 -0.0007 0 77.46 3.90E-07 K SLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6824.6824.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 4837 3343 1 1 1 465.248 1392.722 3 1392.7249 -0.0028 1 30.38 0.0039 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4269.4269.3.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 4838 3357 1 1 1 697.3694 1392.7243 2 1392.7249 -0.0005 1 77.96 1.10E-07 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4284.4284.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 5344 5697 1 1 1 738.3776 1474.7407 2 1474.7416 -0.0009 0 62.92 8.40E-06 K WELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6774.6774.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 5556 4532 1 1 1 508.6005 1522.7797 3 1522.7813 -0.0017 1 26.21 0.0035 R LLRDYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5533.5533.3.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 6307 4355 1 1 1 829.3989 1656.7833 2 1656.7856 -0.0023 0 71.92 7.00E-07 R SGGGFSSGSAGIINYQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5344.5344.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 6726 4456 1 1 1 858.9282 1715.8418 2 1715.8438 -0.002 0 99.68 9.40E-10 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5452.5452.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 6727 4468 1 1 1 572.955 1715.8432 3 1715.8438 -0.0006 0 22.1 0.0085 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5464.5464.3.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 6918 4051 1 1 1 883.3698 1764.725 2 1764.7275 -0.0025 0 119.01 3.10E-12 R FSSCGGGGGSFGAGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5020.5020.2.dta 4 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 761 66149 18 18 16 16 7894 2115 1 1 1 795.321 2382.9411 3 2382.9447 -0.0035 0 60.01 1.00E-06 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2921.2921.3.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 307 1989 1 1 1 344.2059 686.3973 2 686.3963 0.001 0 32.96 0.014 R VQVDVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2787.2787.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 354 543 1 1 1 349.2035 696.3924 2 696.3919 0.0006 0 28.41 0.011 K HATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1242.1242.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 358 3083 1 1 0 350.1781 698.3416 2 698.3388 0.0028 0 29.12 0.012 R FFETR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3987.3987.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 514 4442 1 1 1 372.255 742.4954 2 742.4953 0.0001 0 32.23 0.0047 K LLASLVK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5438.5438.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 696 944 1 1 1 393.2172 784.4199 2 784.4191 0.0008 0 36.16 0.0029 K LSPANQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1668.1668.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 1704 5894 1 1 1 474.2744 946.5342 2 946.5343 -0.0001 0 54.28 4.80E-05 K MAILQIMK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6985.6985.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 1803 602 1 1 1 480.2667 958.5188 2 958.5196 -0.0008 1 53.45 9.50E-05 R QVSDVQKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1306.1306.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 1840 4813 1 1 1 482.2718 962.529 2 962.5293 -0.0003 0 48.49 8.60E-05 K MAILQIMK E Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5832.5832.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 1941 3908 1 1 1 490.2692 978.5238 2 978.5242 -0.0004 0 49.64 0.00013 K MAILQIMK E 2 Oxidation (M) 0.10000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4869.4869.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 2215 440 1 1 1 510.267 1018.5194 2 1018.5196 -0.0001 1 31.07 0.021 K YTKDHTVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1133.1133.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 2446 779 1 1 1 526.8011 1051.5876 2 1051.5886 -0.001 1 29.53 0.0065 R LRPEREPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1493.1493.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 2758 1538 1 1 1 550.3134 1098.6122 2 1098.6145 -0.0024 1 27.9 0.01 R GRVLVNDAQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2298.2298.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 2809 1020 1 1 1 555.8164 1109.6183 2 1109.6193 -0.001 1 49.47 6.50E-05 R LGDKHATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1749.1749.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 2871 3794 1 1 1 561.2667 1120.5189 2 1120.5183 0.0006 0 57.03 3.00E-05 R SGEGEVSGLMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4749.4749.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 3300 5891 1 1 1 593.7819 1185.5493 2 1185.5488 0.0005 0 45.75 0.00018 K DIVENYFMR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6982.6982.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 4742 2027 1 1 1 460.889 1379.6453 3 1379.6463 -0.001 1 29.62 0.0062 R SRSGEGEVSGLMR K Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2827.2827.3.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 6959 4869 1 1 1 893.4877 1784.9609 2 1784.9632 -0.0023 1 39.4 0.00036 K LTEDKADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5892.5892.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 6960 4844 1 1 1 595.9954 1784.9643 3 1784.9632 0.001 1 54.84 1.00E-05 K LTEDKADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5866.5866.3.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 7030 2689 1 1 1 907.47 1812.9254 2 1812.933 -0.0076 1 78.86 9.50E-08 R VLVNDAQKVTEGQQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3543.3543.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 7031 2675 1 1 1 605.3171 1812.9296 3 1812.933 -0.0034 1 63.86 2.70E-06 R VLVNDAQKVTEGQQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3523.3523.3.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 7214 5187 1 1 1 626.6388 1876.8946 3 1876.8955 -0.001 0 46.59 4.30E-05 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6231.6231.3.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 7215 5136 1 1 1 939.455 1876.8954 2 1876.8955 -0.0002 0 66.49 3.40E-06 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6177.6177.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 7427 6078 1 1 1 977.0004 1951.9862 2 1951.9891 -0.0029 0 33.89 0.00066 K VFPGSTTEDYNLIVIER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7171.7171.2.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 7539 2915 1 1 1 673.6858 2018.0355 3 2018.0367 -0.0012 0 65.09 7.90E-07 K IVAERPGTNSTGPAPMAPPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3796.3796.3.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 7558 2236 1 1 1 679.0168 2034.0287 3 2034.0316 -0.0029 0 55.85 8.60E-06 K IVAERPGTNSTGPAPMAPPR A Oxidation (M) 0.00000000000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3050.3050.3.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 7869 4977 1 1 1 792.7314 2375.1723 3 2375.1757 -0.0034 1 34.47 0.00059 R LQEKLSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6007.6007.3.dta 5 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 683 90261 27 27 21 21 8036 4350 1 1 1 622.5418 2486.1381 4 2486.1397 -0.0016 1 45.08 6.70E-05 R DCQLNAHKDHQYQFLEDAVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5339.5339.4.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 307 1989 1 0 1 344.2059 686.3973 2 686.3963 0.001 0 32.96 0.014 R VQVDVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2787.2787.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 354 543 1 0 1 349.2035 696.3924 2 696.3919 0.0006 0 28.41 0.011 K HATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1242.1242.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 358 3083 1 0 0 350.1781 698.3416 2 698.3388 0.0028 0 29.12 0.012 R FFETR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3987.3987.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 514 4442 1 0 1 372.255 742.4954 2 742.4953 0.0001 0 32.23 0.0047 K LLASLVK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5438.5438.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 696 944 1 0 1 393.2172 784.4199 2 784.4191 0.0008 0 36.16 0.0029 K LSPANQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1668.1668.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 1704 5894 1 0 1 474.2744 946.5342 2 946.5343 -0.0001 0 54.28 4.80E-05 K MAILQIMK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6985.6985.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 1803 602 1 0 1 480.2667 958.5188 2 958.5196 -0.0008 1 53.45 9.50E-05 R QVSDVQKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1306.1306.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 1840 4813 1 0 1 482.2718 962.529 2 962.5293 -0.0003 0 48.49 8.60E-05 K MAILQIMK E Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5832.5832.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 1941 3908 1 0 1 490.2692 978.5238 2 978.5242 -0.0004 0 49.64 0.00013 K MAILQIMK E 2 Oxidation (M) 0.10000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4869.4869.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 2446 779 1 0 1 526.8011 1051.5876 2 1051.5886 -0.001 1 29.53 0.0065 R LRPEREPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1493.1493.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 2758 1538 1 0 1 550.3134 1098.6122 2 1098.6145 -0.0024 1 27.9 0.01 R GRVLVNDAQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2298.2298.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 2809 1020 1 0 1 555.8164 1109.6183 2 1109.6193 -0.001 1 49.47 6.50E-05 R LGDKHATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1749.1749.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 2871 3794 1 0 1 561.2667 1120.5189 2 1120.5183 0.0006 0 57.03 3.00E-05 R SGEGEVSGLMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4749.4749.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 4742 2027 1 0 1 460.889 1379.6453 3 1379.6463 -0.001 1 29.62 0.0062 R SRSGEGEVSGLMR K Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2827.2827.3.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 6959 4869 1 0 1 893.4877 1784.9609 2 1784.9632 -0.0023 1 39.4 0.00036 K LTEDKADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5892.5892.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 6960 4844 1 0 1 595.9954 1784.9643 3 1784.9632 0.001 1 54.84 1.00E-05 K LTEDKADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5866.5866.3.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 7030 2689 1 0 1 907.47 1812.9254 2 1812.933 -0.0076 1 78.86 9.50E-08 R VLVNDAQKVTEGQQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3543.3543.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 7031 2675 1 0 1 605.3171 1812.9296 3 1812.933 -0.0034 1 63.86 2.70E-06 R VLVNDAQKVTEGQQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3523.3523.3.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 7214 5187 1 0 1 626.6388 1876.8946 3 1876.8955 -0.001 0 46.59 4.30E-05 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6231.6231.3.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 7215 5136 1 0 1 939.455 1876.8954 2 1876.8955 -0.0002 0 66.49 3.40E-06 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6177.6177.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 7427 6078 1 0 1 977.0004 1951.9862 2 1951.9891 -0.0029 0 33.89 0.00066 K VFPGSTTEDYNLIVIER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7171.7171.2.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 7539 2915 1 0 1 673.6858 2018.0355 3 2018.0367 -0.0012 0 65.09 7.90E-07 K IVAERPGTNSTGPAPMAPPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3796.3796.3.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 7558 2236 1 0 1 679.0168 2034.0287 3 2034.0316 -0.0029 0 55.85 8.60E-06 K IVAERPGTNSTGPAPMAPPR A Oxidation (M) 0.00000000000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3050.3050.3.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 7869 4977 1 0 1 792.7314 2375.1723 3 2375.1757 -0.0034 1 34.47 0.00059 R LQEKLSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6007.6007.3.dta 5 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 654 80621 25 25 19 19 8036 4350 1 0 1 622.5418 2486.1381 4 2486.1397 -0.0016 1 45.08 6.70E-05 R DCQLNAHKDHQYQFLEDAVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5339.5339.4.dta 5 IPI00550037.3 "28S ribosomal protein S15, mitochondrial precursor" 32 29937 1 1 1 1 514 4442 1 0 1 372.255 742.4954 2 742.4953 0.0001 0 32.23 0.0047 R IIALSVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5438.5438.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 95 2352 1 1 1 311.1714 620.3283 2 620.3282 0.0001 0 28.27 0.034 R VAFER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3174.3174.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 452 2928 1 1 1 362.7214 723.4283 2 723.4279 0.0004 0 31.71 0.0029 K LPIEPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3811.3811.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 525 596 1 1 1 373.7296 745.4447 2 745.4446 0.0001 1 25.84 0.032 R TRAISAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1300.1300.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 589 1172 1 1 1 380.7013 759.388 2 759.3875 0.0005 0 39.58 0.0036 K TNLEQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1910.1910.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 884 3956 1 1 1 409.7314 817.4482 2 817.448 0.0002 0 33.91 0.015 R LNMATLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4920.4920.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 1485 1814 1 1 1 305.5157 913.5251 3 913.5246 0.0005 1 23.74 0.038 K RLGYIHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2600.2600.3.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 1503 1535 1 1 1 459.2741 916.5337 2 916.5342 -0.0005 1 25.06 0.036 R KILTTEGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2295.2295.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 1585 1346 1 1 1 466.1988 930.383 2 930.3831 -0.0002 0 41.19 0.00017 R YDNGSGYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2094.2094.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 1657 3113 1 1 1 470.7468 939.4791 2 939.4814 -0.0023 0 45.98 0.00046 R LNQYFQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4019.4019.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 1970 1317 1 1 1 493.7576 985.5006 2 985.4981 0.0025 0 36.11 0.005 R YGDGPRPPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2063.2063.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 2051 3413 1 1 1 498.7439 995.4732 2 995.4746 -0.0014 0 14.71 0.042 K MTPSYEIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4343.4343.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 2155 2962 1 1 1 506.7415 1011.4685 2 1011.4695 -0.001 0 26.26 0.026 K MTPSYEIR A Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3851.3851.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 2601 2995 1 1 1 538.2803 1074.546 2 1074.5458 0.0002 0 41.08 0.00019 K LAQFEPSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3891.3891.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 2700 2360 1 1 1 363.2123 1086.6152 3 1086.6145 0.0007 1 41.34 0.001 R RISAVSVAER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3182.3182.3.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3118 4877 1 1 1 579.3346 1156.6546 2 1156.6492 0.0054 0 52.14 1.30E-05 K VFDPVPVGVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5901.5901.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3119 5828 1 1 1 579.7737 1157.5329 2 1157.5328 0.0001 0 43.31 0.00062 K NFLYAWCGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6918.6918.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3247 3706 1 1 1 588.3059 1174.5973 2 1174.5982 -0.001 0 33.96 0.0051 R DVVQAYPEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4654.4654.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3301 1209 1 1 1 593.783 1185.5514 2 1185.5527 -0.0013 0 36.65 0.0013 K YTQVGPDHNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1949.1949.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3302 2858 1 1 1 593.7949 1185.5753 2 1185.5778 -0.0025 1 45.48 0.00049 R GANLKDYYSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3734.3734.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3304 2871 1 1 1 396.2 1185.578 3 1185.5778 0.0002 1 19.46 0.018 R GANLKDYYSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3748.3748.3.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3385 2458 1 1 1 599.3155 1196.6164 2 1196.6189 -0.0025 1 43.92 0.00061 R LNQYFQKEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3288.3288.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3549 2112 1 1 1 406.8754 1217.6043 3 1217.604 0.0002 1 15.35 0.044 R VAFERGEEPGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2918.2918.3.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3568 4795 1 1 1 611.3631 1220.7116 2 1220.7128 -0.0012 0 24.29 0.011 R TPLHEIALSIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5813.5813.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 3569 4781 1 1 1 407.9114 1220.7124 3 1220.7128 -0.0005 0 37.54 0.00071 R TPLHEIALSIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5798.5798.3.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 4083 4159 1 1 1 643.3788 1284.7431 2 1284.7442 -0.0011 1 58.09 1.10E-05 R KVFDPVPVGVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5135.5135.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 4111 4799 1 1 1 644.8558 1287.697 2 1287.6969 0.0001 0 80.36 1.50E-07 K LAAQSCALSLVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5818.5818.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 4816 4460 1 1 1 464.553 1390.6371 3 1390.6373 -0.0002 0 23.38 0.0064 R LETHMTPEMFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5456.5456.3.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 4963 4226 1 1 1 472.9378 1415.7916 3 1415.7918 -0.0003 1 29.16 0.0018 K KLAAQSCALSLVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5206.5206.3.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 5466 3888 1 1 1 501.935 1502.7832 3 1502.7841 -0.001 0 53.23 1.00E-05 R GISHVIVDEIHER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4848.4848.3.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 5840 5283 1 1 1 790.4243 1578.8341 2 1578.8365 -0.0025 0 69.22 3.20E-07 K QPAIISQLDPVNER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6334.6334.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 6820 5638 1 1 1 871.4326 1740.8507 2 1740.853 -0.0023 0 93.09 6.10E-09 R ELDALDANDELTPLGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6711.6711.2.dta 6 1 IPI00742905.1 ATP-dependent RNA helicase A 604 147921 32 32 29 29 7106 6252 1 1 1 613.6424 1837.9054 3 1837.9071 -0.0017 1 27.38 0.006 K DAQSNAARDFVNYLVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7351.7351.3.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 564 1707 1 1 0 378.7054 755.3962 2 755.3926 0.0036 0 51.03 0.00011 R AGGPGLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2485.2485.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 1894 5361 1 1 0 486.2869 970.5592 2 970.56 -0.0008 0 23.34 0.018 R LLGWIQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6415.6415.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 2126 2320 1 1 0 504.2665 1006.5185 2 1006.5196 -0.0011 0 41.07 0.00062 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3140.3140.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 2288 2624 1 1 1 515.7289 1029.4432 2 1029.4437 -0.0005 0 45.68 0.0001 K SSFTVDCSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3465.3465.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 2638 932 1 1 1 540.2825 1078.5505 2 1078.552 -0.0014 0 50.43 0.00023 R VNVGAGSHPNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1655.1655.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 2701 3907 1 1 1 544.7861 1087.5576 2 1087.5583 -0.0007 0 53.15 0.00011 R TPCEEILVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4868.4868.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 2755 2893 1 1 1 550.2903 1098.566 2 1098.5669 -0.0009 0 39.17 0.0012 K GTVEPQLEAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3771.3771.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 3598 4809 1 1 1 613.8291 1225.6437 2 1225.6455 -0.0019 0 78.26 2.40E-07 R AWGPGLEGGVVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5828.5828.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 4081 5880 1 1 1 643.3659 1284.7173 2 1284.719 -0.0018 0 31.87 0.0022 K LPQLPITNFSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6970.6970.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 4884 5355 1 1 1 700.8264 1399.6382 2 1399.6408 -0.0027 0 41.12 0.0009 K YGGDEIPFSPYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6408.6408.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 4958 5222 1 1 1 708.3782 1414.7418 2 1414.7416 0.0002 0 75.87 7.70E-08 R IANLQTDLSDGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6269.6269.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 5044 3450 1 1 1 715.3616 1428.7087 2 1428.711 -0.0023 0 84.46 3.40E-08 K AFGPGLQGGSAGSPAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4383.4383.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 5064 4221 1 1 1 717.8631 1433.7116 2 1433.7151 -0.0034 0 77.74 2.50E-07 R ANLPQSFQVDTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5201.5201.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 5172 3192 1 1 1 725.3572 1448.6998 2 1448.697 0.0028 0 17.5 0.032 R AYGPGIEPTGNMVK K Oxidation (M) 0.00000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4107.4107.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 5588 6316 1 1 1 767.3885 1532.7624 2 1532.7623 0.0001 0 40.84 0.00046 R AEAGVPAEFSIWTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7416.7416.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 5590 5751 1 1 1 767.4114 1532.8082 2 1532.8086 -0.0004 0 37 0.0033 K SPFSVAVSPSLDLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6831.6831.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 6230 3642 1 1 1 549.6295 1645.8665 3 1645.8675 -0.001 0 42.03 0.00016 K TGVAVNKPAEFTVDAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4587.4587.3.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 6277 3202 1 1 1 826.935 1651.8554 2 1651.8529 0.0025 0 45.61 0.00014 K VTAQGPGLEPSGNIANK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4118.4118.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 6909 3896 1 1 1 882.432 1762.8495 2 1762.8486 0.0009 0 34.03 0.00064 R VANPSGNLTETYVQDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4856.4856.2.dta 7 1 IPI00302592.2 "filamin A, alpha" 565 282581 20 20 20 20 6966 1399 1 1 1 597.2805 1788.8197 3 1788.8213 -0.0016 0 47.7 4.40E-05 K ATCAPQHGAPGPGPADASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2150.2150.3.dta 7 2 IPI00289334.1 Isoform 1 of Filamin-B 150 280188 7 7 7 7 564 1707 1 0 0 378.7054 755.3962 2 755.3926 0.0036 0 51.03 0.00011 R AGGPGLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2485.2485.2.dta 7 2 IPI00289334.1 Isoform 1 of Filamin-B 150 280188 7 7 7 7 1182 3080 1 0 1 430.735 859.4554 2 859.4552 0.0001 0 23.17 0.014 K VFGPGVER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3981.3981.2.dta 7 2 IPI00289334.1 Isoform 1 of Filamin-B 150 280188 7 7 7 7 1894 5361 1 0 0 486.2869 970.5592 2 970.56 -0.0008 0 23.34 0.018 R LLGWIQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6415.6415.2.dta 7 2 IPI00289334.1 Isoform 1 of Filamin-B 150 280188 7 7 7 7 2126 2320 1 0 0 504.2665 1006.5185 2 1006.5196 -0.0011 0 41.07 0.00062 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3140.3140.2.dta 7 2 IPI00289334.1 Isoform 1 of Filamin-B 150 280188 7 7 7 7 3166 1296 1 0 1 388.8759 1163.606 3 1163.6047 0.0013 0 17.35 0.024 R VNIGQGSHPQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2040.2040.3.dta 7 2 IPI00289334.1 Isoform 1 of Filamin-B 150 280188 7 7 7 7 5714 6034 1 0 1 781.4217 1560.8288 2 1560.83 -0.0012 0 59.23 1.10E-05 K VLFASQEIPASPFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7127.7127.2.dta 7 2 IPI00289334.1 Isoform 1 of Filamin-B 150 280188 7 7 7 7 6910 5956 1 0 1 882.4351 1762.8556 2 1762.856 -0.0004 0 53.73 3.80E-05 K SGCIVNNLAEFTVDPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7048.7048.2.dta 7 IPI00382698.1 Isoform 4 of Filamin-B 122 232499 6 6 6 6 1182 3080 1 0 1 430.735 859.4554 2 859.4552 0.0001 0 23.17 0.014 K VFGPGVER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3981.3981.2.dta 7 IPI00382698.1 Isoform 4 of Filamin-B 122 232499 6 6 6 6 1894 5361 1 0 0 486.2869 970.5592 2 970.56 -0.0008 0 23.34 0.018 R LLGWIQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6415.6415.2.dta 7 IPI00382698.1 Isoform 4 of Filamin-B 122 232499 6 6 6 6 2126 2320 1 0 0 504.2665 1006.5185 2 1006.5196 -0.0011 0 41.07 0.00062 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3140.3140.2.dta 7 IPI00382698.1 Isoform 4 of Filamin-B 122 232499 6 6 6 6 3166 1296 1 0 1 388.8759 1163.606 3 1163.6047 0.0013 0 17.35 0.024 R VNIGQGSHPQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2040.2040.3.dta 7 IPI00382698.1 Isoform 4 of Filamin-B 122 232499 6 6 6 6 5714 6034 1 0 1 781.4217 1560.8288 2 1560.83 -0.0012 0 59.23 1.10E-05 K VLFASQEIPASPFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7127.7127.2.dta 7 IPI00382698.1 Isoform 4 of Filamin-B 122 232499 6 6 6 6 6910 5956 1 0 1 882.4351 1762.8556 2 1762.856 -0.0004 0 53.73 3.80E-05 K SGCIVNNLAEFTVDPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7048.7048.2.dta 7 IPI00553169.3 "Filamin A, alpha" 111 28176 2 2 2 2 2638 932 1 0 1 540.2825 1078.5505 2 1078.552 -0.0014 0 50.43 0.00023 R VNVGAGSHPNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1655.1655.2.dta 7 IPI00553169.3 "Filamin A, alpha" 111 28176 2 2 2 2 5044 3450 1 0 1 715.3616 1428.7087 2 1428.711 -0.0023 0 84.46 3.40E-08 K AFGPGLQGGSAGSPAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4383.4383.2.dta 7 IPI00552416.3 "Filamin A, alpha" 95 52192 2 2 2 2 4884 5355 1 0 1 700.8264 1399.6382 2 1399.6408 -0.0027 0 41.12 0.0009 K YGGDEIPFSPYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6408.6408.2.dta 7 IPI00552416.3 "Filamin A, alpha" 95 52192 2 2 2 2 5064 4221 1 0 1 717.8631 1433.7116 2 1433.7151 -0.0034 0 77.74 2.50E-07 R ANLPQSFQVDTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5201.5201.2.dta 7 IPI00552858.2 "Filamin A, alpha" 70 36523 2 2 2 2 564 1707 1 0 0 378.7054 755.3962 2 755.3926 0.0036 0 51.03 0.00011 R AGGPGLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2485.2485.2.dta 7 IPI00552858.2 "Filamin A, alpha" 70 36523 2 2 2 2 5588 6316 1 0 1 767.3885 1532.7624 2 1532.7623 0.0001 0 40.84 0.00046 R AEAGVPAEFSIWTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7416.7416.2.dta 7 IPI00798140.1 111 kDa protein 51 112109 1 1 1 1 564 1707 1 0 0 378.7054 755.3962 2 755.3926 0.0036 0 51.03 0.00011 R AGGPGLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2485.2485.2.dta 7 IPI00178352.4 Isoform 1 of Filamin-C 44 293678 2 2 2 2 1894 5361 1 0 0 486.2869 970.5592 2 970.56 -0.0008 0 23.34 0.018 R LLGWIQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6415.6415.2.dta 7 IPI00178352.4 Isoform 1 of Filamin-C 44 293678 2 2 2 2 2126 2320 1 0 0 504.2665 1006.5185 2 1006.5196 -0.0011 0 41.07 0.00062 K IQQNTFTR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3140.3140.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 668 1578 1 1 1 390.1938 778.373 2 778.3722 0.0008 0 35.87 0.00043 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2341.2341.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 2027 2040 1 1 1 332.1944 993.5613 3 993.5607 0.0006 0 24.17 0.031 R LQGEIAHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2841.2841.3.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 2111 2311 1 1 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 2668 4425 1 1 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 2669 4443 1 1 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 2792 2573 1 1 0 554.272 1106.5295 2 1106.5356 -0.0061 0 57.58 3.00E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3411.3411.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 2941 3356 1 1 1 566.2584 1130.5022 2 1130.5026 -0.0005 0 50.67 1.80E-05 R STSSFSCLSR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4283.4283.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 2949 2002 1 1 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 3377 1636 1 1 1 599.2782 1196.5418 2 1196.5422 -0.0004 0 80.3 1.00E-07 K GGSISGGGYGSGGGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2403.2403.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 3839 2730 1 1 1 627.8073 1253.6001 2 1253.6001 0 0 99.54 2.00E-09 R GFSSGSAVVSGGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3590.3590.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 4350 2857 1 1 1 660.7936 1319.5726 2 1319.5756 -0.003 0 87.52 6.20E-09 R HGGGGGGFGGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3733.3733.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 4351 2855 1 1 1 440.8659 1319.576 3 1319.5756 0.0004 0 48.07 0.00011 R HGGGGGGFGGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3731.3731.3.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 4413 3964 1 1 1 665.322 1328.6295 2 1328.632 -0.0025 0 80.84 2.60E-08 K NVQDAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4929.4929.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 4445 3467 1 1 1 446.2418 1335.7035 3 1335.7034 0.0001 1 17.31 0.035 R TAAENDFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4401.4401.3.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 4821 1862 1 1 1 464.5644 1390.6713 3 1390.6728 -0.0015 1 30.71 0.012 R SKEEAEALYHSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2651.2651.3.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 4868 4848 1 1 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 1 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 535 66110 17 17 14 14 4869 4845 1 1 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 183 671 1 0 0 322.2289 642.4432 2 642.4428 0.0003 1 32.86 0.0014 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1380.1380.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 200 367 1 0 1 323.6983 645.3821 2 645.381 0.0012 1 29.7 0.034 K KIETR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1058.1058.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 379 762 1 0 1 352.191 702.3675 2 702.3661 0.0014 0 32.42 0.021 K VSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1475.1475.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 1224 557 1 0 1 434.7227 867.4308 2 867.4311 -0.0003 1 38.52 0.0024 K HGDDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1257.1257.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 1241 2378 1 0 1 435.7199 869.4253 2 869.4243 0.001 0 59.25 1.70E-05 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3202.3202.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 1595 2141 1 0 0 466.7375 931.4604 2 931.461 -0.0006 0 38.5 0.0014 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2949.2949.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 2084 4085 1 0 1 500.7874 999.5602 2 999.56 0.0002 0 39.97 0.0013 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5056.5056.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 2296 4956 1 0 1 515.7876 1029.5606 2 1029.5607 -0.0001 0 40.3 0.002 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5985.5985.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 2500 1841 1 0 0 530.785 1059.5554 2 1059.556 -0.0006 1 32.9 0.0068 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2629.2629.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 2660 1603 1 0 1 361.1932 1080.5578 3 1080.5564 0.0014 1 35.99 0.0013 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2367.2367.3.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 3100 4152 1 0 0 577.2811 1152.5476 2 1152.5485 -0.0009 0 18.86 0.021 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5127.5127.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 3232 2917 1 0 1 587.3268 1172.639 2 1172.6289 0.0102 0 15.99 0.038 K LVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3798.3798.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 3582 1028 1 0 1 612.7976 1223.5807 2 1223.5816 -0.0009 1 17.03 0.026 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1756.1756.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 4356 6394 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 87.23 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7496.7496.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 4468 3210 1 0 1 671.3774 1340.7402 2 1340.7412 -0.001 1 60.57 1.20E-05 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4127.4127.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 4485 5191 1 0 1 672.841 1343.6675 2 1343.6681 -0.0006 0 66.54 1.90E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6236.6236.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 5304 3744 1 0 1 491.9311 1472.7714 3 1472.7722 -0.0008 1 56.94 1.70E-05 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4695.4695.3.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 5378 4872 1 0 1 494.2604 1479.7595 3 1479.7643 -0.0048 1 26.99 0.0092 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5895.5895.3.dta 8 2 IPI00554648.3 "Keratin, type II cytoskeletal 8" 485 53671 24 24 22 22 6989 4283 1 0 1 599.949 1796.8251 3 1796.825 0.0001 1 33.72 0.00087 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5267.5267.3.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 1996 664 1 0 1 495.2304 988.4463 2 988.4462 0.0001 0 39.8 0.00019 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1372.1372.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 2792 2573 1 0 0 554.272 1106.5295 2 1106.5356 -0.0061 0 57.58 3.00E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3411.3411.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 2949 2002 1 0 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 3100 4152 1 0 0 577.2811 1152.5476 2 1152.5485 -0.0009 0 18.86 0.021 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5127.5127.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 4924 6361 1 0 1 704.3586 1406.7026 2 1406.7041 -0.0015 0 68.94 2.30E-06 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7463.7463.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 5005 3255 1 0 1 712.819 1423.6234 2 1423.6263 -0.0029 0 76.25 1.50E-07 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4175.4175.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 5153 3843 1 0 1 724.3923 1446.77 2 1446.7678 0.0022 0 66.95 1.00E-06 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4801.4801.2.dta 8 3 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 393 60273 14 14 12 12 5916 4072 1 0 1 799.883 1597.7514 2 1597.7519 -0.0004 0 40.86 0.00015 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5042.5042.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 1595 2141 1 0 0 466.7375 931.4604 2 931.461 -0.0006 0 38.5 0.0014 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2949.2949.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 2393 5017 1 0 1 523.2871 1044.5597 2 1044.5604 -0.0007 0 32.42 0.004 K WTLLQEQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6050.6050.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 2500 1841 1 0 0 530.785 1059.5554 2 1059.556 -0.0006 1 32.9 0.0068 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2629.2629.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 2779 3359 1 0 1 552.793 1103.5715 2 1103.5724 -0.0009 0 76.39 6.70E-07 R SAYGGPVGAGIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4286.4286.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 3998 6693 1 0 1 636.855 1271.6954 2 1271.6973 -0.0019 0 66.6 3.70E-06 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7816.7816.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 4770 3469 1 0 1 693.3704 1384.7263 2 1384.731 -0.0047 1 37.37 0.00031 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4403.4403.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 4771 3466 1 0 1 462.5842 1384.7309 3 1384.731 -0.0001 1 34.66 0.0056 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4400.4400.3.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 4970 6164 1 0 1 709.8663 1417.7181 2 1417.7201 -0.002 0 69.4 9.60E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7259.7259.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 5124 2905 1 0 1 721.3912 1440.7678 2 1440.7684 -0.0007 1 43.76 7.90E-05 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3784.3784.2.dta 8 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 369 51443 15 15 12 12 5416 3935 1 0 1 497.6122 1489.8149 3 1489.814 0.0009 1 21.33 0.01 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4898.4898.3.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 2949 2002 1 0 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 3351 2359 1 0 1 597.7901 1193.5656 2 1193.5676 -0.002 0 42.07 0.00026 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3181.3181.2.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 4937 3995 1 0 1 705.8626 1409.7107 2 1409.7151 -0.0044 0 42.9 0.00012 R SFSTASAITPSVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4962.4962.2.dta 8 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 230 62637 10 10 8 8 5116 4054 1 0 1 720.3621 1438.7096 2 1438.7053 0.0043 0 36.06 0.00042 R GLGVGFGSGGGSSSSVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5023.5023.2.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 190 2798 1 0 0 323.1818 644.3491 2 644.3493 -0.0002 0 30.32 0.042 R LDLER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3667.3667.2.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 365 1962 1 0 1 351.201 700.3874 2 700.3868 0.0006 0 56.44 5.30E-05 R SSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2758.2758.2.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 1274 1246 1 0 1 436.7092 871.4038 2 871.4035 0.0002 0 18.55 0.03 R SVSSSSYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1989.1989.2.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 1595 2141 1 0 0 466.7375 931.4604 2 931.461 -0.0006 0 38.5 0.0014 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2949.2949.2.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 2500 1841 1 0 0 530.785 1059.5554 2 1059.556 -0.0006 1 32.9 0.0068 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2629.2629.2.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 4094 1638 1 0 1 429.8933 1286.658 3 1286.6579 0.0001 1 24.25 0.013 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2405.2405.3.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 5032 3765 1 0 1 714.8595 1427.7044 2 1427.7045 0 0 63.08 1.20E-06 R SLYASSPGGVYATR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4718.4718.2.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 6532 4903 1 0 1 563.6149 1687.8228 3 1687.8199 0.0029 1 38.6 0.00024 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5928.5928.3.dta 8 6 IPI00418471.6 Vimentin 174 53676 10 10 10 10 6945 3748 1 0 1 592.959 1775.8553 3 1775.855 0.0003 1 23.92 0.039 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4700.4700.3.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 1996 664 1 0 1 495.2304 988.4463 2 988.4462 0.0001 0 39.8 0.00019 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1372.1372.2.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 2792 2573 1 0 0 554.272 1106.5295 2 1106.5356 -0.0061 0 57.58 3.00E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3411.3411.2.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 2949 2002 1 0 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 3100 4152 1 0 0 577.2811 1152.5476 2 1152.5485 -0.0009 0 18.86 0.021 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5127.5127.2.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 4924 6361 1 0 1 704.3586 1406.7026 2 1406.7041 -0.0015 0 68.94 2.30E-06 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7463.7463.2.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 5005 3255 1 0 1 712.819 1423.6234 2 1423.6263 -0.0029 0 76.25 1.50E-07 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4175.4175.2.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 5153 3843 1 0 1 724.3923 1446.77 2 1446.7678 0.0022 0 66.95 1.00E-06 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4801.4801.2.dta 8 IPI00816709.1 Keratin 6C 353 60245 11 11 10 10 5916 4072 1 0 1 799.883 1597.7514 2 1597.7519 -0.0004 0 40.86 0.00015 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5042.5042.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 1996 664 1 0 1 495.2304 988.4463 2 988.4462 0.0001 0 39.8 0.00019 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1372.1372.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 2792 2573 1 0 0 554.272 1106.5295 2 1106.5356 -0.0061 0 57.58 3.00E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3411.3411.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 2949 2002 1 0 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 3100 4152 1 0 0 577.2811 1152.5476 2 1152.5485 -0.0009 0 18.86 0.021 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5127.5127.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 4924 6361 1 0 1 704.3586 1406.7026 2 1406.7041 -0.0015 0 68.94 2.30E-06 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7463.7463.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 5005 3255 1 0 1 712.819 1423.6234 2 1423.6263 -0.0029 0 76.25 1.50E-07 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4175.4175.2.dta 8 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 346 60247 13 13 11 11 5916 4072 1 0 1 799.883 1597.7514 2 1597.7519 -0.0004 0 40.86 0.00015 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5042.5042.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 1224 557 1 0 1 434.7227 867.4308 2 867.4311 -0.0003 1 38.52 0.0024 K HGDDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1257.1257.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 1595 2141 1 0 0 466.7375 931.4604 2 931.461 -0.0006 0 38.5 0.0014 K LLEGEESR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2949.2949.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 2084 4085 1 0 1 500.7874 999.5602 2 999.56 0.0002 0 39.97 0.0013 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5056.5056.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 2500 1841 1 0 0 530.785 1059.5554 2 1059.556 -0.0006 1 32.9 0.0068 R KLLEGEESR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2629.2629.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 3100 4152 1 0 0 577.2811 1152.5476 2 1152.5485 -0.0009 0 18.86 0.021 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5127.5127.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 3582 1028 1 0 1 612.7976 1223.5807 2 1223.5816 -0.0009 1 17.03 0.026 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1756.1756.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 4356 6394 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 87.23 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7496.7496.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 4468 3210 1 0 1 671.3774 1340.7402 2 1340.7412 -0.001 1 60.57 1.20E-05 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4127.4127.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 4485 5191 1 0 1 672.841 1343.6675 2 1343.6681 -0.0006 0 66.54 1.90E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6236.6236.2.dta 8 IPI00793917.1 27 kDa protein 248 26765 10 10 10 10 6989 4283 1 0 1 599.949 1796.8251 3 1796.825 0.0001 1 33.72 0.00087 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5267.5267.3.dta 8 IPI00792642.1 25 kDa protein 232 24809 9 9 7 7 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00792642.1 25 kDa protein 232 24809 9 9 7 7 2296 4956 1 0 1 515.7876 1029.5606 2 1029.5607 -0.0001 0 40.3 0.002 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5985.5985.2.dta 8 IPI00792642.1 25 kDa protein 232 24809 9 9 7 7 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 IPI00792642.1 25 kDa protein 232 24809 9 9 7 7 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 IPI00792642.1 25 kDa protein 232 24809 9 9 7 7 4356 6394 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 87.23 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7496.7496.2.dta 8 IPI00792642.1 25 kDa protein 232 24809 9 9 7 7 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 IPI00792642.1 25 kDa protein 232 24809 9 9 7 7 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 IPI00792642.1 25 kDa protein 232 24809 9 9 7 7 5378 4872 1 0 1 494.2604 1479.7595 3 1479.7643 -0.0048 1 26.99 0.0092 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5895.5895.3.dta 8 IPI00792642.1 25 kDa protein 232 24809 9 9 7 7 6989 4283 1 0 1 599.949 1796.8251 3 1796.825 0.0001 1 33.72 0.00087 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5267.5267.3.dta 8 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 222 42557 8 8 8 8 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 222 42557 8 8 8 8 1996 664 1 0 1 495.2304 988.4463 2 988.4462 0.0001 0 39.8 0.00019 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1372.1372.2.dta 8 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 222 42557 8 8 8 8 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 222 42557 8 8 8 8 2792 2573 1 0 0 554.272 1106.5295 2 1106.5356 -0.0061 0 57.58 3.00E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3411.3411.2.dta 8 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 222 42557 8 8 8 8 2949 2002 1 0 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 222 42557 8 8 8 8 3100 4152 1 0 0 577.2811 1152.5476 2 1152.5485 -0.0009 0 18.86 0.021 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5127.5127.2.dta 8 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 222 42557 8 8 8 8 4924 6361 1 0 1 704.3586 1406.7026 2 1406.7041 -0.0015 0 68.94 2.30E-06 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7463.7463.2.dta 8 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 222 42557 8 8 8 8 5153 3843 1 0 1 724.3923 1446.77 2 1446.7678 0.0022 0 66.95 1.00E-06 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4801.4801.2.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 379 762 1 0 1 352.191 702.3675 2 702.3661 0.0014 0 32.42 0.021 K VSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1475.1475.2.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 1241 2378 1 0 1 435.7199 869.4253 2 869.4243 0.001 0 59.25 1.70E-05 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3202.3202.2.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 2296 4956 1 0 1 515.7876 1029.5606 2 1029.5607 -0.0001 0 40.3 0.002 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5985.5985.2.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 2660 1603 1 0 1 361.1932 1080.5578 3 1080.5564 0.0014 1 35.99 0.0013 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2367.2367.3.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 IPI00791912.1 22 kDa protein 205 22195 10 10 8 8 5378 4872 1 0 1 494.2604 1479.7595 3 1479.7643 -0.0048 1 26.99 0.0092 R TEMENEFVLIKK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5895.5895.3.dta 8 IPI00795725.1 17 kDa protein 202 16798 6 6 6 6 1224 557 1 0 1 434.7227 867.4308 2 867.4311 -0.0003 1 38.52 0.0024 K HGDDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1257.1257.2.dta 8 IPI00795725.1 17 kDa protein 202 16798 6 6 6 6 2084 4085 1 0 1 500.7874 999.5602 2 999.56 0.0002 0 39.97 0.0013 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5056.5056.2.dta 8 IPI00795725.1 17 kDa protein 202 16798 6 6 6 6 3582 1028 1 0 1 612.7976 1223.5807 2 1223.5816 -0.0009 1 17.03 0.026 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1756.1756.2.dta 8 IPI00795725.1 17 kDa protein 202 16798 6 6 6 6 4356 6394 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 87.23 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7496.7496.2.dta 8 IPI00795725.1 17 kDa protein 202 16798 6 6 6 6 4468 3210 1 0 1 671.3774 1340.7402 2 1340.7412 -0.001 1 60.57 1.20E-05 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4127.4127.2.dta 8 IPI00795725.1 17 kDa protein 202 16798 6 6 6 6 4485 5191 1 0 1 672.841 1343.6675 2 1343.6681 -0.0006 0 66.54 1.90E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6236.6236.2.dta 8 IPI00791341.1 20 kDa protein 198 19686 9 9 7 7 379 762 1 0 1 352.191 702.3675 2 702.3661 0.0014 0 32.42 0.021 K VSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1475.1475.2.dta 8 IPI00791341.1 20 kDa protein 198 19686 9 9 7 7 1241 2378 1 0 1 435.7199 869.4253 2 869.4243 0.001 0 59.25 1.70E-05 R ISSSSFSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3202.3202.2.dta 8 IPI00791341.1 20 kDa protein 198 19686 9 9 7 7 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00791341.1 20 kDa protein 198 19686 9 9 7 7 2296 4956 1 0 1 515.7876 1029.5606 2 1029.5607 -0.0001 0 40.3 0.002 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5985.5985.2.dta 8 IPI00791341.1 20 kDa protein 198 19686 9 9 7 7 2660 1603 1 0 1 361.1932 1080.5578 3 1080.5564 0.0014 1 35.99 0.0013 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2367.2367.3.dta 8 IPI00791341.1 20 kDa protein 198 19686 9 9 7 7 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 IPI00791341.1 20 kDa protein 198 19686 9 9 7 7 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 IPI00791341.1 20 kDa protein 198 19686 9 9 7 7 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 IPI00791341.1 20 kDa protein 198 19686 9 9 7 7 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 197 47891 7 7 7 7 183 671 1 0 0 322.2289 642.4432 2 642.4428 0.0003 1 32.86 0.0014 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1380.1380.2.dta 8 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 197 47891 7 7 7 7 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 197 47891 7 7 7 7 2296 4956 1 0 1 515.7876 1029.5606 2 1029.5607 -0.0001 0 40.3 0.002 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5985.5985.2.dta 8 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 197 47891 7 7 7 7 3100 4152 1 0 0 577.2811 1152.5476 2 1152.5485 -0.0009 0 18.86 0.021 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5127.5127.2.dta 8 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 197 47891 7 7 7 7 4356 6394 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 87.23 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7496.7496.2.dta 8 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 197 47891 7 7 7 7 4485 5191 1 0 1 672.841 1343.6675 2 1343.6681 -0.0006 0 66.54 1.90E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6236.6236.2.dta 8 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 197 47891 7 7 7 7 6989 4283 1 0 1 599.949 1796.8251 3 1796.825 0.0001 1 33.72 0.00087 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5267.5267.3.dta 8 IPI00005859.2 Keratin-75 161 59809 7 7 5 5 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00005859.2 Keratin-75 161 59809 7 7 5 5 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 IPI00005859.2 Keratin-75 161 59809 7 7 5 5 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 IPI00005859.2 Keratin-75 161 59809 7 7 5 5 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 IPI00005859.2 Keratin-75 161 59809 7 7 5 5 2949 2002 1 0 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 IPI00005859.2 Keratin-75 161 59809 7 7 5 5 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 IPI00005859.2 Keratin-75 161 59809 7 7 5 5 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 IPI00300052.1 Keratin type II cuticular Hb4 149 65938 7 7 5 5 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00300052.1 Keratin type II cuticular Hb4 149 65938 7 7 5 5 1595 2141 1 0 0 466.7375 931.4604 2 931.461 -0.0006 0 38.5 0.0014 R LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2949.2949.2.dta 8 IPI00300052.1 Keratin type II cuticular Hb4 149 65938 7 7 5 5 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 IPI00300052.1 Keratin type II cuticular Hb4 149 65938 7 7 5 5 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 IPI00300052.1 Keratin type II cuticular Hb4 149 65938 7 7 5 5 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 IPI00300052.1 Keratin type II cuticular Hb4 149 65938 7 7 5 5 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 IPI00300052.1 Keratin type II cuticular Hb4 149 65938 7 7 5 5 5416 3935 1 0 1 497.6122 1489.8149 3 1489.814 0.0009 1 21.33 0.01 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4898.4898.3.dta 8 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 149 30826 4 4 4 4 183 671 1 0 0 322.2289 642.4432 2 642.4428 0.0003 1 32.86 0.0014 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1380.1380.2.dta 8 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 149 30826 4 4 4 4 3100 4152 1 0 0 577.2811 1152.5476 2 1152.5485 -0.0009 0 18.86 0.021 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5127.5127.2.dta 8 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 149 30826 4 4 4 4 4356 6394 1 0 1 660.8392 1319.6638 2 1319.6642 -0.0005 0 87.23 1.30E-08 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7496.7496.2.dta 8 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 149 30826 4 4 4 4 4485 5191 1 0 1 672.841 1343.6675 2 1343.6681 -0.0006 0 66.54 1.90E-06 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6236.6236.2.dta 8 IPI00017870.1 Keratin-8-like protein 1 129 55459 6 6 5 5 1595 2141 1 0 0 466.7375 931.4604 2 931.461 -0.0006 0 38.5 0.0014 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2949.2949.2.dta 8 IPI00017870.1 Keratin-8-like protein 1 129 55459 6 6 5 5 2296 4956 1 0 1 515.7876 1029.5606 2 1029.5607 -0.0001 0 40.3 0.002 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5985.5985.2.dta 8 IPI00017870.1 Keratin-8-like protein 1 129 55459 6 6 5 5 2500 1841 1 0 0 530.785 1059.5554 2 1059.556 -0.0006 1 32.9 0.0068 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2629.2629.2.dta 8 IPI00017870.1 Keratin-8-like protein 1 129 55459 6 6 5 5 3582 1028 1 0 1 612.7976 1223.5807 2 1223.5816 -0.0009 1 17.03 0.026 R TKTEISEMNR N Oxidation (M) 0.0000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1756.1756.2.dta 8 IPI00017870.1 Keratin-8-like protein 1 129 55459 6 6 5 5 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 IPI00017870.1 Keratin-8-like protein 1 129 55459 6 6 5 5 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 IPI00241841.8 keratin 6L 127 58085 5 5 3 3 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00241841.8 keratin 6L 127 58085 5 5 3 3 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 IPI00241841.8 keratin 6L 127 58085 5 5 3 3 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 IPI00241841.8 keratin 6L 127 58085 5 5 3 3 4868 4848 1 0 0 699.3735 1396.7324 2 1396.735 -0.0027 1 57.14 4.50E-06 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5870.5870.2.dta 8 IPI00241841.8 keratin 6L 127 58085 5 5 3 3 4869 4845 1 0 0 466.5859 1396.7358 3 1396.735 0.0008 1 49.34 0.00023 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5867.5867.3.dta 8 IPI00792167.1 9 kDa protein 112 8852 2 2 2 2 3998 6693 1 0 1 636.855 1271.6954 2 1271.6973 -0.0019 0 66.6 3.70E-06 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7816.7816.2.dta 8 IPI00792167.1 9 kDa protein 112 8852 2 2 2 2 4970 6164 1 0 1 709.8663 1417.7181 2 1417.7201 -0.002 0 69.4 9.60E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7259.7259.2.dta 8 IPI00796330.1 18 kDa protein 102 18135 2 2 2 2 2792 2573 1 0 0 554.272 1106.5295 2 1106.5356 -0.0061 0 57.58 3.00E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3411.3411.2.dta 8 IPI00796330.1 18 kDa protein 102 18135 2 2 2 2 4924 6361 1 0 1 704.3586 1406.7026 2 1406.7041 -0.0015 0 68.94 2.30E-06 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7463.7463.2.dta 8 IPI00655639.1 Hypothetical protein (Fragment) 90 12922 2 2 2 2 3998 6693 1 0 1 636.855 1271.6954 2 1271.6973 -0.0019 0 66.6 3.70E-06 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7816.7816.2.dta 8 IPI00655639.1 Hypothetical protein (Fragment) 90 12922 2 2 2 2 5124 2905 1 0 1 721.3912 1440.7678 2 1440.7684 -0.0007 1 43.76 7.90E-05 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3784.3784.2.dta 8 IPI00174775.2 Keratin 6 irs3 80 59457 4 4 3 3 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 IPI00174775.2 Keratin 6 irs3 80 59457 4 4 3 3 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 IPI00174775.2 Keratin 6 irs3 80 59457 4 4 3 3 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 IPI00174775.2 Keratin 6 irs3 80 59457 4 4 3 3 2949 2002 1 0 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 IPI00791554.1 17 kDa protein 79 17100 4 4 3 3 1595 2141 1 0 0 466.7375 931.4604 2 931.461 -0.0006 0 38.5 0.0014 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2949.2949.2.dta 8 IPI00791554.1 17 kDa protein 79 17100 4 4 3 3 2500 1841 1 0 0 530.785 1059.5554 2 1059.556 -0.0006 1 32.9 0.0068 R KLLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2629.2629.2.dta 8 IPI00791554.1 17 kDa protein 79 17100 4 4 3 3 4770 3469 1 0 1 693.3704 1384.7263 2 1384.731 -0.0047 1 37.37 0.00031 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4403.4403.2.dta 8 IPI00791554.1 17 kDa protein 79 17100 4 4 3 3 4771 3466 1 0 1 462.5842 1384.7309 3 1384.731 -0.0001 1 34.66 0.0056 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4400.4400.3.dta 8 IPI00795197.1 24 kDa protein 77 24107 3 3 3 3 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 IPI00795197.1 24 kDa protein 77 24107 3 3 3 3 2949 2002 1 0 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 IPI00795197.1 24 kDa protein 77 24107 3 3 3 3 3351 2359 1 0 1 597.7901 1193.5656 2 1193.5676 -0.002 0 42.07 0.00026 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3181.3181.2.dta 8 IPI00793572.1 6 kDa protein 69 6322 1 1 1 1 4970 6164 1 0 1 709.8663 1417.7181 2 1417.7201 -0.002 0 69.4 9.60E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7259.7259.2.dta 8 IPI00166205.2 Keratin-78 62 57728 3 3 3 3 23 860 4 0 1 301.1745 600.3344 2 600.3343 0.0001 0 27.1 0.039 K QNLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1578.1578.2.dta 8 IPI00166205.2 Keratin-78 62 57728 3 3 3 3 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00166205.2 Keratin-78 62 57728 3 3 3 3 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 R LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 IPI00793202.1 14 kDa protein 60 14435 3 3 3 3 2296 4956 1 0 1 515.7876 1029.5606 2 1029.5607 -0.0001 0 40.3 0.002 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5985.5985.2.dta 8 IPI00793202.1 14 kDa protein 60 14435 3 3 3 3 5378 4872 1 0 1 494.2604 1479.7595 3 1479.7643 -0.0048 1 26.99 0.0092 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5895.5895.3.dta 8 IPI00793202.1 14 kDa protein 60 14435 3 3 3 3 6989 4283 1 0 1 599.949 1796.8251 3 1796.825 0.0001 1 33.72 0.00087 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5267.5267.3.dta 8 IPI00290078.5 keratin 4 58 64442 1 1 1 1 2792 2573 1 0 0 554.272 1106.5295 2 1106.5356 -0.0061 0 57.58 3.00E-05 R AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3411.3411.2.dta 8 IPI00021751.5 Neurofilament triplet H protein 53 112640 2 2 2 2 2111 2311 1 0 0 503.2369 1004.4593 2 1004.4597 -0.0003 0 39.41 0.00024 K LLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3130.3130.2.dta 8 IPI00021751.5 Neurofilament triplet H protein 53 112640 2 2 2 2 2949 2002 1 0 0 567.2842 1132.5539 2 1132.5546 -0.0007 1 32.43 0.0043 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2800.2800.2.dta 8 IPI00465084.6 Desmin 52 53560 3 3 3 3 190 2798 1 0 1 323.1818 644.3491 2 644.3493 -0.0002 0 30.32 0.042 R IDLER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3667.3667.2.dta 8 IPI00465084.6 Desmin 52 53560 3 3 3 3 1595 2141 1 0 0 466.7375 931.4604 2 931.461 -0.0006 0 38.5 0.0014 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2949.2949.2.dta 8 IPI00465084.6 Desmin 52 53560 3 3 3 3 2500 1841 1 0 0 530.785 1059.5554 2 1059.556 -0.0006 1 32.9 0.0068 R KLLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2629.2629.2.dta 8 IPI00061200.3 Keratin-71 48 57769 2 2 1 1 2668 4425 1 0 0 361.5381 1081.5926 3 1081.592 0.0006 1 22.83 0.047 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5420.5420.3.dta 8 IPI00061200.3 Keratin-71 48 57769 2 2 1 1 2669 4443 1 0 0 541.8036 1081.5927 2 1081.592 0.0007 1 48.33 0.00025 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5439.5439.2.dta 8 IPI00025363.1 "Isoform 1 of Glial fibrillary acidic protein, astrocyte" 44 49907 2 2 2 2 190 2798 1 0 0 323.1818 644.3491 2 644.3493 -0.0002 0 30.32 0.042 R LDLER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3667.3667.2.dta 8 IPI00025363.1 "Isoform 1 of Glial fibrillary acidic protein, astrocyte" 44 49907 2 2 2 2 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00217437.4 Tau-tubulin kinase 43 185741 3 3 3 3 200 367 1 0 1 323.6983 645.3821 2 645.381 0.0012 1 29.7 0.034 K KIETR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1058.1058.2.dta 8 IPI00217437.4 Tau-tubulin kinase 43 185741 3 3 3 3 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00217437.4 Tau-tubulin kinase 43 185741 3 3 3 3 3100 4152 1 0 0 577.2811 1152.5476 2 1152.5485 -0.0009 0 18.86 0.021 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5127.5127.2.dta 8 IPI00032541.1 Keratin type II cuticular Hb5 42 57306 2 2 2 2 1444 2078 1 0 0 453.7376 905.4606 2 905.4607 -0.0001 0 41.31 0.0023 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2882.2882.2.dta 8 IPI00032541.1 Keratin type II cuticular Hb5 42 57306 2 2 2 2 5416 3935 1 0 1 497.6122 1489.8149 3 1489.814 0.0009 1 21.33 0.01 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4898.4898.3.dta 8 IPI00793849.1 Protein 42 22010 1 1 1 1 3351 2359 1 0 1 597.7901 1193.5656 2 1193.5676 -0.002 0 42.07 0.00026 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3181.3181.2.dta 8 IPI00791653.1 8 kDa protein 36 7516 1 1 1 1 668 1578 1 0 1 390.1938 778.373 2 778.3722 0.0008 0 35.87 0.00043 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2341.2341.2.dta 8 IPI00552689.1 Vimentin 29 20138 2 2 2 2 190 2798 1 0 0 323.1818 644.3491 2 644.3493 -0.0002 0 30.32 0.042 R LDLER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3667.3667.2.dta 8 IPI00552689.1 Vimentin 29 20138 2 2 2 2 6945 3748 1 0 1 592.959 1775.8553 3 1775.855 0.0003 1 23.92 0.039 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4700.4700.3.dta 8 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 27 11491 1 1 1 1 5378 4872 1 0 1 494.2604 1479.7595 3 1479.7643 -0.0048 1 26.99 0.0092 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5895.5895.3.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 172 2440 2 1 1 321.2027 640.3909 2 640.3908 0.0001 0 28.78 0.013 K QLPGVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3269.3269.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 188 3672 4 1 1 322.7212 643.4278 2 643.4268 0.001 0 22.96 0.032 K ILTLGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4618.4618.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 598 457 1 1 1 381.2297 760.4449 2 760.4443 0.0006 1 54.27 6.10E-05 K SGAALSKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1151.1151.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 670 6979 1 1 1 390.2115 778.4085 2 778.4086 -0.0001 0 34.05 0.0095 K HASHISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.811.811.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 885 547 1 1 1 409.7399 817.4653 2 817.4657 -0.0004 1 38.65 0.002 R GKSGAALSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1246.1246.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 1390 1029 1 1 1 450.7196 899.4246 2 899.425 -0.0004 0 43.91 7.60E-05 K TGNAWHSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1757.1757.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 1391 1031 1 1 1 300.8156 899.4248 3 899.425 -0.0001 0 17.39 0.023 K TGNAWHSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1759.1759.3.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 2369 1804 1 1 1 348.2017 1041.5832 3 1041.5818 0.0014 1 25.49 0.037 K QLPGVKSEGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2589.2589.3.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 2543 3326 1 1 1 533.7961 1065.5777 2 1065.5818 -0.0041 0 40.73 0.00058 K AEPVEVVAPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4251.4251.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 3296 4919 1 1 1 593.293 1184.5714 2 1184.5713 0 0 66.42 4.10E-06 K TLGDFAAEYAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5946.5946.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 4716 6229 1 1 1 689.3771 1376.7397 2 1376.7412 -0.0015 0 105.81 3.90E-10 R TTNFAGILSQGLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7326.7326.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 4879 3832 1 1 1 700.363 1398.7115 2 1398.7103 0.0012 0 63.22 1.20E-06 K QQVPSGESAILDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4789.4789.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 5437 2848 1 1 1 498.9471 1493.8194 3 1493.8202 -0.0007 0 36.26 0.0025 K KPPLLNNADSVQAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3722.3722.3.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 5836 5600 1 1 1 789.4039 1576.7933 2 1576.7959 -0.0026 0 47.8 4.50E-05 R IAPPEAPVTGYMFGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6670.6670.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 5902 4804 1 1 1 797.4025 1592.7904 2 1592.7909 -0.0005 0 24.96 0.012 R IAPPEAPVTGYMFGK G Oxidation (M) 0.000000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5823.5823.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 6068 5549 1 1 1 812.9054 1623.7962 2 1623.7992 -0.003 0 96.12 4.50E-09 R VVSEDFLQDVSASTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6616.6616.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 6803 4954 1 1 1 869.3736 1736.7326 2 1736.7352 -0.0026 0 68 5.90E-07 K SDAYYCTGDVTAWTK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5983.5983.2.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 7055 3160 1 1 1 609.272 1824.7943 3 1824.8014 -0.0071 1 16.63 0.028 R GGSDDSSKDPIDVNYEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4070.4070.3.dta 9 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 504 113811 19 19 17 17 7568 5362 1 1 1 682.0014 2042.9824 3 2042.9837 -0.0013 1 41.41 0.0002 K KFYPLEIDYGQDEEAVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6416.6416.3.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 98 2748 1 1 0 311.6813 621.348 2 621.3486 -0.0006 0 29.58 0.03 K SQFLK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3609.3609.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 456 1126 1 1 1 363.1956 724.3766 2 724.3755 0.001 0 33.17 0.00077 R AVYTSGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1861.1861.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 666 1949 1 1 1 389.2017 776.3888 2 776.385 0.0037 0 45.16 0.0012 R LSEAMAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2744.2744.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 951 988 1 1 1 415.7007 829.3869 2 829.3865 0.0004 0 47.42 0.00017 R NPVCANR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1715.1715.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 1123 4382 1 1 1 425.7364 849.4583 2 849.4596 -0.0013 0 45.72 0.00044 R FLLDTNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5374.5374.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 1512 1521 1 1 1 461.2351 920.4556 2 920.4563 -0.0007 0 28.48 0.035 K TTGEGTSLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2280.2280.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 2080 2121 1 1 1 500.7456 999.4766 2 999.4774 -0.0008 0 46.31 4.50E-05 K HVEEFSPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2927.2927.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 2123 3801 1 1 1 503.7877 1005.5608 2 1005.5607 0 1 27.08 0.026 R RFLLDTNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4756.4756.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 2300 4101 1 1 1 516.2344 1030.4542 2 1030.4542 0 0 48.46 2.90E-05 R LGFSEYCR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5073.5073.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 3290 2933 1 1 1 592.8165 1183.6184 2 1183.6197 -0.0013 0 88.57 2.00E-08 R IQETQAELPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3816.3816.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 3291 2972 1 1 1 592.8167 1183.6189 2 1183.6197 -0.0008 0 36.01 0.00043 R IQETQAELPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3863.3863.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 4748 3614 1 1 1 691.3329 1380.6513 2 1380.6521 -0.0008 0 74.44 2.30E-07 R VSGVDGYETEGIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4557.4557.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 4779 4712 1 1 1 693.8239 1385.6333 2 1385.6351 -0.0018 0 59.01 2.90E-06 K ESEDFIVEQYK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5725.5725.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 5295 6332 1 1 1 736.3643 1470.7141 2 1470.7143 -0.0003 0 49.23 9.20E-05 K DFYVAFQDLPTR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7433.7433.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 5987 5550 1 1 1 809.415 1616.8154 2 1616.8167 -0.0013 0 71.05 2.20E-07 R LVFLACCVAPTNPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6617.6617.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 6518 4746 1 1 1 843.4319 1684.8493 2 1684.8533 -0.0039 0 56.96 5.20E-06 R TSILAAANPISGHYDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5761.5761.2.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 6677 4161 1 1 1 569.9601 1706.8584 3 1706.8588 -0.0003 1 15.63 0.037 R VSGVDGYETEGIRGLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5137.5137.3.dta 10 1 IPI00031517.1 DNA replication licensing factor MCM6 487 93801 18 18 17 17 6701 4292 1 1 1 572.2892 1713.8457 3 1713.8461 -0.0004 1 22.38 0.0083 K ISKESEDFIVEQYK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5277.5277.3.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 390 2632 1 1 1 353.2114 704.4083 2 704.4068 0.0015 0 40.78 0.0014 R SSLSLAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3474.3474.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 762 1347 1 1 1 399.2305 796.4465 2 796.4443 0.0022 0 24.73 0.026 R AQTPVPGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2095.2095.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 857 5435 1 1 1 407.2634 812.5122 2 812.512 0.0003 0 45.34 0.00018 R ALVELLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6493.6493.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 941 3271 5 0 1 414.7508 827.4871 2 827.4865 0.0006 0 28.56 0.022 R LLQDAIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4192.4192.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 1009 4126 1 1 1 419.7323 837.4501 2 837.4497 0.0004 0 25.22 0.018 R FQQFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5100.5100.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 1469 1495 1 1 1 455.7534 909.4922 2 909.492 0.0003 0 41.32 0.00024 R AGAAPVAPEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2252.2252.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 1616 2757 1 1 1 468.2507 934.4869 2 934.4872 -0.0003 0 41.32 0.002 R LQEIYNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3619.3619.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 1986 624 1 1 1 494.7618 987.5091 2 987.5097 -0.0007 1 30.92 0.017 R LRESEQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1330.1330.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 2109 1969 1 1 1 502.7534 1003.4922 2 1003.4934 -0.0012 0 67.66 1.60E-06 R ATEAGSLEAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2765.2765.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 2115 5565 1 1 1 503.29 1004.5655 2 1004.5655 0 0 35.08 0.0045 R FLSQLLER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6633.6633.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 2566 4680 1 1 1 535.8322 1069.6498 2 1069.6495 0.0002 1 23.09 0.038 R ALVELLREK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5691.5691.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 3037 5014 1 1 1 571.8293 1141.644 2 1141.6455 -0.0015 0 36 0.0016 K QATELALLQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6047.6047.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 3453 3952 1 1 1 601.8282 1201.6418 2 1201.6415 0.0003 0 59.41 2.90E-05 K NNTALQSVSLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4916.4916.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 3458 4612 1 1 1 401.9201 1202.7384 3 1202.7387 -0.0003 1 28.34 0.0038 R ITKYPLLISR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5618.5618.3.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 3483 1177 1 1 1 605.7809 1209.5472 2 1209.5482 -0.001 1 23 0.017 R CKDTLANCTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1915.1915.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 4477 3913 1 1 1 448.5805 1342.7197 3 1342.7205 -0.0008 1 21.96 0.029 R GTDRLDLPVTTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4875.4875.3.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 4637 3844 1 1 1 682.846 1363.6775 2 1363.6765 0.0009 0 45.19 5.80E-05 R ILSQSTDSLNMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4802.4802.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 4743 2894 1 1 1 690.8419 1379.6692 2 1379.6715 -0.0023 0 78.87 4.00E-08 R ILSQSTDSLNMR N Oxidation (M) 0.000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3772.3772.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 5963 3711 1 1 1 806.3912 1610.7678 2 1610.7689 -0.0011 0 46.81 0.00031 R ERPSSAIYPSDSFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4660.4660.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 6857 6102 1 1 1 875.4476 1748.8807 2 1748.8832 -0.0025 0 67.99 4.20E-07 K ELLSNVDEGIYQLEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7196.7196.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 6991 3825 1 1 1 599.9631 1796.8676 3 1796.8662 0.0014 0 32.99 0.00081 K EALICPTCNVTIHNR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4782.4782.3.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 7540 5948 1 1 1 1010.0366 2018.0587 2 2018.0585 0.0002 0 33.2 0.00077 R QLAALGQTEPLPAEAPWAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7039.7039.2.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 7553 4832 1 1 1 678.7157 2033.1253 3 2033.1269 -0.0016 1 33.63 0.0017 R AGAAPVAPEKQATELALLQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5853.5853.3.dta 11 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 472 112386 24 24 23 23 7612 5044 1 1 1 705.6851 2114.0333 3 2114.0392 -0.0059 0 26.09 0.0036 K SVSTTNIAGHFNDESPLGLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6079.6079.3.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 23 860 1 0 1 301.1745 600.3344 2 600.3343 0.0001 0 42.09 0.0012 R AGNLAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1578.1578.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 240 6174 1 1 1 335.2055 668.3964 2 668.3969 -0.0005 1 23.61 0.021 K GLHSKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.727.727.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 367 4961 1 1 1 351.2083 700.402 2 700.402 -0.0001 0 37.57 0.007 R LNLWR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5990.5990.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 480 3647 1 1 1 365.2347 728.4549 2 728.4545 0.0004 0 38.46 0.004 K GLATVIR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4592.4592.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 570 3243 1 1 1 379.2323 756.45 2 756.4494 0.0007 0 26.43 0.04 K ELVLQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4162.4162.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 755 1413 1 1 1 398.6963 795.378 2 795.3763 0.0018 0 27.26 0.01 K LNSGDYK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2165.2165.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 1775 4145 1 1 1 479.2769 956.5393 2 956.5403 -0.001 0 24.57 0.025 R QINLSNIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5120.5120.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 2209 3618 1 1 1 509.7738 1017.5331 2 1017.5342 -0.0011 0 66.9 5.80E-06 K SLLSAEEAAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4561.4561.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 2315 1668 1 1 1 517.2617 1032.5088 2 1032.5088 0 0 39.37 0.00045 R VADISGDTQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2436.2436.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 2414 6387 1 1 1 524.8008 1047.5871 2 1047.5865 0.0006 0 40.83 0.0011 K QFLPFLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7489.7489.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 2567 4793 1 1 1 536.2487 1070.4829 2 1070.4821 0.0007 0 35.5 0.0017 K FVDGEWYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5811.5811.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 3641 1414 1 1 1 616.8272 1231.6399 2 1231.6408 -0.001 1 51.65 0.00016 R VADISGDTQKAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2166.2166.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 3642 1412 1 1 1 411.554 1231.64 3 1231.6408 -0.0008 1 21.17 0.023 R VADISGDTQKAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2164.2164.3.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 4431 3407 1 1 1 667.832 1333.6495 2 1333.6514 -0.0019 0 34.12 0.0049 R DYVAPTANLDQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4337.4337.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 4881 5453 1 1 1 700.4018 1398.789 2 1398.7905 -0.0014 0 73.25 5.50E-07 K VMQVLNADAIVVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6512.6512.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 5042 5654 1 1 1 715.3513 1428.6881 2 1428.6885 -0.0004 0 99.42 1.80E-09 R SEAVVEYVFSGSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6728.6728.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 5234 3991 1 1 1 731.3519 1460.6892 2 1460.6895 -0.0003 0 55.28 4.00E-05 R SSHYDELLAAEAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4958.4958.2.dta 12 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 432 102618 18 18 17 17 5261 4135 1 1 1 733.3793 1464.744 2 1464.746 -0.002 0 83.62 1.40E-08 K VITEYLNAQESAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5109.5109.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 98 2748 1 0 0 311.6813 621.348 2 621.3486 -0.0006 0 29.58 0.03 K SQFLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3609.3609.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 2231 6395 1 1 1 511.2785 1020.5425 2 1020.5426 -0.0001 0 57.73 3.40E-05 R FDILCVVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7497.7497.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 2965 4622 1 1 1 567.8404 1133.6662 2 1133.6669 -0.0007 0 22.69 0.0074 R QLHLNQLIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5629.5629.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 2966 4616 1 1 1 378.8962 1133.6668 3 1133.6669 -0.0001 0 32.86 0.0029 R QLHLNQLIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5622.5622.3.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 3228 6481 1 1 1 586.837 1171.6595 2 1171.6601 -0.0006 0 64.16 3.50E-06 R GLALALFGGEPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7589.7589.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 4017 3928 1 1 1 637.8268 1273.6391 2 1273.6402 -0.001 0 66.65 1.90E-06 K VAVGELTDEDVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4891.4891.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 4188 3987 1 1 1 650.3442 1298.6739 2 1298.6765 -0.0026 0 60.11 1.90E-05 R CTVIAAANPIGGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4954.4954.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 4251 5220 1 1 1 435.9223 1304.745 3 1304.7452 -0.0002 0 22.42 0.041 R ISHLPLVEELR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6267.6267.3.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 4278 5682 1 1 1 655.8358 1309.657 2 1309.6588 -0.0018 0 73.96 4.50E-07 R VMLESFIDTQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6758.6758.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 4428 7699 1 1 1 666.3821 1330.7496 2 1330.7496 0 0 31.53 0.0063 R DNNELLLFILK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8979.8979.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 4432 3509 1 1 1 667.855 1333.6954 2 1333.699 -0.0036 0 58.34 4.00E-06 K QLVAEQVTYQR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4446.4446.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 4617 4654 1 1 1 681.3572 1360.6999 2 1360.702 -0.0021 0 38.39 0.0012 K ESMATGSIPITVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5663.5663.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 4714 4056 1 1 1 689.3547 1376.6948 2 1376.697 -0.0022 0 42.1 0.00013 K ESMATGSIPITVR H Oxidation (M) 0.0010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5025.5025.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 5578 5163 1 1 1 765.3842 1528.7538 2 1528.7556 -0.0018 0 76.48 2.10E-07 R GDINVLLCGDPGTAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6206.6206.2.dta 13 1 IPI00184330.5 DNA replication licensing factor MCM2 419 102516 15 15 13 13 7549 4519 1 1 1 678.0112 2031.0119 3 2031.0161 -0.0042 1 37.03 0.00055 R FGAQQDTIEVPEKDLVDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5519.5519.3.dta 13 IPI00795155.1 13 kDa protein 58 12883 1 1 1 1 2231 6395 1 0 1 511.2785 1020.5425 2 1020.5426 -0.0001 0 57.73 3.40E-05 R FDILCVVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7497.7497.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 78 1043 1 1 1 308.6871 615.3596 2 615.3592 0.0004 0 33.46 0.019 R VAVEAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1772.1772.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 556 2109 1 1 1 377.7087 753.4029 2 753.4021 0.0008 0 50.07 0.00011 K NPADLPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2915.2915.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 577 2530 1 1 1 379.7297 757.4448 2 757.4446 0.0002 0 59.33 3.70E-05 K AGIIASAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3365.3365.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 578 2546 1 1 1 379.7302 757.4458 2 757.4446 0.0012 0 38.12 0.0048 K AGIIASAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3382.3382.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 897 4655 1 1 1 411.2224 820.4302 2 820.4299 0.0003 0 26.95 0.026 R TILMMGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5664.5664.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 1519 2734 1 1 1 461.7351 921.4557 2 921.4556 0.0001 0 33.45 0.0088 K SDPVVSYR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3594.3594.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 1883 3106 1 1 0 485.2764 968.5382 2 968.5403 -0.0021 0 33.81 0.0013 R GGGQIIPTAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4011.4011.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 2167 1996 1 1 1 507.2536 1012.4927 2 1012.4938 -0.0011 0 43.35 0.00072 K GEGQLGPAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2794.2794.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 2354 5353 1 1 1 520.2695 1038.5244 2 1038.5242 0.0002 0 31.27 0.014 K GPLMMYISK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6406.6406.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 2620 3058 1 1 1 539.2735 1076.5324 2 1076.5325 0 0 28.83 0.002 R IMGPNYTPGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3957.3957.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 2797 5084 1 1 1 554.3234 1106.6323 2 1106.6336 -0.0013 0 57.75 1.10E-05 R VFSGLVSTGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6122.6122.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 2893 4082 1 1 1 562.2867 1122.5588 2 1122.5591 -0.0003 0 55.1 2.40E-05 K STLTDSLVCK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5053.5053.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 4557 2704 1 1 1 451.2574 1350.7504 3 1350.7507 -0.0003 1 39.31 0.0005 R VAVEAKNPADLPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3562.3562.3.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 4727 4944 1 1 1 689.8605 1377.7065 2 1377.7075 -0.0009 0 63.4 3.30E-06 R CLYASVLTAQPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5972.5972.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 4892 3269 1 1 1 468.272 1401.7943 3 1401.798 -0.0037 1 29.77 0.005 K KEDLYLKPIQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4190.4190.3.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 5051 2383 1 1 1 477.5845 1429.7317 3 1429.7314 0.0003 1 47.87 0.00016 K FAAKGEGQLGPAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3207.3207.3.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 5139 7764 1 1 1 722.8866 1443.7586 2 1443.7609 -0.0023 1 17.06 0.025 K EGIPALDNFLDKL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.9085.9085.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 5593 4284 1 1 1 512.2765 1533.8076 3 1533.8086 -0.0009 1 23.3 0.024 R RCLYASVLTAQPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5268.5268.3.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 5906 4578 1 1 1 797.8843 1593.754 2 1593.7556 -0.0016 0 87.97 2.60E-08 R ETVSEESNVLCLSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5582.5582.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 5977 2958 1 1 1 539.2593 1614.7562 3 1614.7573 -0.0011 0 28.59 0.016 K TGTITTFEHAHNMR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3846.3846.3.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 6824 4749 1 1 1 871.9147 1741.8148 2 1741.8311 -0.0163 1 15.2 0.037 R YLAEKYEWDVAEAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5764.5764.2.dta 14 1 IPI00186290.6 Elongation factor 2 416 96246 22 22 21 21 7442 5240 1 1 1 654.6647 1960.9722 3 1960.9717 0.0005 0 21.62 0.02 R GHVFEESQVAGTPMFVVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6288.6288.3.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 1345 2080 1 0 1 444.7429 887.4713 2 887.4712 0.0001 0 30.1 0.026 K TATITEPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2884.2884.2.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 1883 3106 1 0 0 485.2764 968.5382 2 968.5403 -0.0021 0 33.81 0.0013 R GGGQIIPTAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4011.4011.2.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 2734 1475 1 0 1 547.7684 1093.5222 2 1093.5226 -0.0004 1 20.31 0.012 K CFAETPNKK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2231.2231.2.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 2735 1461 1 0 1 365.5151 1093.5236 3 1093.5226 0.001 1 20.67 0.012 K CFAETPNKK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2216.2216.3.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 2887 6209 1 0 1 561.7821 1121.5497 2 1121.5505 -0.0009 0 74.69 8.90E-07 K YDWDLLAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7305.7305.2.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 3058 4817 1 0 1 572.8175 1143.6205 2 1143.6209 -0.0005 0 55.93 8.00E-06 K ITMIAEPLEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5837.5837.2.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 3856 4577 1 0 1 628.8576 1255.7007 2 1255.7024 -0.0017 0 62.56 2.30E-06 K STPVTVVLPDTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5581.5581.2.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 4831 4651 1 0 1 696.8895 1391.7645 2 1391.766 -0.0015 0 53.69 4.30E-05 K IAVEPVNPSELPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5660.5660.2.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 4834 5811 1 0 1 697.3464 1392.6782 2 1392.6786 -0.0004 0 35.78 0.0005 K DSIVQGFQWGTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6899.6899.2.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 5231 4323 1 0 1 730.9136 1459.8126 2 1459.8147 -0.0021 0 46.8 4.10E-05 K ILDAVVAQEPLHR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5310.5310.2.dta 14 2 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 266 110336 11 11 10 10 7254 4727 1 0 1 632.0065 1892.9978 3 1892.9996 -0.0019 0 15.9 0.046 R GHVTQDAPIPGSPLYTIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5741.5741.3.dta 14 IPI00440662.1 Antigen MLAA-42 (Fragment) 95 17032 3 3 3 3 1519 2734 1 0 1 461.7351 921.4557 2 921.4556 0.0001 0 33.45 0.0088 K SDPVVSYR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3594.3594.2.dta 14 IPI00440662.1 Antigen MLAA-42 (Fragment) 95 17032 3 3 3 3 5906 4578 1 0 1 797.8843 1593.754 2 1593.7556 -0.0016 0 87.97 2.60E-08 R ETVSEESNVLCLSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5582.5582.2.dta 14 IPI00440662.1 Antigen MLAA-42 (Fragment) 95 17032 3 3 3 3 6824 4749 1 0 1 871.9147 1741.8148 2 1741.8311 -0.0163 1 15.2 0.037 R YLAEKYEWDVAEAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5764.5764.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 79 2400 1 1 0 308.6924 615.3702 2 615.3704 -0.0002 0 33.8 0.032 K SQLLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3225.3225.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 489 1124 1 1 1 366.2065 730.3985 2 730.3974 0.0011 0 29.52 0.015 R TSPVTAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1859.1859.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 1106 4638 1 1 1 423.2585 844.5024 2 844.5018 0.0006 0 49.91 0.00019 R TLETLIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5646.5646.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 1514 2830 1 1 1 461.2608 920.507 2 920.508 -0.001 0 35.04 0.00077 R VQVVGTYR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3703.3703.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 1599 6676 1 1 1 466.7815 931.5485 2 931.5491 -0.0006 0 45.02 0.00018 K VALLDVFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7798.7798.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 1691 2703 1 1 1 473.2248 944.4351 2 944.4352 -0.0001 0 55.21 2.90E-05 K GGYTSGTFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3561.3561.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 1939 3225 1 1 1 490.2543 978.4941 2 978.4957 -0.0016 0 39.04 0.00094 R YVLCTAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4143.4143.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 2203 3673 1 1 1 509.2914 1016.5682 2 1016.5688 -0.0007 0 40.58 0.0019 R TVLIACNVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4619.4619.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 2325 1406 1 1 1 345.5181 1033.5326 3 1033.5305 0.0021 0 29.44 0.0019 K HDNLLHGTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2157.2157.3.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 2508 1396 1 1 1 531.7552 1061.4958 2 1061.4964 -0.0006 0 24.65 0.0049 R SVHYCPATK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2147.2147.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 2586 2053 1 1 1 537.2722 1072.5298 2 1072.5302 -0.0004 1 32.88 0.0013 K KGGYTSGTFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2855.2855.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 3167 4741 1 1 1 388.8802 1163.6187 3 1163.6186 0.0001 1 42.51 0.001 R SKDIFDQLAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5756.5756.3.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 4713 4412 1 1 1 689.3495 1376.6844 2 1376.6871 -0.0026 0 70.06 3.10E-07 R CSVLAAANPVYGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5406.5406.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 4722 4200 1 1 1 689.8271 1377.6397 2 1377.6412 -0.0015 0 65.73 2.20E-06 K DAQPSFSAEDIAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5179.5179.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 4828 3043 1 1 1 464.9121 1391.7145 3 1391.7157 -0.0012 1 20.1 0.038 K VRELISDNQYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3941.3941.3.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 5144 5687 1 1 1 723.371 1444.7274 2 1444.7297 -0.0023 0 56.47 3.50E-05 R SVDVILDDDLVDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6763.6763.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 5563 6483 1 1 1 762.9348 1523.855 2 1523.8559 -0.0009 0 53.79 9.90E-06 R GDINILLIGDPSVAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7591.7591.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 6338 7222 1 1 1 832.443 1662.8714 2 1662.8729 -0.0015 0 18.48 0.018 R LLNNAFEELVAFQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8362.8362.2.dta 15 1 IPI00013214.1 DNA replication licensing factor MCM3 415 91551 19 19 19 19 7747 5357 1 1 1 771.077 2310.2091 3 2310.2107 -0.0016 0 34.73 0.00055 K IIKPVLTQESATYIAEEYSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6411.6411.3.dta 15 IPI00385434.2 MCM3 minichromosome maintenance deficient 3 84 37995 4 4 4 4 489 1124 1 0 1 366.2065 730.3985 2 730.3974 0.0011 0 29.52 0.015 R TSPVTAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1859.1859.2.dta 15 IPI00385434.2 MCM3 minichromosome maintenance deficient 3 84 37995 4 4 4 4 1106 4638 1 0 1 423.2585 844.5024 2 844.5018 0.0006 0 49.91 0.00019 R TLETLIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5646.5646.2.dta 15 IPI00385434.2 MCM3 minichromosome maintenance deficient 3 84 37995 4 4 4 4 2325 1406 1 0 1 345.5181 1033.5326 3 1033.5305 0.0021 0 29.44 0.0019 K HDNLLHGTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2157.2157.3.dta 15 IPI00385434.2 MCM3 minichromosome maintenance deficient 3 84 37995 4 4 4 4 7747 5357 1 0 1 771.077 2310.2091 3 2310.2107 -0.0016 0 34.73 0.00055 K IIKPVLTQESATYIAEEYSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6411.6411.3.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 1397 4968 1 1 1 450.7795 899.5445 2 899.544 0.0005 0 54.5 3.40E-05 K VLLSALER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5998.5998.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 2290 3671 1 1 1 515.7686 1029.5226 2 1029.5244 -0.0018 0 29.68 0.011 K EQVPGFTPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4616.4616.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 2748 4430 1 1 1 549.3254 1096.6362 2 1096.6353 0.0009 0 69.22 6.40E-07 K GALALAQAVQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5425.5425.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 3202 6439 1 1 1 585.3554 1168.6963 2 1168.6968 -0.0006 0 37.77 0.00029 K GVPTGFILPIR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7542.7542.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 3298 2463 1 1 1 593.344 1184.6734 2 1184.6765 -0.003 1 18.21 0.031 R KITIGQAPTEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3293.3293.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 4439 5559 1 1 1 668.3303 1334.646 2 1334.6475 -0.0015 0 49.82 2.70E-05 K QGFGNLPICMAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6626.6626.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 4724 4999 1 1 1 689.8374 1377.6603 2 1377.6623 -0.0021 0 74.32 6.20E-07 K TDTESELDLISR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6031.6031.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 5396 5808 1 1 1 743.8799 1485.7452 2 1485.7464 -0.0011 0 59.33 6.60E-06 R LDIDPETITWQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6896.6896.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 5471 3742 1 1 1 752.8597 1503.7048 2 1503.7053 -0.0005 0 55.81 2.00E-05 K TDPTTLTDEEINR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4693.4693.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 5619 4893 1 1 1 768.8481 1535.6817 2 1535.6749 0.0069 0 47.27 4.10E-05 R GDLNDCFIPCTPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5918.5918.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 6101 5250 1 1 1 815.9548 1629.8951 2 1629.8978 -0.0027 0 74.32 1.70E-07 K YVVVTGITPTPLGEGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6299.6299.2.dta 16 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 384 102180 12 12 12 12 7570 4263 1 1 1 682.3501 2044.0285 3 2044.0324 -0.0039 1 23.16 0.0067 R LGIEKTDPTTLTDEEINR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5246.5246.3.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 2085 4213 1 1 1 500.8053 999.596 2 999.5964 -0.0004 0 36.54 0.00037 R IPTISTQLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5192.5192.2.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 2784 970 1 1 1 553.2668 1104.519 2 1104.5234 -0.0043 0 40.12 0.00034 R GQGSSPVAMQK A Oxidation (M) 0.00000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1695.1695.2.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 2787 4721 1 1 1 553.3087 1104.6029 2 1104.6026 0.0003 0 49.03 0.00015 R SLGEISALTSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5734.5734.2.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 2861 3086 1 1 1 559.8059 1117.5973 2 1117.5979 -0.0006 0 71.33 1.60E-06 K STVEGIQASVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3990.3990.2.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 2946 4264 1 1 1 566.7921 1131.5696 2 1131.5706 -0.0011 0 40.79 0.0023 R TNLLQVCER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5247.5247.2.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 3207 3570 1 1 1 585.8278 1169.6411 2 1169.6404 0.0007 0 36.32 0.00039 R ELTPQVVSAAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4510.4510.2.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 3976 3056 1 1 1 635.3435 1268.6725 2 1268.6725 0 0 85.9 3.60E-08 K AVAGNISDPGLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3955.3955.2.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 4301 3934 1 1 1 657.8725 1313.7304 2 1313.7303 0.0001 0 70.75 2.30E-07 K QVATALQNLQTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4897.4897.2.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 4596 3212 1 1 1 679.8831 1357.7516 2 1357.7565 -0.0049 1 28.32 0.0029 R ALASIDSKLNQAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4129.4129.2.dta 17 1 IPI00291175.7 Isoform 1 of Vinculin 378 117220 10 10 10 10 5213 4698 1 1 1 729.4008 1456.7871 2 1456.7886 -0.0015 0 102.9 8.00E-10 K AQQVSQGLDVLTAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5710.5710.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 264 1004 1 1 1 337.2035 672.3924 2 672.3919 0.0005 0 29.74 0.0033 K VVVSNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1732.1732.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 487 3854 1 1 0 365.7269 729.4393 2 729.4385 0.0008 0 37.07 0.005 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4813.4813.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 1194 1659 1 1 0 432.2184 862.4223 2 862.4218 0.0005 0 29.68 0.016 R EMLQQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2427.2427.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 1713 3536 1 1 1 474.7267 947.4388 2 947.4389 -0.0001 0 41.05 0.0011 K FYEQFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4475.4475.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 2798 6052 1 1 1 554.7742 1107.5339 2 1107.5349 -0.001 0 64.83 8.30E-07 R APFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7145.7145.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 3094 2776 1 1 0 576.2815 1150.5484 2 1150.5506 -0.0021 0 59.25 2.20E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3640.3640.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 3193 1711 1 1 1 390.1948 1167.5626 3 1167.5632 -0.0007 0 39.92 0.00045 K LGIHEDSQNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2490.2490.3.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 3757 5342 1 1 0 621.8558 1241.697 2 1241.6979 -0.0009 0 61.6 5.20E-06 K ADLINNLGTIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6395.6395.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 3938 5558 1 1 1 632.8242 1263.6339 2 1263.636 -0.0021 1 27.2 0.042 R RAPFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6625.6625.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 4647 4938 1 1 1 683.3669 1364.7192 2 1364.7221 -0.0029 0 70.77 4.30E-07 R TLTIVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5966.5966.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 5507 5296 1 1 0 757.3954 1512.7763 2 1512.7784 -0.002 0 92.48 9.70E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6347.6347.2.dta 18 1 IPI00382470.3 Heat shock protein HSP 90-alpha 2 376 98670 12 12 12 12 7071 4824 1 1 1 917.3946 1832.7746 2 1832.7741 0.0006 0 62.39 1.50E-06 R NPDDITNEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5844.5844.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 487 3854 1 0 0 365.7269 729.4393 2 729.4385 0.0008 0 37.07 0.005 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4813.4813.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 950 5875 1 0 1 415.2683 828.5221 2 828.5221 0 0 35.57 0.0021 R ALLFIPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6966.6966.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 1194 1659 1 0 0 432.2184 862.4223 2 862.4218 0.0005 0 29.68 0.016 R EMLQQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2427.2427.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 3028 1816 1 0 1 571.2829 1140.5512 2 1140.5523 -0.0011 0 25.29 0.0042 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2602.2602.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 3029 1812 1 0 1 381.1921 1140.5545 3 1140.5523 0.0022 0 32.7 0.0082 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2598.2598.3.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 3094 2776 1 0 0 576.2815 1150.5484 2 1150.5506 -0.0021 0 59.25 2.20E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3640.3640.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 3757 5342 1 0 0 621.8558 1241.697 2 1241.6979 -0.0009 0 61.6 5.20E-06 K ADLINNLGTIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6395.6395.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 3812 3239 1 0 1 625.3114 1248.6083 2 1248.6098 -0.0016 0 32.99 0.002 K EQVANSAFVER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4158.4158.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 4647 4938 1 0 1 683.3669 1364.7192 2 1364.7221 -0.0029 0 70.77 4.30E-07 R TLTLVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5966.5966.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 5507 5296 1 0 0 757.3954 1512.7763 2 1512.7784 -0.002 0 92.48 9.70E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6347.6347.2.dta 18 2 IPI00334775.6 85 kDa protein 296 85104 11 11 10 10 7130 4907 1 0 1 924.4016 1846.7887 2 1846.7897 -0.001 0 36.02 0.0012 R NPDDITQEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5933.5933.2.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 264 1004 1 0 1 337.2035 672.3924 2 672.3919 0.0005 0 29.74 0.0033 K VVVSNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1732.1732.2.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 487 3854 1 0 0 365.7269 729.4393 2 729.4385 0.0008 0 37.07 0.005 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4813.4813.2.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 1194 1659 1 0 0 432.2184 862.4223 2 862.4218 0.0005 0 29.68 0.016 R EMLQQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2427.2427.2.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 1713 3536 1 0 1 474.7267 947.4388 2 947.4389 -0.0001 0 41.05 0.0011 K FYEQFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4475.4475.2.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 2798 6052 1 0 1 554.7742 1107.5339 2 1107.5349 -0.001 0 64.83 8.30E-07 R APFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7145.7145.2.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 3094 2776 1 0 0 576.2815 1150.5484 2 1150.5506 -0.0021 0 59.25 2.20E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3640.3640.2.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 3193 1711 1 0 1 390.1948 1167.5626 3 1167.5632 -0.0007 0 39.92 0.00045 K LGIHEDSQNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2490.2490.3.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 3938 5558 1 0 1 632.8242 1263.6339 2 1263.636 -0.0021 1 27.2 0.042 R RAPFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6625.6625.2.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 5507 5296 1 0 0 757.3954 1512.7763 2 1512.7784 -0.002 0 92.48 9.70E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6347.6347.2.dta 18 IPI00604607.2 Hsp89-alpha-delta-N 285 63839 10 10 10 10 7071 4824 1 0 1 917.3946 1832.7746 2 1832.7741 0.0006 0 62.39 1.50E-06 R NPDDITNEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5844.5844.2.dta 18 IPI00796258.1 12 kDa protein 145 11880 5 5 5 5 487 3854 1 0 0 365.7269 729.4393 2 729.4385 0.0008 0 37.07 0.005 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4813.4813.2.dta 18 IPI00796258.1 12 kDa protein 145 11880 5 5 5 5 1194 1659 1 0 0 432.2184 862.4223 2 862.4218 0.0005 0 29.68 0.016 R EMLQQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2427.2427.2.dta 18 IPI00796258.1 12 kDa protein 145 11880 5 5 5 5 1713 3536 1 0 1 474.7267 947.4388 2 947.4389 -0.0001 0 41.05 0.0011 K FYEQFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4475.4475.2.dta 18 IPI00796258.1 12 kDa protein 145 11880 5 5 5 5 3193 1711 1 0 1 390.1948 1167.5626 3 1167.5632 -0.0007 0 39.92 0.00045 K LGIHEDSQNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2490.2490.3.dta 18 IPI00796258.1 12 kDa protein 145 11880 5 5 5 5 5507 5296 1 0 0 757.3954 1512.7763 2 1512.7784 -0.002 0 92.48 9.70E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6347.6347.2.dta 18 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 139 19120 6 6 5 5 487 3854 1 0 0 365.7269 729.4393 2 729.4385 0.0008 0 37.07 0.005 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4813.4813.2.dta 18 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 139 19120 6 6 5 5 1194 1659 1 0 0 432.2184 862.4223 2 862.4218 0.0005 0 29.68 0.016 R EMLQQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2427.2427.2.dta 18 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 139 19120 6 6 5 5 3028 1816 1 0 1 571.2829 1140.5512 2 1140.5523 -0.0011 0 25.29 0.0042 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2602.2602.2.dta 18 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 139 19120 6 6 5 5 3029 1812 1 0 1 381.1921 1140.5545 3 1140.5523 0.0022 0 32.7 0.0082 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2598.2598.3.dta 18 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 139 19120 6 6 5 5 3812 3239 1 0 1 625.3114 1248.6083 2 1248.6098 -0.0016 0 32.99 0.002 K EQVANSAFVER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4158.4158.2.dta 18 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 139 19120 6 6 5 5 5507 5296 1 0 0 757.3954 1512.7763 2 1512.7784 -0.002 0 92.48 9.70E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6347.6347.2.dta 18 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 126 20112 5 5 4 4 487 3854 1 0 0 365.7269 729.4393 2 729.4385 0.0008 0 37.07 0.005 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4813.4813.2.dta 18 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 126 20112 5 5 4 4 1194 1659 1 0 0 432.2184 862.4223 2 862.4218 0.0005 0 29.68 0.016 R EMLQQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2427.2427.2.dta 18 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 126 20112 5 5 4 4 3028 1816 1 0 1 571.2829 1140.5512 2 1140.5523 -0.0011 0 25.29 0.0042 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2602.2602.2.dta 18 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 126 20112 5 5 4 4 3029 1812 1 0 1 381.1921 1140.5545 3 1140.5523 0.0022 0 32.7 0.0082 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2598.2598.3.dta 18 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 126 20112 5 5 4 4 5507 5296 1 0 0 757.3954 1512.7763 2 1512.7784 -0.002 0 92.48 9.70E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6347.6347.2.dta 18 IPI00411633.3 Heat shock protein beta 112 17005 2 2 2 2 3757 5342 1 0 0 621.8558 1241.697 2 1241.6979 -0.0009 0 61.6 5.20E-06 K ADLINNLGTIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6395.6395.2.dta 18 IPI00411633.3 Heat shock protein beta 112 17005 2 2 2 2 4647 4938 1 0 1 683.3669 1364.7192 2 1364.7221 -0.0029 0 70.77 4.30E-07 R TLTLVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5966.5966.2.dta 18 IPI00031523.3 Heat shock protein 90 kDa alpha class A member 2 (Fragment) 98 35709 2 2 2 2 3094 2776 1 0 0 576.2815 1150.5484 2 1150.5506 -0.0021 0 59.25 2.20E-05 K YIDQEELNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3640.3640.2.dta 18 IPI00031523.3 Heat shock protein 90 kDa alpha class A member 2 (Fragment) 98 35709 2 2 2 2 3757 5342 1 0 0 621.8558 1241.697 2 1241.6979 -0.0009 0 61.6 5.20E-06 K ADLINNLGTIAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6395.6395.2.dta 18 IPI00030275.5 "Heat shock protein 75 kDa, mitochondrial precursor" 92 80345 1 1 1 1 5507 5296 1 0 1 757.3954 1512.7763 2 1512.7784 -0.002 0 92.48 9.70E-09 R GVVDSEDIPLNLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6347.6347.2.dta 18 IPI00555957.1 Heat shock protein 90Ad 71 47796 1 1 1 1 4647 4938 1 0 1 683.3669 1364.7192 2 1364.7221 -0.0029 0 70.77 4.30E-07 R TLTIVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5966.5966.2.dta 18 IPI00555614.1 Heat shock protein 90Bc 41 68624 2 2 2 2 1194 1659 1 0 0 432.2184 862.4223 2 862.4218 0.0005 0 29.68 0.016 R EMLQQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2427.2427.2.dta 18 IPI00555614.1 Heat shock protein 90Bc 41 68624 2 2 2 2 3812 3239 1 0 1 625.3114 1248.6083 2 1248.6098 -0.0016 0 32.99 0.002 K EQVANSAFVER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4158.4158.2.dta 18 IPI00742783.1 Similar to Heat shock protein HSP 90-beta 30 22067 1 1 1 1 1194 1659 1 0 0 432.2184 862.4223 2 862.4218 0.0005 0 29.68 0.016 R EMLQQSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2427.2427.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 236 5177 1 1 1 334.692 667.3694 2 667.3694 0 0 23.67 0.041 K GFGFIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6221.6221.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 419 2677 1 1 1 358.221 714.4274 2 714.4276 -0.0001 0 39.9 0.0017 R ALAEIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3525.3525.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 1338 3128 1 1 1 443.7536 885.4926 2 885.492 0.0006 0 41.24 0.00019 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4035.4035.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 2459 708 1 1 1 527.7491 1053.4837 2 1053.4839 -0.0002 1 22.88 0.022 R QREESYSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1418.1418.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 2757 2512 1 1 1 550.3122 1098.6098 2 1098.6146 -0.0047 1 44.84 6.20E-05 R AVVIVDDRGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3346.3346.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 2866 2661 1 1 1 560.7629 1119.5113 2 1119.5131 -0.0018 0 41.55 0.00025 R GMGPGTPAGYGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3508.3508.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 2986 1961 1 1 1 568.7601 1135.5056 2 1135.5081 -0.0025 0 54 8.60E-06 R GMGPGTPAGYGR G Oxidation (M) 0.010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2757.2757.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 3048 3011 1 1 1 572.3168 1142.6191 2 1142.6196 -0.0005 0 68.68 4.00E-06 R FATHAAALSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3907.3907.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 3105 5255 1 1 1 577.3212 1152.6278 2 1152.6291 -0.0014 1 48.67 0.0002 K GFGFIKLESR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6304.6304.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 3777 3506 1 1 1 623.3496 1244.6847 2 1244.6877 -0.003 0 54.17 3.70E-05 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4443.4443.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 3778 3507 1 1 1 415.9034 1244.6883 3 1244.6877 0.0006 0 31.36 0.0014 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4444.4444.3.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 3958 2820 1 1 1 634.3126 1266.6107 2 1266.6139 -0.0032 0 40.18 0.00017 R SPPPGMGLNQNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3692.3692.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 4467 2557 1 1 1 671.3353 1340.656 2 1340.6586 -0.0026 0 63.16 9.40E-06 R FGQGGAGPVGGQGPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3394.3394.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 5109 3778 1 1 1 479.9177 1436.7313 3 1436.73 0.0014 1 45.74 0.00049 K YGEPGEVFINKGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4732.4732.3.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 6903 3612 1 1 1 588.2656 1761.775 3 1761.7747 0.0004 0 21.34 0.017 R FAQHGTFEYEYSQR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4555.4555.3.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 7017 6564 1 1 1 904.4592 1806.9039 2 1806.904 -0.0001 0 19.63 0.014 R LFVGNLPADITEDEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7674.7674.2.dta 19 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 367 76216 17 17 15 15 7446 5969 1 1 1 655.3417 1963.0032 3 1963.0051 -0.0019 1 16.68 0.04 R LFVGNLPADITEDEFKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7062.7062.3.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 236 5177 1 0 1 334.692 667.3694 2 667.3694 0 0 23.67 0.041 K GFGFIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6221.6221.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 419 2677 1 0 1 358.221 714.4274 2 714.4276 -0.0001 0 39.9 0.0017 R ALAEIAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3525.3525.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 1338 3128 1 0 1 443.7536 885.4926 2 885.492 0.0006 0 41.24 0.00019 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4035.4035.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 2459 708 1 0 1 527.7491 1053.4837 2 1053.4839 -0.0002 1 22.88 0.022 R QREESYSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1418.1418.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 2757 2512 1 0 1 550.3122 1098.6098 2 1098.6146 -0.0047 1 44.84 6.20E-05 R AVVIVDDRGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3346.3346.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 3048 3011 1 0 1 572.3168 1142.6191 2 1142.6196 -0.0005 0 68.68 4.00E-06 R FATHAAALSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3907.3907.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 3105 5255 1 0 1 577.3212 1152.6278 2 1152.6291 -0.0014 1 48.67 0.0002 K GFGFIKLESR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6304.6304.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 3777 3506 1 0 1 623.3496 1244.6847 2 1244.6877 -0.003 0 54.17 3.70E-05 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4443.4443.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 3778 3507 1 0 1 415.9034 1244.6883 3 1244.6877 0.0006 0 31.36 0.0014 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4444.4444.3.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 3958 2820 1 0 1 634.3126 1266.6107 2 1266.6139 -0.0032 0 40.18 0.00017 R SPPPGMGLNQNR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3692.3692.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 5109 3778 1 0 1 479.9177 1436.7313 3 1436.73 0.0014 1 45.74 0.00049 K YGEPGEVFINKGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4732.4732.3.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 6903 3612 1 0 1 588.2656 1761.775 3 1761.7747 0.0004 0 21.34 0.017 R FAQHGTFEYEYSQR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4555.4555.3.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 7017 6564 1 0 1 904.4592 1806.9039 2 1806.904 -0.0001 0 19.63 0.014 R LFVGNLPADITEDEFK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7674.7674.2.dta 19 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 267 72332 14 14 13 13 7446 5969 1 0 1 655.3417 1963.0032 3 1963.0051 -0.0019 1 16.68 0.04 R LFVGNLPADITEDEFKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7062.7062.3.dta 19 IPI00304596.3 Non-POU domain-containing octamer-binding protein 41 54311 1 1 1 1 1338 3128 1 0 1 443.7536 885.4926 2 885.492 0.0006 0 41.24 0.00019 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4035.4035.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 244 732 1 1 1 335.698 669.3815 2 669.381 0.0006 0 45.84 0.00029 K VAANAPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1443.1443.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 583 1568 1 1 1 379.7425 757.4704 2 757.4698 0.0006 1 33.59 0.0095 R KQLLEK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2330.2330.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 1160 1449 1 1 1 427.2153 852.4161 2 852.4164 -0.0003 0 40.55 0.0013 K YIQAACK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2203.2203.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 2496 1356 1 1 1 530.2922 1058.5699 2 1058.572 -0.0021 1 32.32 0.005 K TGQIKEVER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2104.2104.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 2555 2087 1 1 1 535.2761 1068.5376 2 1068.5386 -0.001 0 47.95 0.00019 R AHIAQLCEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2891.2891.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 2914 4354 1 1 1 563.7983 1125.582 2 1125.5818 0.0002 0 57.82 2.70E-05 K VANVELYYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5343.5343.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 3724 6454 1 1 1 618.8359 1235.6573 2 1235.6584 -0.001 0 33.65 0.0072 K TLQIFNIEMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7558.7558.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 4167 4788 1 1 1 648.8381 1295.6616 2 1295.6622 -0.0006 0 49.67 2.20E-05 K LLYNNVSNFGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5806.5806.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 4448 4930 1 1 1 669.3467 1336.6788 2 1336.6809 -0.0021 0 81.54 2.30E-08 R VVGAMQLYSVDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5957.5957.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 5222 3333 2 1 1 730.3519 1458.6893 2 1458.6891 0.0002 1 20.18 0.013 R FLRENPYYDSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4258.4258.2.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 6011 4724 1 1 1 540.9509 1619.831 3 1619.8307 0.0002 1 39.42 0.00037 R ALEHFTDLYDIKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5738.5738.3.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 6728 4218 1 1 1 572.9612 1715.8619 3 1715.8631 -0.0012 0 26.09 0.0063 K VSQPIEGHAASFAQFK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5198.5198.3.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 6889 4508 1 1 1 586.9663 1757.8771 3 1757.8736 0.0035 1 29.15 0.0018 R KFNALFAQGNYSEAAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5507.5507.3.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 6943 1704 1 1 1 592.9482 1775.8227 3 1775.826 -0.0033 0 32.17 0.00096 R IHEGCEEPATHNALAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2481.2481.3.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 7462 5062 1 1 1 657.6806 1970.02 3 1970.0221 -0.0021 0 20.54 0.012 R LASTLVHLGEYQAAVDGAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6098.6098.3.dta 20 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 339 193260 16 16 16 16 7622 4803 1 1 1 711.0368 2130.0886 3 2130.0892 -0.0006 1 37.87 0.00028 R ANVPNKVIQCFAETGQVQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5822.5822.3.dta 20 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 155 189020 6 6 6 6 583 1568 1 0 1 379.7425 757.4704 2 757.4698 0.0006 1 33.59 0.0095 R KQLLEK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2330.2330.2.dta 20 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 155 189020 6 6 6 6 1160 1449 1 0 1 427.2153 852.4161 2 852.4164 -0.0003 0 40.55 0.0013 K YIQAACK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2203.2203.2.dta 20 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 155 189020 6 6 6 6 2496 1356 1 0 1 530.2922 1058.5699 2 1058.572 -0.0021 1 32.32 0.005 K TGQIKEVER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2104.2104.2.dta 20 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 155 189020 6 6 6 6 2555 2087 1 0 1 535.2761 1068.5376 2 1068.5386 -0.001 0 47.95 0.00019 R AHIAQLCEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2891.2891.2.dta 20 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 155 189020 6 6 6 6 3724 6454 1 0 1 618.8359 1235.6573 2 1235.6584 -0.001 0 33.65 0.0072 K TLQIFNIEMK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7558.7558.2.dta 20 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 155 189020 6 6 6 6 4448 4930 1 0 1 669.3467 1336.6788 2 1336.6809 -0.0021 0 81.54 2.30E-08 R VVGAMQLYSVDR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5957.5957.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 268 1992 1 1 1 337.6957 673.3769 2 673.3759 0.001 0 35.51 0.019 R EVASLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2790.2790.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 980 2289 1 1 1 417.7501 833.4857 2 833.4858 -0.0001 0 25.84 0.0065 K VTSVSTLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3107.3107.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 1700 776 1 1 1 473.7693 945.524 2 945.5243 -0.0004 1 37.19 0.0034 K IRQDSVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1490.1490.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 2384 3915 1 1 0 522.75 1043.4854 2 1043.4858 -0.0004 0 20.02 0.023 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4877.4877.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 2616 4217 1 1 1 538.8046 1075.5946 2 1075.5947 -0.0002 0 48.28 0.00029 K LLTDVQLMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5197.5197.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 2711 1901 1 1 0 546.2552 1090.4959 2 1090.4978 -0.0019 0 43.21 8.90E-05 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2693.2693.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 3211 4454 1 1 1 586.3201 1170.6257 2 1170.6244 0.0013 0 67.3 5.10E-06 R GQEQLLENIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5450.5450.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 4401 3749 1 1 1 664.3696 1326.7246 2 1326.7255 -0.0009 1 57.08 4.40E-06 R GQEQLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4701.4701.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 4918 2847 1 1 1 703.8888 1405.763 2 1405.7664 -0.0034 1 52.28 3.00E-05 K VTSVSTLKSEDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3721.3721.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 5711 2844 1 1 1 520.9661 1559.8765 3 1559.8784 -0.0018 0 20.75 0.011 K VVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3718.3718.3.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 5712 2832 1 1 1 390.9769 1559.8784 4 1559.8784 0 0 30.3 0.0025 K VVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3705.3705.4.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 5722 4806 1 1 1 782.8451 1563.6756 2 1563.6776 -0.002 0 45.33 5.60E-05 R DDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5825.5825.2.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 5723 4794 1 1 1 522.2333 1563.6782 3 1563.6776 0.0005 0 22.13 0.0084 R DDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5812.5812.3.dta 21 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 337 57510 14 14 12 12 5974 4335 1 1 1 807.9016 1613.7887 2 1613.7897 -0.001 0 85.75 2.20E-08 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5323.5323.2.dta 21 2 IPI00012878.1 Heat shock factor protein 2 65 60482 3 3 3 3 2384 3915 1 0 0 522.75 1043.4854 2 1043.4858 -0.0004 0 20.02 0.023 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4877.4877.2.dta 21 2 IPI00012878.1 Heat shock factor protein 2 65 60482 3 3 3 3 2711 1901 1 0 0 546.2552 1090.4959 2 1090.4978 -0.0019 0 43.21 8.90E-05 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2693.2693.2.dta 21 2 IPI00012878.1 Heat shock factor protein 2 65 60482 3 3 3 3 2796 1188 1 0 1 554.3038 1106.5931 2 1106.5945 -0.0014 0 32.6 0.00088 K HAQQQQVIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1927.1927.2.dta 21 IPI00008456.1 Isoform HSF4B of Heat shock factor protein 4 20 53362 1 1 1 1 2384 3915 1 0 0 522.75 1043.4854 2 1043.4858 -0.0004 0 20.02 0.023 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4877.4877.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 408 1427 1 1 1 356.1882 710.3618 2 710.3599 0.0019 0 34.05 0.002 R ASYGVSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2180.2180.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 647 1311 1 1 1 387.2027 772.3908 2 772.3902 0.0006 0 42.52 0.00097 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2057.2057.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 887 4112 1 1 1 410.2401 818.4657 2 818.465 0.0007 0 35.03 0.0034 K FIEIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5085.5085.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 1170 3763 1 1 1 429.2655 856.5165 2 856.513 0.0035 0 40.22 0.0026 K LNTLLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4716.4716.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 1395 1436 1 1 1 450.7703 899.5261 2 899.5263 -0.0002 1 26.44 0.031 R KAVVVCPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2189.2189.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 1667 2114 1 1 1 471.2923 940.57 2 940.5706 -0.0005 1 41 0.00056 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2920.2920.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 2054 3114 1 1 1 498.7583 995.5021 2 995.5036 -0.0015 0 35.76 0.0024 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4020.4020.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 2412 4137 1 1 1 524.7745 1047.5345 2 1047.5349 -0.0004 0 46.87 4.00E-05 K NGQDLGVAFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5111.5111.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 3066 5373 1 1 1 573.2648 1144.515 2 1144.5158 -0.0008 0 54.88 1.70E-05 K MCLFAGFQR K Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6428.6428.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 4754 5416 1 1 1 691.8525 1381.6904 2 1381.6911 -0.0007 0 70.23 2.20E-06 K YNILGTNTIMDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6474.6474.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 5875 4480 1 1 1 530.2877 1587.8413 3 1587.8403 0.0011 1 26.3 0.0072 K QMADTGKLNTLLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5477.5477.3.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 6204 3045 1 1 1 410.4707 1637.8536 4 1637.8525 0.001 1 30.44 0.0014 R HLYTKDIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3943.3943.4.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 6630 4833 1 1 1 849.3928 1696.771 2 1696.7733 -0.0023 1 46.06 4.80E-05 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5854.5854.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 6631 4816 1 1 1 566.5983 1696.7732 3 1696.7733 -0.0001 1 35.29 0.00049 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5836.5836.3.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 6715 5923 1 1 1 857.9591 1713.9037 2 1713.905 -0.0013 0 51.36 4.50E-05 K SSGPTSLFAVTVAPPGAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7014.7014.2.dta 22 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 335 89665 16 16 14 14 6716 5941 1 1 1 572.3088 1713.9045 3 1713.905 -0.0005 0 27.48 0.029 K SSGPTSLFAVTVAPPGAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7032.7032.3.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 408 1427 1 0 1 356.1882 710.3618 2 710.3599 0.0019 0 34.05 0.002 R ASYGVSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2180.2180.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 647 1311 1 0 1 387.2027 772.3908 2 772.3902 0.0006 0 42.52 0.00097 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2057.2057.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 887 4112 1 0 1 410.2401 818.4657 2 818.465 0.0007 0 35.03 0.0034 K FIEIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5085.5085.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 1170 3763 1 0 1 429.2655 856.5165 2 856.513 0.0035 0 40.22 0.0026 K LNTLLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4716.4716.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 1395 1436 1 0 1 450.7703 899.5261 2 899.5263 -0.0002 1 26.44 0.031 R KAVVVCPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2189.2189.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 1667 2114 1 0 1 471.2923 940.57 2 940.5706 -0.0005 1 41 0.00056 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2920.2920.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 2054 3114 1 0 1 498.7583 995.5021 2 995.5036 -0.0015 0 35.76 0.0024 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4020.4020.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 2412 4137 1 0 1 524.7745 1047.5345 2 1047.5349 -0.0004 0 46.87 4.00E-05 K NGQDLGVAFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5111.5111.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 3066 5373 1 0 1 573.2648 1144.515 2 1144.5158 -0.0008 0 54.88 1.70E-05 K MCLFAGFQR K Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6428.6428.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 4754 5416 1 0 1 691.8525 1381.6904 2 1381.6911 -0.0007 0 70.23 2.20E-06 K YNILGTNTIMDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6474.6474.2.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 5875 4480 1 0 1 530.2877 1587.8413 3 1587.8403 0.0011 1 26.3 0.0072 K QMADTGKLNTLLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5477.5477.3.dta 22 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 251 62395 12 12 12 12 6204 3045 1 0 1 410.4707 1637.8536 4 1637.8525 0.001 1 30.44 0.0014 R HLYTKDIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3943.3943.4.dta 22 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 165 27900 7 7 6 6 408 1427 1 0 1 356.1882 710.3618 2 710.3599 0.0019 0 34.05 0.002 R ASYGVSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2180.2180.2.dta 22 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 165 27900 7 7 6 6 1667 2114 1 0 1 471.2923 940.57 2 940.5706 -0.0005 1 41 0.00056 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2920.2920.2.dta 22 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 165 27900 7 7 6 6 2054 3114 1 0 1 498.7583 995.5021 2 995.5036 -0.0015 0 35.76 0.0024 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4020.4020.2.dta 22 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 165 27900 7 7 6 6 2412 4137 1 0 1 524.7745 1047.5345 2 1047.5349 -0.0004 0 46.87 4.00E-05 K NGQDLGVAFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5111.5111.2.dta 22 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 165 27900 7 7 6 6 6204 3045 1 0 1 410.4707 1637.8536 4 1637.8525 0.001 1 30.44 0.0014 R HLYTKDIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3943.3943.4.dta 22 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 165 27900 7 7 6 6 6630 4833 1 0 1 849.3928 1696.771 2 1696.7733 -0.0023 1 46.06 4.80E-05 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5854.5854.2.dta 22 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 165 27900 7 7 6 6 6631 4816 1 0 1 566.5983 1696.7732 3 1696.7733 -0.0001 1 35.29 0.00049 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5836.5836.3.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 805 3275 1 1 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 2304 4791 1 1 1 516.3029 1030.5913 2 1030.591 0.0003 0 61.33 7.40E-06 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5809.5809.2.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 2788 1457 1 1 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 55.28 5.40E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2212.2212.2.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 3169 3182 1 1 1 583.2967 1164.5788 2 1164.5775 0.0014 0 31.17 0.0074 R LENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4096.4096.2.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 3686 3299 1 1 1 412.2313 1233.672 3 1233.6717 0.0004 1 29.62 0.0069 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4222.4222.3.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 3928 2929 1 1 1 631.8013 1261.588 2 1261.5899 -0.0019 0 71.15 1.30E-06 R SLLEGEGSSGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3812.3812.2.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 4590 3799 1 1 1 453.2439 1356.71 3 1356.711 -0.001 1 17.61 0.028 R QSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4754.4754.3.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 4747 3475 1 1 1 691.3263 1380.638 2 1380.6408 -0.0028 0 85.91 1.60E-08 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4410.4410.2.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 5067 3941 1 1 1 717.8872 1433.7599 2 1433.7626 -0.0028 1 26.32 0.0054 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4904.4904.2.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 5422 2209 1 1 1 747.3704 1492.7263 2 1492.727 -0.0007 1 25.07 0.0045 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3021.3021.2.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 5671 2208 1 1 1 775.342 1548.6694 2 1548.67 -0.0006 0 92.24 2.20E-09 R SGGGGGGGGCGGGGGVSSLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3020.3020.2.dta 23 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 332 59711 12 12 12 12 6675 5063 1 1 1 854.388 1706.7614 2 1706.7649 -0.0035 0 17.1 0.025 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6099.6099.2.dta 23 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 305 51875 9 9 9 9 521 2817 1 0 0 373.7057 745.3969 2 745.397 -0.0001 0 29.22 0.042 K TIEDLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3689.3689.2.dta 23 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 305 51875 9 9 9 9 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 305 51875 9 9 9 9 2788 1457 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 55.28 5.40E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2212.2212.2.dta 23 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 305 51875 9 9 9 9 2790 3041 1 0 0 553.7845 1105.5544 2 1105.555 -0.0006 0 85.96 6.50E-08 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3939.3939.2.dta 23 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 305 51875 9 9 9 9 3224 6286 1 0 1 586.7662 1171.5178 2 1171.5186 -0.0008 0 41.32 0.00022 K DAEEWFFTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7386.7386.2.dta 23 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 305 51875 9 9 9 9 3949 3471 1 0 1 633.8357 1265.6568 2 1265.6615 -0.0047 1 21.32 0.01 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4405.4405.2.dta 23 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 305 51875 9 9 9 9 4042 2588 1 0 0 639.7954 1277.5763 2 1277.5783 -0.002 0 60.04 1.30E-05 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3427.3427.2.dta 23 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 305 51875 9 9 9 9 4616 2536 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.31 2.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3371.3371.2.dta 23 2 IPI00384444.5 "Keratin, type I cytoskeletal 14" 305 51875 9 9 9 9 5012 3195 1 0 1 713.3527 1424.6908 2 1424.6896 0.0012 0 64.64 8.70E-07 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4111.4111.2.dta 23 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 285 51578 8 8 8 8 521 2817 1 0 0 373.7057 745.3969 2 745.397 -0.0001 0 29.22 0.042 K TIEDLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3689.3689.2.dta 23 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 285 51578 8 8 8 8 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 285 51578 8 8 8 8 2741 5942 1 0 1 548.7689 1095.5233 2 1095.5237 -0.0004 0 61.1 1.10E-05 R DAETWFLSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7033.7033.2.dta 23 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 285 51578 8 8 8 8 2788 1457 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 55.28 5.40E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2212.2212.2.dta 23 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 285 51578 8 8 8 8 2790 3041 1 0 0 553.7845 1105.5544 2 1105.555 -0.0006 0 85.96 6.50E-08 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3939.3939.2.dta 23 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 285 51578 8 8 8 8 3905 2039 1 0 1 630.788 1259.5615 2 1259.563 -0.0015 0 56.87 8.10E-06 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2840.2840.2.dta 23 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 285 51578 8 8 8 8 4042 2588 1 0 0 639.7954 1277.5763 2 1277.5783 -0.002 0 60.04 1.30E-05 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3427.3427.2.dta 23 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 285 51578 8 8 8 8 4449 3258 1 0 1 669.8345 1337.6544 2 1337.6575 -0.0032 0 70.15 1.70E-06 R APSTYGGGLSVSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4178.4178.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 432 3000 1 0 1 359.7006 717.3866 2 717.3843 0.0023 0 32.57 0.012 K IMADIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3896.3896.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 502 3582 2 0 1 367.6962 733.3779 2 733.3792 -0.0013 0 28.82 0.045 K IMADIR A Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4523.4523.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 1916 2741 1 0 1 488.2301 974.4457 2 974.4458 -0.0001 0 46.29 0.00031 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3602.3602.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 2362 4280 1 0 0 521.306 1040.5974 2 1040.5978 -0.0004 0 48.62 7.90E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5264.5264.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 2728 2221 1 0 1 547.2852 1092.5558 2 1092.5563 -0.0006 1 14.04 0.048 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3034.3034.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 4344 3927 1 0 1 660.3392 1318.6638 2 1318.6629 0.0008 0 77.64 1.50E-07 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4890.4890.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 4854 2473 1 0 1 465.915 1394.7231 3 1394.7266 -0.0035 1 19.86 0.015 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3304.3304.3.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 4977 5578 1 0 1 710.3765 1418.7384 2 1418.7405 -0.0021 0 53.2 0.00011 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6647.6647.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 5302 4394 1 0 1 491.9267 1472.7583 3 1472.7583 0 1 32.83 0.0081 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5387.5387.3.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 5474 2032 1 0 1 752.8958 1503.777 2 1503.7781 -0.0011 1 31.31 0.0012 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2832.2832.2.dta 23 4 IPI00554788.4 49 kDa protein 269 48793 12 12 11 11 5545 5077 1 0 1 761.8738 1521.733 2 1521.7345 -0.0015 0 78.5 4.40E-08 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6114.6114.2.dta 23 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 207 44065 6 6 6 6 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 207 44065 6 6 6 6 1122 4554 1 0 1 425.7322 849.4499 2 849.4497 0.0002 0 50.95 6.30E-05 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5556.5556.2.dta 23 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 207 44065 6 6 6 6 2362 4280 1 0 0 521.306 1040.5974 2 1040.5978 -0.0004 0 48.62 7.90E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5264.5264.2.dta 23 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 207 44065 6 6 6 6 3574 2620 1 0 0 611.8239 1221.6332 2 1221.6353 -0.0022 1 32.19 0.0014 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3461.3461.2.dta 23 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 207 44065 6 6 6 6 3762 3782 1 0 1 622.3303 1242.6461 2 1242.6455 0.0006 0 51.31 0.00016 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4736.4736.2.dta 23 5 IPI00479145.2 "Keratin, type I cytoskeletal 19" 207 44065 6 6 6 6 5689 4037 1 0 1 777.8785 1553.7425 2 1553.7434 -0.0009 0 96.8 3.20E-09 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5005.5005.2.dta 23 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 160 48361 7 7 6 6 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 160 48361 7 7 6 6 1959 2246 1 0 1 492.7537 983.4928 2 983.4924 0.0005 0 44.09 0.00053 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3061.3061.2.dta 23 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 160 48361 7 7 6 6 3052 6409 1 0 1 572.7502 1143.4859 2 1143.4873 -0.0014 0 36.25 0.0004 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7511.7511.2.dta 23 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 160 48361 7 7 6 6 3574 2620 1 0 0 611.8239 1221.6332 2 1221.6353 -0.0022 1 32.19 0.0014 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3461.3461.2.dta 23 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 160 48361 7 7 6 6 4616 2536 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.31 2.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3371.3371.2.dta 23 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 160 48361 7 7 6 6 6315 4008 1 0 1 553.9682 1658.8828 3 1658.8839 -0.0011 1 17.46 0.023 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4976.4976.3.dta 23 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 160 48361 7 7 6 6 6316 4031 1 0 1 830.4491 1658.8836 2 1658.8839 -0.0003 1 17.87 0.021 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4999.4999.2.dta 23 IPI00789750.1 27 kDa protein 238 26775 7 7 7 7 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00789750.1 27 kDa protein 238 26775 7 7 7 7 2788 1457 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 55.28 5.40E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2212.2212.2.dta 23 IPI00789750.1 27 kDa protein 238 26775 7 7 7 7 2790 3041 1 0 0 553.7845 1105.5544 2 1105.555 -0.0006 0 85.96 6.50E-08 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3939.3939.2.dta 23 IPI00789750.1 27 kDa protein 238 26775 7 7 7 7 3224 6286 1 0 1 586.7662 1171.5178 2 1171.5186 -0.0008 0 41.32 0.00022 K DAEEWFFTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7386.7386.2.dta 23 IPI00789750.1 27 kDa protein 238 26775 7 7 7 7 3949 3471 1 0 1 633.8357 1265.6568 2 1265.6615 -0.0047 1 21.32 0.01 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4405.4405.2.dta 23 IPI00789750.1 27 kDa protein 238 26775 7 7 7 7 4042 2588 1 0 0 639.7954 1277.5763 2 1277.5783 -0.002 0 60.04 1.30E-05 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3427.3427.2.dta 23 IPI00789750.1 27 kDa protein 238 26775 7 7 7 7 5012 3195 1 0 1 713.3527 1424.6908 2 1424.6896 0.0012 0 64.64 8.70E-07 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4111.4111.2.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 2304 4791 1 0 1 516.3029 1030.5913 2 1030.591 0.0003 0 61.33 7.40E-06 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5809.5809.2.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 2788 1457 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 55.28 5.40E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2212.2212.2.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 3169 3182 1 0 1 583.2967 1164.5788 2 1164.5775 0.0014 0 31.17 0.0074 R LENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4096.4096.2.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 3686 3299 1 0 1 412.2313 1233.672 3 1233.6717 0.0004 1 29.62 0.0069 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4222.4222.3.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 4590 3799 1 0 1 453.2439 1356.71 3 1356.711 -0.001 1 17.61 0.028 R QSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4754.4754.3.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 4747 3475 1 0 1 691.3263 1380.638 2 1380.6408 -0.0028 0 85.91 1.60E-08 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4410.4410.2.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 5067 3941 1 0 1 717.8872 1433.7599 2 1433.7626 -0.0028 1 26.32 0.0054 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4904.4904.2.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 5422 2209 1 0 1 747.3704 1492.7263 2 1492.727 -0.0007 1 25.07 0.0045 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3021.3021.2.dta 23 IPI00383111.2 57 kDa protein 212 56699 10 10 10 10 6675 5063 1 0 1 854.388 1706.7614 2 1706.7649 -0.0035 0 17.1 0.025 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6099.6099.2.dta 23 IPI00794644.1 21 kDa protein 181 20831 5 5 5 5 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00794644.1 21 kDa protein 181 20831 5 5 5 5 1122 4554 1 0 1 425.7322 849.4499 2 849.4497 0.0002 0 50.95 6.30E-05 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5556.5556.2.dta 23 IPI00794644.1 21 kDa protein 181 20831 5 5 5 5 2362 4280 1 0 0 521.306 1040.5974 2 1040.5978 -0.0004 0 48.62 7.90E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5264.5264.2.dta 23 IPI00794644.1 21 kDa protein 181 20831 5 5 5 5 3574 2620 1 0 0 611.8239 1221.6332 2 1221.6353 -0.0022 1 32.19 0.0014 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3461.3461.2.dta 23 IPI00794644.1 21 kDa protein 181 20831 5 5 5 5 5689 4037 1 0 1 777.8785 1553.7425 2 1553.7434 -0.0009 0 96.8 3.20E-09 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5005.5005.2.dta 23 IPI00791852.1 42 kDa protein 155 41729 5 5 5 5 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00791852.1 42 kDa protein 155 41729 5 5 5 5 1959 2246 1 0 1 492.7537 983.4928 2 983.4924 0.0005 0 44.09 0.00053 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3061.3061.2.dta 23 IPI00791852.1 42 kDa protein 155 41729 5 5 5 5 3052 6409 1 0 1 572.7502 1143.4859 2 1143.4873 -0.0014 0 36.25 0.0004 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7511.7511.2.dta 23 IPI00791852.1 42 kDa protein 155 41729 5 5 5 5 3574 2620 1 0 0 611.8239 1221.6332 2 1221.6353 -0.0022 1 32.19 0.0014 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3461.3461.2.dta 23 IPI00791852.1 42 kDa protein 155 41729 5 5 5 5 4616 2536 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.31 2.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3371.3371.2.dta 23 IPI00794267.1 18 kDa protein 142 18099 4 4 4 4 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00794267.1 18 kDa protein 142 18099 4 4 4 4 1916 2741 1 0 1 488.2301 974.4457 2 974.4458 -0.0001 0 46.29 0.00031 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3602.3602.2.dta 23 IPI00794267.1 18 kDa protein 142 18099 4 4 4 4 2362 4280 1 0 0 521.306 1040.5974 2 1040.5978 -0.0004 0 48.62 7.90E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5264.5264.2.dta 23 IPI00794267.1 18 kDa protein 142 18099 4 4 4 4 4344 3927 1 0 1 660.3392 1318.6638 2 1318.6629 0.0008 0 77.64 1.50E-07 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4890.4890.2.dta 23 IPI00747707.1 KRT17 protein 139 41332 6 6 5 5 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00747707.1 KRT17 protein 139 41332 6 6 5 5 3052 6409 1 0 1 572.7502 1143.4859 2 1143.4873 -0.0014 0 36.25 0.0004 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7511.7511.2.dta 23 IPI00747707.1 KRT17 protein 139 41332 6 6 5 5 3574 2620 1 0 0 611.8239 1221.6332 2 1221.6353 -0.0022 1 32.19 0.0014 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3461.3461.2.dta 23 IPI00747707.1 KRT17 protein 139 41332 6 6 5 5 4616 2536 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.31 2.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3371.3371.2.dta 23 IPI00747707.1 KRT17 protein 139 41332 6 6 5 5 6315 4008 1 0 1 553.9682 1658.8828 3 1658.8839 -0.0011 1 17.46 0.023 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4976.4976.3.dta 23 IPI00747707.1 KRT17 protein 139 41332 6 6 5 5 6316 4031 1 0 1 830.4491 1658.8836 2 1658.8839 -0.0003 1 17.87 0.021 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4999.4999.2.dta 23 IPI00180956.6 49 kDa protein 126 49001 3 3 3 3 1959 2246 1 0 1 492.7537 983.4928 2 983.4924 0.0005 0 44.09 0.00053 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3061.3061.2.dta 23 IPI00180956.6 49 kDa protein 126 49001 3 3 3 3 3052 6409 1 0 1 572.7502 1143.4859 2 1143.4873 -0.0014 0 36.25 0.0004 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7511.7511.2.dta 23 IPI00180956.6 49 kDa protein 126 49001 3 3 3 3 4616 2536 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.31 2.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3371.3371.2.dta 23 IPI00791348.1 20 kDa protein 123 19811 3 3 3 3 521 2817 1 0 0 373.7057 745.3969 2 745.397 -0.0001 0 29.22 0.042 K TIEDLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3689.3689.2.dta 23 IPI00791348.1 20 kDa protein 123 19811 3 3 3 3 2790 3041 1 0 0 553.7845 1105.5544 2 1105.555 -0.0006 0 85.96 6.50E-08 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3939.3939.2.dta 23 IPI00791348.1 20 kDa protein 123 19811 3 3 3 3 4042 2588 1 0 0 639.7954 1277.5763 2 1277.5783 -0.002 0 60.04 1.30E-05 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3427.3427.2.dta 23 IPI00794807.1 15 kDa protein 108 15435 3 3 3 3 2728 2221 1 0 1 547.2852 1092.5558 2 1092.5563 -0.0006 1 14.04 0.048 R AQYDELARK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3034.3034.2.dta 23 IPI00794807.1 15 kDa protein 108 15435 3 3 3 3 4977 5578 1 0 1 710.3765 1418.7384 2 1418.7405 -0.0021 0 53.2 0.00011 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6647.6647.2.dta 23 IPI00794807.1 15 kDa protein 108 15435 3 3 3 3 5545 5077 1 0 1 761.8738 1521.733 2 1521.7345 -0.0015 0 78.5 4.40E-08 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6114.6114.2.dta 23 IPI00792454.1 30 kDa protein 108 30075 2 2 2 2 3224 6286 1 0 1 586.7662 1171.5178 2 1171.5186 -0.0008 0 41.32 0.00022 K DAEEWFFTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7386.7386.2.dta 23 IPI00792454.1 30 kDa protein 108 30075 2 2 2 2 4616 2536 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.31 2.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3371.3371.2.dta 23 IPI00184195.2 19 kDa protein 104 18696 4 4 4 4 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00184195.2 19 kDa protein 104 18696 4 4 4 4 2362 4280 1 0 0 521.306 1040.5974 2 1040.5978 -0.0004 0 48.62 7.90E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5264.5264.2.dta 23 IPI00184195.2 19 kDa protein 104 18696 4 4 4 4 3574 2620 1 0 0 611.8239 1221.6332 2 1221.6353 -0.0022 1 32.19 0.0014 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3461.3461.2.dta 23 IPI00184195.2 19 kDa protein 104 18696 4 4 4 4 3762 3782 1 0 1 622.3303 1242.6461 2 1242.6455 0.0006 0 51.31 0.00016 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4736.4736.2.dta 23 IPI00791156.1 31 kDa protein 94 30866 4 4 4 4 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00791156.1 31 kDa protein 94 30866 4 4 4 4 1959 2246 1 0 1 492.7537 983.4928 2 983.4924 0.0005 0 44.09 0.00053 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3061.3061.2.dta 23 IPI00791156.1 31 kDa protein 94 30866 4 4 4 4 3224 6286 1 0 1 586.7662 1171.5178 2 1171.5186 -0.0008 0 41.32 0.00022 K DAEEWFFTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7386.7386.2.dta 23 IPI00791156.1 31 kDa protein 94 30866 4 4 4 4 3574 2620 1 0 0 611.8239 1221.6332 2 1221.6353 -0.0022 1 32.19 0.0014 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3461.3461.2.dta 23 IPI00418663.3 Keratin-28 68 53733 2 2 2 2 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00418663.3 Keratin-28 68 53733 2 2 2 2 2788 1457 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 55.28 5.40E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2212.2212.2.dta 23 IPI00795353.1 11 kDa protein 65 10894 2 2 2 2 4977 5578 1 0 1 710.3765 1418.7384 2 1418.7405 -0.0021 0 53.2 0.00011 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6647.6647.2.dta 23 IPI00795353.1 11 kDa protein 65 10894 2 2 2 2 5474 2032 1 0 1 752.8958 1503.777 2 1503.7781 -0.0011 1 31.31 0.0012 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2832.2832.2.dta 23 IPI00794731.1 15 kDa protein 57 15182 1 1 1 1 3905 2039 1 0 1 630.788 1259.5615 2 1259.563 -0.0015 0 56.87 8.10E-06 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2840.2840.2.dta 23 IPI00794047.1 18 kDa protein 57 18209 2 2 2 2 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00794047.1 18 kDa protein 57 18209 2 2 2 2 1959 2246 1 0 1 492.7537 983.4928 2 983.4924 0.0005 0 44.09 0.00053 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3061.3061.2.dta 23 IPI00328103.2 Keratin-27 55 50419 1 1 1 1 2788 1457 1 0 0 553.7665 1105.5185 2 1105.5186 -0.0001 0 55.28 5.40E-05 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2212.2212.2.dta 23 IPI00748465.1 44 kDa protein 46 44811 1 1 1 1 1916 2741 1 0 1 488.2301 974.4457 2 974.4458 -0.0001 0 46.29 0.00031 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3602.3602.2.dta 23 IPI00792629.1 18 kDa protein 44 18074 1 1 1 1 1959 2246 1 0 1 492.7537 983.4928 2 983.4924 0.0005 0 44.09 0.00053 R QFTSSSSIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3061.3061.2.dta 23 IPI00791342.1 13 kDa protein 43 13121 3 3 3 3 521 2817 1 0 0 373.7057 745.3969 2 745.397 -0.0001 0 29.22 0.042 K TIEDLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3689.3689.2.dta 23 IPI00791342.1 13 kDa protein 43 13121 3 3 3 3 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00791342.1 13 kDa protein 43 13121 3 3 3 3 3949 3471 1 0 1 633.8357 1265.6568 2 1265.6615 -0.0047 1 21.32 0.01 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4405.4405.2.dta 23 IPI00789536.1 MGC102966 protein 40 15752 2 2 2 2 521 2817 1 0 0 373.7057 745.3969 2 745.397 -0.0001 0 29.22 0.042 K TIEDLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3689.3689.2.dta 23 IPI00789536.1 MGC102966 protein 40 15752 2 2 2 2 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00171196.2 keratin 13 isoform b 35 46181 2 2 2 2 805 3275 1 0 0 404.2036 806.3926 2 806.3923 0.0003 0 36.76 0.0031 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4196.4196.2.dta 23 IPI00171196.2 keratin 13 isoform b 35 46181 2 2 2 2 4590 3799 1 0 1 453.2439 1356.71 3 1356.711 -0.001 1 17.61 0.028 R QSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4754.4754.3.dta 23 IPI00737922.1 "similar to Keratin, type I cytoskeletal 18" 33 9331 1 1 1 1 5302 4394 1 0 1 491.9267 1472.7583 3 1472.7583 0 1 32.83 0.0081 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5387.5387.3.dta 23 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 18 49898 1 1 1 1 4590 3799 1 0 1 453.2439 1356.71 3 1356.711 -0.001 1 17.61 0.028 R QSVEADINGLRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4754.4754.3.dta 24 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 331 107484 9 9 9 9 470 3949 1 1 0 364.6844 727.3543 2 727.3541 0.0002 0 30.55 0.013 R FDFTAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4913.4913.2.dta 24 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 331 107484 9 9 9 9 1918 1474 1 1 1 488.2768 974.539 2 974.5396 -0.0007 1 37.42 0.0037 R KIQSLGDSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2230.2230.2.dta 24 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 331 107484 9 9 9 9 2695 2394 1 1 1 543.8111 1085.6076 2 1085.6081 -0.0004 0 49.02 0.00014 R IVAVTGAEAQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3219.3219.2.dta 24 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 331 107484 9 9 9 9 3758 2042 1 1 1 621.861 1241.7075 2 1241.7092 -0.0017 1 53.62 2.20E-05 R RIVAVTGAEAQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2843.2843.2.dta 24 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 331 107484 9 9 9 9 4923 3634 1 1 1 704.3523 1406.69 2 1406.6864 0.0036 0 72.78 1.50E-07 K AVYTQDCPLAAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4578.4578.2.dta 24 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 331 107484 9 9 9 9 4927 4776 1 1 1 704.8406 1407.6667 2 1407.6671 -0.0003 0 53.23 1.40E-05 R AVFDETYPDPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5793.5793.2.dta 24 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 331 107484 9 9 9 9 5381 4281 1 1 1 741.8289 1481.6433 2 1481.6456 -0.0024 0 88.5 5.00E-09 K VGAEDADGIDMAYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5265.5265.2.dta 24 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 331 107484 9 9 9 9 5663 4421 1 1 1 773.889 1545.7634 2 1545.7708 -0.0074 1 38.67 0.00051 K KAEEIANEMIEAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5415.5415.2.dta 24 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 331 107484 9 9 9 9 6218 3306 1 1 1 822.8997 1643.7849 2 1643.7872 -0.0023 0 72.05 7.10E-07 K ITCLCQVPQNAANR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4229.4229.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 484 1621 1 1 0 365.7148 729.415 2 729.4133 0.0017 0 35.58 0.0098 R LSNLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2387.2387.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 618 973 1 1 1 384.2061 766.3977 2 766.3973 0.0003 1 25.18 0.049 K DKVSYR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1699.1699.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 2256 3921 1 1 1 513.3027 1024.5908 2 1024.5917 -0.0009 0 39.66 0.00073 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4883.4883.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 2257 3777 1 1 1 513.3036 1024.5927 2 1024.5917 0.0011 0 51.29 6.10E-05 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4731.4731.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 2461 2767 1 1 1 528.2049 1054.3952 2 1054.3961 -0.0008 0 26.42 0.0023 R CDSNPCFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3629.3629.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 2462 2169 1 1 1 528.2055 1054.3965 2 1054.3961 0.0004 0 52.53 5.60E-06 R CDSNPCFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2979.2979.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 3490 1714 1 1 1 606.2557 1210.4968 2 1210.4972 -0.0004 1 35.27 0.00077 R RCDSNPCFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2494.2494.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 3719 3208 1 1 1 618.3405 1234.6665 2 1234.667 -0.0005 1 14.55 0.043 R QQVKETSFLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4125.4125.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 3720 3197 1 1 1 412.5649 1234.673 3 1234.667 0.006 1 44.33 0.00036 R QQVKETSFLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4113.4113.3.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 5976 3426 1 1 1 808.3761 1614.7376 2 1614.7387 -0.001 0 79.34 4.20E-08 R NSLWHTGDTSDQVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4357.4357.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 6301 5326 1 1 1 828.3935 1654.7724 2 1654.774 -0.0015 0 85.96 8.70E-09 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6378.6378.2.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 6302 5341 1 1 1 552.599 1654.7752 3 1654.774 0.0012 0 20.99 0.03 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6394.6394.3.dta 25 1 IPI00328550.3 Thrombospondin-4 precursor 320 108482 13 13 9 9 7477 4770 1 1 1 660.9543 1979.8412 3 1979.8418 -0.0006 0 36.51 0.00089 K DVDIDSYPDEELPCSAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5787.5787.3.dta 25 IPI00329535.2 Thrombospondin-3 precursor 89 106872 2 2 1 1 6301 5326 1 0 1 828.3935 1654.7724 2 1654.774 -0.0015 0 85.96 8.70E-09 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6378.6378.2.dta 25 IPI00329535.2 Thrombospondin-3 precursor 89 106872 2 2 1 1 6302 5341 1 0 1 552.599 1654.7752 3 1654.774 0.0012 0 20.99 0.03 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6394.6394.3.dta 25 IPI00028030.3 Cartilage oligomeric matrix protein precursor 69 85402 2 2 1 1 2256 3921 1 0 1 513.3027 1024.5908 2 1024.5917 -0.0009 0 39.66 0.00073 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4883.4883.2.dta 25 IPI00028030.3 Cartilage oligomeric matrix protein precursor 69 85402 2 2 1 1 2257 3777 1 0 1 513.3036 1024.5927 2 1024.5917 0.0011 0 51.29 6.10E-05 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4731.4731.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 2031 2113 1 1 1 498.2429 994.4713 2 994.4719 -0.0007 0 40.94 0.0011 R LETYENAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2919.2919.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 2198 3317 1 1 1 509.2635 1016.5124 2 1016.5138 -0.0014 0 54.89 8.00E-05 R AAELETDIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4241.4241.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 2491 5658 1 1 1 529.7958 1057.5771 2 1057.5767 0.0004 0 48.93 0.0003 R ESLEALLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6732.6732.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 2791 3442 1 1 1 553.7933 1105.5721 2 1105.5768 -0.0047 0 34.49 0.0041 K IQQQFSDLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4374.4374.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 2856 6499 1 1 1 559.3069 1116.5993 2 1116.6001 -0.0008 0 57.54 2.90E-05 K AEVLWLMGAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7607.7607.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 3205 5863 1 1 1 585.8165 1169.6185 2 1169.6193 -0.0008 0 49 4.10E-05 K NPGLWLESVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6954.6954.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 3817 2671 1 1 1 625.8019 1249.5892 2 1249.5907 -0.0015 0 17.19 0.024 R AGSVATCQAVMR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3518.3518.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 4021 3677 1 1 1 638.3029 1274.5912 2 1274.5925 -0.0013 0 67.36 2.30E-06 R AAQDLCEEALR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4623.4623.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 4403 3453 1 1 1 664.8193 1327.6241 2 1327.6255 -0.0014 0 54.36 8.00E-06 K AAVELEEPEDAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4386.4386.2.dta 26 1 IPI00305068.5 Pre-mRNA-processing factor 6 316 107656 10 10 10 10 6833 3412 1 1 1 873.448 1744.8814 2 1744.8843 -0.0029 0 91.43 1.70E-08 R LSQVSDSVSGQTVVDPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4342.4342.2.dta 26 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 153 47302 4 4 4 4 2491 5658 1 0 1 529.7958 1057.5771 2 1057.5767 0.0004 0 48.93 0.0003 R ESLEALLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6732.6732.2.dta 26 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 153 47302 4 4 4 4 2856 6499 1 0 1 559.3069 1116.5993 2 1116.6001 -0.0008 0 57.54 2.90E-05 K AEVLWLMGAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7607.7607.2.dta 26 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 153 47302 4 4 4 4 3205 5863 1 0 1 585.8165 1169.6185 2 1169.6193 -0.0008 0 49 4.10E-05 K NPGLWLESVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6954.6954.2.dta 26 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 153 47302 4 4 4 4 4021 3677 1 0 1 638.3029 1274.5912 2 1274.5925 -0.0013 0 67.36 2.30E-06 R AAQDLCEEALR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4623.4623.2.dta 27 1 IPI00645078.1 Ubiquitin-activating enzyme E1 310 118858 6 6 4 4 3903 4923 1 1 1 630.3689 1258.7232 2 1258.7245 -0.0013 0 61.97 6.40E-06 R LQTSSVLVSGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5950.5950.2.dta 27 1 IPI00645078.1 Ubiquitin-activating enzyme E1 310 118858 6 6 4 4 5143 4186 1 1 1 723.3365 1444.6585 2 1444.6617 -0.0031 0 76.78 6.30E-08 K DNPGVVTCLDEAR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5164.5164.2.dta 27 1 IPI00645078.1 Ubiquitin-activating enzyme E1 310 118858 6 6 4 4 6065 6212 1 1 1 541.9739 1622.9 3 1622.8992 0.0008 0 45.22 5.70E-05 R LAGTQPLEVLEAVQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7308.7308.3.dta 27 1 IPI00645078.1 Ubiquitin-activating enzyme E1 310 118858 6 6 4 4 6066 6193 1 1 1 812.4575 1622.9004 2 1622.8992 0.0012 0 81.21 2.40E-08 R LAGTQPLEVLEAVQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7289.7289.2.dta 27 1 IPI00645078.1 Ubiquitin-activating enzyme E1 310 118858 6 6 4 4 7232 6445 1 1 1 628.6532 1882.9378 3 1882.9384 -0.0007 0 55.49 6.30E-06 R NEEDAAELVALAQAVNAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7548.7548.3.dta 27 1 IPI00645078.1 Ubiquitin-activating enzyme E1 310 118858 6 6 4 4 7233 6444 1 1 1 942.478 1882.9414 2 1882.9384 0.003 0 80.13 5.10E-08 R NEEDAAELVALAQAVNAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7547.7547.2.dta 27 IPI00641319.1 Ubiquitin-activating enzyme E1 119 31030 2 2 2 2 3903 4923 1 0 1 630.3689 1258.7232 2 1258.7245 -0.0013 0 61.97 6.40E-06 R LQTSSVLVSGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5950.5950.2.dta 27 IPI00641319.1 Ubiquitin-activating enzyme E1 119 31030 2 2 2 2 5143 4186 1 0 1 723.3365 1444.6585 2 1444.6617 -0.0031 0 76.78 6.30E-08 K DNPGVVTCLDEAR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5164.5164.2.dta 27 IPI00026119.6 Ubiquitin-activating enzyme E1 110 57443 2 2 1 1 6065 6212 1 0 1 541.9739 1622.9 3 1622.8992 0.0008 0 45.22 5.70E-05 R LAGTQPLEVLEAVQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7308.7308.3.dta 27 IPI00026119.6 Ubiquitin-activating enzyme E1 110 57443 2 2 1 1 6066 6193 1 0 1 812.4575 1622.9004 2 1622.8992 0.0012 0 81.21 2.40E-08 R LAGTQPLEVLEAVQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7289.7289.2.dta 27 IPI00552452.1 Ubiquitin-activating enzyme E1 62 25264 1 1 1 1 3903 4923 1 0 1 630.3689 1258.7232 2 1258.7245 -0.0013 0 61.97 6.40E-06 R LQTSSVLVSGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5950.5950.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 402 2185 1 1 1 354.1961 706.3777 2 706.3762 0.0015 0 28.01 0.034 R AFVNTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2996.2996.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 898 1171 1 1 1 411.2476 820.4806 2 820.4807 -0.0001 1 33.93 0.0046 R KYAQAIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1909.1909.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 1882 1872 1 1 1 485.259 968.5035 2 968.5039 -0.0005 0 31.67 0.0027 K HELLNSTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2662.2662.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 2419 4581 1 1 1 525.2667 1048.5188 2 1048.5189 -0.0001 0 36.86 0.00075 K QVEELFER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5585.5585.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 2499 5963 1 1 1 530.782 1059.5495 2 1059.5502 -0.0006 0 71.1 2.30E-06 R SPTWFGIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7055.7055.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 2510 5021 1 1 1 531.7719 1061.5293 2 1061.5294 -0.0001 0 30.37 0.021 R SPSWYGIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6054.6054.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 2862 3933 1 1 1 559.8083 1117.6021 2 1117.6019 0.0002 0 40.72 0.0018 K STVVPVPYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4896.4896.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 2892 3104 1 1 1 562.2841 1122.5536 2 1122.5557 -0.0021 0 85.35 5.30E-08 K FAEALGSTEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4009.4009.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 3607 5820 1 1 1 614.7854 1227.5562 2 1227.556 0.0002 0 23.68 0.006 R EFSFEAWNAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6909.6909.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 3796 4984 1 1 1 624.3528 1246.691 2 1246.6921 -0.0011 0 63.98 6.10E-06 K FAQALGLTEAVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6015.6015.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 3995 4191 1 1 1 636.834 1271.6534 2 1271.6544 -0.001 0 31.06 0.0034 R SILSPGGSCGPIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5169.5169.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 5218 3263 1 1 1 729.8696 1457.7247 2 1457.7263 -0.0016 1 21.75 0.0091 R TNTPVKEDWNVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4183.4183.2.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 5475 4643 1 1 1 502.2672 1503.7797 3 1503.7794 0.0003 1 39.94 0.0012 R QLREQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5651.5651.3.dta 28 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 306 112859 14 14 14 14 6827 5617 1 1 1 872.4666 1742.9187 2 1742.9203 -0.0016 0 44.74 6.40E-05 R DQSAVVVQGLPEGVAFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6688.6688.2.dta 28 IPI00737506.2 Similar to General transcription factor II-I 205 68761 7 7 7 7 2499 5963 1 0 1 530.782 1059.5495 2 1059.5502 -0.0006 0 71.1 2.30E-06 R SPTWFGIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7055.7055.2.dta 28 IPI00737506.2 Similar to General transcription factor II-I 205 68761 7 7 7 7 2510 5021 1 0 1 531.7719 1061.5293 2 1061.5294 -0.0001 0 30.37 0.021 R SPSWYGIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6054.6054.2.dta 28 IPI00737506.2 Similar to General transcription factor II-I 205 68761 7 7 7 7 2892 3104 1 0 1 562.2841 1122.5536 2 1122.5557 -0.0021 0 85.35 5.30E-08 K FAEALGSTEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4009.4009.2.dta 28 IPI00737506.2 Similar to General transcription factor II-I 205 68761 7 7 7 7 3607 5820 1 0 1 614.7854 1227.5562 2 1227.556 0.0002 0 23.68 0.006 R EFSFEAWNAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6909.6909.2.dta 28 IPI00737506.2 Similar to General transcription factor II-I 205 68761 7 7 7 7 3796 4984 1 0 1 624.3528 1246.691 2 1246.6921 -0.0011 0 63.98 6.10E-06 K FAQALGLTEAVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6015.6015.2.dta 28 IPI00737506.2 Similar to General transcription factor II-I 205 68761 7 7 7 7 5218 3263 1 0 1 729.8696 1457.7247 2 1457.7263 -0.0016 1 21.75 0.0091 R TNTPVKEDWNVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4183.4183.2.dta 28 IPI00737506.2 Similar to General transcription factor II-I 205 68761 7 7 7 7 5475 4643 1 0 1 502.2672 1503.7797 3 1503.7794 0.0003 1 39.94 0.0012 R QLREQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5651.5651.3.dta 28 IPI00398199.2 GTF2I repeat domain containing 2B 40 108533 1 1 1 1 5475 4643 1 0 1 502.2672 1503.7797 3 1503.7794 0.0003 1 39.94 0.0012 K QLREQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5651.5651.3.dta 29 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 284 156697 7 7 7 7 1089 2890 1 0 1 422.2377 842.4609 2 842.461 -0.0001 0 50.06 0.00023 K ANELLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3768.3768.2.dta 29 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 284 156697 7 7 7 7 2248 1553 1 1 1 512.7686 1023.5227 2 1023.5236 -0.001 1 21.39 0.0099 R ESLKEYQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2314.2314.2.dta 29 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 284 156697 7 7 7 7 3962 6635 1 1 1 634.3499 1266.6853 2 1266.686 -0.0007 0 52.66 7.40E-05 R LLEVYDQLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7750.7750.2.dta 29 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 284 156697 7 7 7 7 5951 4225 1 1 1 804.3766 1606.7386 2 1606.7409 -0.0023 0 59.21 2.80E-06 R YVENPSQVLNCER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5205.5205.2.dta 29 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 284 156697 7 7 7 7 6775 5085 1 1 1 864.4721 1726.9297 2 1726.9326 -0.0029 0 109.57 5.30E-11 R VASVSQNAIVSAAGNIAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6123.6123.2.dta 29 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 284 156697 7 7 7 7 6922 4351 1 1 1 883.9274 1765.8403 2 1765.8417 -0.0014 0 74.47 1.00E-07 K ISNQVDLSNVCAQYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5340.5340.2.dta 29 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 284 156697 7 7 7 7 7429 5301 1 1 1 651.9811 1952.9216 3 1952.9228 -0.0012 0 27.75 0.0025 K HGEPEEDIVGLQAFQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6352.6352.3.dta 30 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 276 62320 8 8 8 8 758 701 1 1 1 399.1806 796.3466 2 796.3464 0.0002 0 30.59 0.0014 R GGSGGSYGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1411.1411.2.dta 30 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 276 62320 8 8 8 8 851 841 1 1 1 406.7528 811.491 2 811.4916 -0.0006 1 36.41 0.002 K KGPAAIQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1558.1558.2.dta 30 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 276 62320 8 8 8 8 1828 822 1 1 1 481.7484 961.4823 2 961.4828 -0.0005 1 49.19 0.00034 K SLEDTKNR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1539.1539.2.dta 30 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 276 62320 8 8 8 8 2501 4650 1 1 1 530.7853 1059.556 2 1059.556 0 0 42.79 0.00047 K TLLDIDNTR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5659.5659.2.dta 30 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 276 62320 8 8 8 8 3639 2273 1 1 1 616.8018 1231.5891 2 1231.5906 -0.0015 0 127.9 1.60E-12 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3090.3090.2.dta 30 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 276 62320 8 8 8 8 3687 1750 1 1 1 618.2676 1234.5207 2 1234.5215 -0.0007 0 69.47 5.60E-07 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2533.2533.2.dta 30 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 276 62320 8 8 8 8 6970 1543 1 1 1 597.9136 1790.7189 3 1790.7205 -0.0016 0 20.35 0.015 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2303.2303.3.dta 30 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 276 62320 8 8 8 8 8045 5093 1 1 1 837.3802 2509.1189 3 2509.1245 -0.0056 0 36.91 0.00035 K EIETYHNLLEGGQEDFESSGAGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6131.6131.3.dta 31 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 266 105962 9 9 8 8 279 4691 3 1 1 339.2208 676.427 2 676.4272 -0.0001 0 19.14 0.046 R IYLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5702.5702.2.dta 31 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 266 105962 9 9 8 8 1768 3740 1 1 1 478.7793 955.5441 2 955.545 -0.0009 0 52.08 0.00011 K LNEILQAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4691.4691.2.dta 31 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 266 105962 9 9 8 8 2936 2957 1 1 1 565.7929 1129.5713 2 1129.5727 -0.0015 0 51.06 0.00011 K LGSLVENNER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3845.3845.2.dta 31 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 266 105962 9 9 8 8 2964 5812 1 1 1 567.811 1133.6075 2 1133.608 -0.0005 0 58.37 2.50E-05 R FEELTNLIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6901.6901.2.dta 31 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 266 105962 9 9 8 8 3730 5961 1 1 1 619.3103 1236.6061 2 1236.606 0.0001 0 51.81 0.00014 K CLEEFELLGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7053.7053.2.dta 31 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 266 105962 9 9 8 8 4281 5381 1 1 1 655.9102 1309.8059 2 1309.8081 -0.0023 1 45.61 9.60E-05 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6436.6436.2.dta 31 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 266 105962 9 9 8 8 4282 5363 1 1 1 437.6097 1309.8074 3 1309.8081 -0.0007 1 40.79 0.00031 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6417.6417.3.dta 31 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 266 105962 9 9 8 8 5451 4311 1 1 1 499.5867 1495.7384 3 1495.7379 0.0005 0 44.14 0.00027 K DAHNALLDIQSSGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5297.5297.3.dta 31 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 266 105962 9 9 8 8 6874 4911 1 1 1 877.9663 1753.9181 2 1753.921 -0.0029 0 75.04 1.00E-07 R TEPTAQQNLALQLAEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5937.5937.2.dta 31 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 183 90789 7 7 6 6 279 4691 3 0 1 339.2208 676.427 2 676.4272 -0.0001 0 19.14 0.046 R IYLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5702.5702.2.dta 31 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 183 90789 7 7 6 6 1768 3740 1 0 1 478.7793 955.5441 2 955.545 -0.0009 0 52.08 0.00011 K LNEILQAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4691.4691.2.dta 31 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 183 90789 7 7 6 6 2964 5812 1 0 1 567.811 1133.6075 2 1133.608 -0.0005 0 58.37 2.50E-05 R FEELTNLIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6901.6901.2.dta 31 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 183 90789 7 7 6 6 3730 5961 1 0 1 619.3103 1236.6061 2 1236.606 0.0001 0 51.81 0.00014 K CLEEFELLGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7053.7053.2.dta 31 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 183 90789 7 7 6 6 4281 5381 1 0 1 655.9102 1309.8059 2 1309.8081 -0.0023 1 45.61 9.60E-05 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6436.6436.2.dta 31 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 183 90789 7 7 6 6 4282 5363 1 0 1 437.6097 1309.8074 3 1309.8081 -0.0007 1 40.79 0.00031 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6417.6417.3.dta 31 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 183 90789 7 7 6 6 5451 4311 1 0 1 499.5867 1495.7384 3 1495.7379 0.0005 0 44.14 0.00027 K DAHNALLDIQSSGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5297.5297.3.dta 31 IPI00738727.1 EIF3S8 protein 177 37827 5 5 4 4 2936 2957 1 0 1 565.7929 1129.5713 2 1129.5727 -0.0015 0 51.06 0.00011 K LGSLVENNER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3845.3845.2.dta 31 IPI00738727.1 EIF3S8 protein 177 37827 5 5 4 4 4281 5381 1 0 1 655.9102 1309.8059 2 1309.8081 -0.0023 1 45.61 9.60E-05 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6436.6436.2.dta 31 IPI00738727.1 EIF3S8 protein 177 37827 5 5 4 4 4282 5363 1 0 1 437.6097 1309.8074 3 1309.8081 -0.0007 1 40.79 0.00031 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6417.6417.3.dta 31 IPI00738727.1 EIF3S8 protein 177 37827 5 5 4 4 5451 4311 1 0 1 499.5867 1495.7384 3 1495.7379 0.0005 0 44.14 0.00027 K DAHNALLDIQSSGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5297.5297.3.dta 31 IPI00738727.1 EIF3S8 protein 177 37827 5 5 4 4 6874 4911 1 0 1 877.9663 1753.9181 2 1753.921 -0.0029 0 75.04 1.00E-07 R TEPTAQQNLALQLAEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5937.5937.2.dta 32 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 259 67889 9 9 9 9 1190 2157 1 1 1 431.735 861.4555 2 861.4556 -0.0001 0 66.78 5.00E-06 K TGTELVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2966.2966.2.dta 32 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 259 67889 9 9 9 9 1536 4898 1 1 1 462.7872 923.5599 2 923.5552 0.0047 0 36.44 0.0014 K ANLPLLQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5923.5923.2.dta 32 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 259 67889 9 9 9 9 2082 2319 1 1 1 500.7653 999.5161 2 999.5172 -0.0011 0 56.03 4.90E-05 R VCTISPAPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3139.3139.2.dta 32 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 259 67889 9 9 9 9 2318 2493 1 1 1 517.2718 1032.5291 2 1032.5274 0.0018 0 34.96 0.0095 K IQAMSEVQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3325.3325.2.dta 32 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 259 67889 9 9 9 9 2329 4290 1 1 1 518.2773 1034.5401 2 1034.5396 0.0005 0 62.71 4.00E-06 K AFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5275.5275.2.dta 32 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 259 67889 9 9 9 9 3174 1517 1 1 1 583.793 1165.5714 2 1165.5727 -0.0013 1 38.92 0.0024 R YNENTELRK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2276.2276.2.dta 32 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 259 67889 9 9 9 9 4382 1625 1 1 1 663.2817 1324.5488 2 1324.55 -0.0012 0 61.84 2.40E-06 K ASETCSGCNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2391.2391.2.dta 32 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 259 67889 9 9 9 9 5195 1219 1 1 1 485.2219 1452.6438 3 1452.6449 -0.0012 1 45.7 0.00021 R KASETCSGCNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1960.1960.3.dta 32 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 259 67889 9 9 9 9 7167 5299 1 1 1 621.3265 1860.9578 3 1860.9581 -0.0003 1 32.85 0.0012 K AVAEAEQKAFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6350.6350.3.dta 32 IPI00021473.1 MTG16 36 59566 1 1 1 1 1536 4898 1 0 1 462.7872 923.5599 2 923.5552 0.0047 0 36.44 0.0014 K ANLPLLQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5923.5923.2.dta 33 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 254 189761 9 9 9 9 529 4016 1 1 1 374.2292 746.4438 2 746.4439 -0.0001 0 32.34 0.0075 K IQAFIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4984.4984.2.dta 33 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 254 189761 9 9 9 9 937 5120 1 1 1 414.2711 826.5276 2 826.5276 -0.0001 0 43.24 0.0002 R LIVDVIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6160.6160.2.dta 33 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 254 189761 9 9 9 9 1794 2795 1 1 1 479.8055 957.5964 2 957.5971 -0.0007 1 25.43 0.013 R TILLNTKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3663.3663.2.dta 33 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 254 189761 9 9 9 9 2078 720 1 1 1 500.2554 998.4962 2 998.4967 -0.0005 0 65.11 4.20E-06 K MLQHAASNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1430.1430.2.dta 33 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 254 189761 9 9 9 9 2390 1149 1 1 1 523.285 1044.5555 2 1044.5564 -0.0008 1 19.22 0.032 K KLAVGDNNSK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1885.1885.2.dta 33 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 254 189761 9 9 9 9 2860 5209 1 1 1 559.8049 1117.5952 2 1117.5954 -0.0002 0 27.48 0.036 K LIFQMPQNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6255.6255.2.dta 33 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 254 189761 9 9 9 9 3723 3005 1 1 1 618.8331 1235.6517 2 1235.651 0.0007 0 72.88 9.20E-07 K LQQTYAALNSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3900.3900.2.dta 33 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 254 189761 9 9 9 9 5384 4635 1 1 1 742.3405 1482.6665 2 1482.6667 -0.0002 0 58.99 1.10E-05 K ATFYGEQVDYYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5643.5643.2.dta 33 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 254 189761 9 9 9 9 6870 5404 1 1 1 877.4872 1752.9598 2 1752.9622 -0.0024 0 81.31 2.40E-08 K VDQIQEIVTGNPTVIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6461.6461.2.dta 33 IPI00299048.6 Isoform 1 of Ras GTPase-activating-like protein IQGAP2 27 181071 1 1 1 1 2860 5209 1 0 1 559.8049 1117.5952 2 1117.5954 -0.0002 0 27.48 0.036 K LIFQMPQNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6255.6255.2.dta 34 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 253 118104 8 8 8 8 1178 4987 1 1 1 430.2476 858.4806 2 858.4811 -0.0004 0 26.19 0.013 R SDLGNLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6018.6018.2.dta 34 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 253 118104 8 8 8 8 1764 1968 1 1 1 478.7339 955.4533 2 955.4545 -0.0012 0 44.08 0.00042 R HGNLCLDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2764.2764.2.dta 34 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 253 118104 8 8 8 8 2781 5659 1 1 1 552.7993 1103.5841 2 1103.5863 -0.0022 0 51.43 5.40E-05 K AFLDSLPDVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6733.6733.2.dta 34 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 253 118104 8 8 8 8 3054 2755 1 1 1 572.7845 1143.5544 2 1143.552 0.0024 0 40.67 0.0011 R EQGNIEEAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3616.3616.2.dta 34 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 253 118104 8 8 8 8 3374 7189 1 1 1 598.8607 1195.7069 2 1195.7077 -0.0008 0 40.98 0.0004 R VPNSVLWLLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8327.8327.2.dta 34 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 253 118104 8 8 8 8 3517 5011 1 1 1 607.852 1213.6894 2 1213.6918 -0.0024 0 67.43 2.40E-06 K LVSIVADQLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6044.6044.2.dta 34 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 253 118104 8 8 8 8 4824 5002 1 1 1 696.8405 1391.6664 2 1391.6681 -0.0017 0 34.73 0.0012 K DSGNIPEAIASYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6034.6034.2.dta 34 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 253 118104 8 8 8 8 6300 3920 1 1 1 828.369 1654.7235 2 1654.7257 -0.0022 0 93.52 1.70E-09 K GSVAEAEDCYNTALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4882.4882.2.dta 34 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 247 104029 7 7 7 7 1764 1968 1 0 1 478.7339 955.4533 2 955.4545 -0.0012 0 44.08 0.00042 R HGNLCLDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2764.2764.2.dta 34 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 247 104029 7 7 7 7 2781 5659 1 0 1 552.7993 1103.5841 2 1103.5863 -0.0022 0 51.43 5.40E-05 K AFLDSLPDVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6733.6733.2.dta 34 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 247 104029 7 7 7 7 3054 2755 1 0 1 572.7845 1143.5544 2 1143.552 0.0024 0 40.67 0.0011 R EQGNIEEAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3616.3616.2.dta 34 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 247 104029 7 7 7 7 3374 7189 1 0 1 598.8607 1195.7069 2 1195.7077 -0.0008 0 40.98 0.0004 R VPNSVLWLLR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8327.8327.2.dta 34 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 247 104029 7 7 7 7 3517 5011 1 0 1 607.852 1213.6894 2 1213.6918 -0.0024 0 67.43 2.40E-06 K LVSIVADQLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6044.6044.2.dta 34 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 247 104029 7 7 7 7 4824 5002 1 0 1 696.8405 1391.6664 2 1391.6681 -0.0017 0 34.73 0.0012 K DSGNIPEAIASYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6034.6034.2.dta 34 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 247 104029 7 7 7 7 6300 3920 1 0 1 828.369 1654.7235 2 1654.7257 -0.0022 0 93.52 1.70E-09 K GSVAEAEDCYNTALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4882.4882.2.dta 34 IPI00794271.1 20 kDa protein 26 20166 1 1 1 1 1178 4987 1 0 1 430.2476 858.4806 2 858.4811 -0.0004 0 26.19 0.013 R SDLGNLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6018.6018.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 984 4566 1 1 1 418.2206 834.4267 2 834.4269 -0.0002 0 37.37 0.0056 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5569.5569.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 985 3944 1 1 1 418.2211 834.4276 2 834.4269 0.0007 0 53.37 0.00014 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4908.4908.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 986 4116 1 1 1 418.2211 834.4276 2 834.4269 0.0007 0 46.17 0.00074 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5089.5089.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 987 4423 1 1 1 418.2212 834.4278 2 834.4269 0.0009 0 40.57 0.0027 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5418.5418.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 988 3807 1 1 1 418.2225 834.4305 2 834.4269 0.0035 0 29.91 0.03 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4763.4763.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 995 2437 1 1 1 418.7408 835.4671 2 835.4664 0.0007 1 37.36 0.0027 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3266.3266.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1035 3127 1 1 1 419.7553 837.4961 2 837.496 0.0002 0 22.4 0.028 K ALPAPIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4034.4034.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1040 5873 1 1 1 419.7553 837.4961 2 837.496 0.0002 0 22.51 0.027 K ALPAPIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6963.6963.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1129 3608 1 1 1 426.2171 850.4196 2 850.4218 -0.0022 0 27.22 0.036 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4550.4550.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1130 3594 1 1 1 426.2176 850.4206 2 850.4218 -0.0013 0 31.33 0.013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4535.4535.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1136 327 1 1 1 426.2181 850.4216 2 850.4218 -0.0002 0 28.06 0.042 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.10455.10455.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1141 3451 1 1 1 426.2182 850.4218 2 850.4218 0 0 36.62 0.0058 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4384.4384.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1144 6599 1 1 1 426.2183 850.422 2 850.4218 0.0002 0 29.82 0.028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7710.7710.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1146 2956 1 1 1 426.2184 850.4223 2 850.4218 0.0004 0 45.02 0.00084 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3843.3843.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1147 3892 1 1 1 426.2185 850.4224 2 850.4218 0.0006 0 33.5 0.012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4852.4852.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 1149 3736 1 1 1 426.2187 850.4229 2 850.4218 0.0011 0 35.68 0.0072 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4687.4687.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 3967 3945 1 1 1 634.3838 1266.753 2 1266.7547 -0.0017 1 34.6 0.0015 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4909.4909.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 3968 4244 1 1 1 634.3842 1266.7539 2 1266.7547 -0.0008 1 36.32 0.00081 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5226.5226.2.dta 35 1 IPI00384938.1 Hypothetical protein DKFZp686N02209 249 53503 19 19 4 4 3969 3819 1 1 1 634.3845 1266.7545 2 1266.7547 -0.0002 1 60.36 3.20E-06 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4775.4775.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 984 4566 1 0 1 418.2206 834.4267 2 834.4269 -0.0002 0 37.37 0.0056 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5569.5569.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 985 3944 1 0 1 418.2211 834.4276 2 834.4269 0.0007 0 53.37 0.00014 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4908.4908.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 986 4116 1 0 1 418.2211 834.4276 2 834.4269 0.0007 0 46.17 0.00074 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5089.5089.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 987 4423 1 0 1 418.2212 834.4278 2 834.4269 0.0009 0 40.57 0.0027 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5418.5418.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 988 3807 1 0 1 418.2225 834.4305 2 834.4269 0.0035 0 29.91 0.03 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4763.4763.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1035 3127 1 0 1 419.7553 837.4961 2 837.496 0.0002 0 22.4 0.028 K ALPAPIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4034.4034.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1040 5873 1 0 1 419.7553 837.4961 2 837.496 0.0002 0 22.51 0.027 K ALPAPIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6963.6963.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1129 3608 1 0 1 426.2171 850.4196 2 850.4218 -0.0022 0 27.22 0.036 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4550.4550.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1130 3594 1 0 1 426.2176 850.4206 2 850.4218 -0.0013 0 31.33 0.013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4535.4535.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1136 327 1 0 1 426.2181 850.4216 2 850.4218 -0.0002 0 28.06 0.042 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.10455.10455.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1141 3451 1 0 1 426.2182 850.4218 2 850.4218 0 0 36.62 0.0058 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4384.4384.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1144 6599 1 0 1 426.2183 850.422 2 850.4218 0.0002 0 29.82 0.028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7710.7710.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1146 2956 1 0 1 426.2184 850.4223 2 850.4218 0.0004 0 45.02 0.00084 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3843.3843.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1147 3892 1 0 1 426.2185 850.4224 2 850.4218 0.0006 0 33.5 0.012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4852.4852.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 1149 3736 1 0 1 426.2187 850.4229 2 850.4218 0.0011 0 35.68 0.0072 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4687.4687.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 3967 3945 1 0 1 634.3838 1266.753 2 1266.7547 -0.0017 1 34.6 0.0015 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4909.4909.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 3968 4244 1 0 1 634.3842 1266.7539 2 1266.7547 -0.0008 1 36.32 0.00081 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5226.5226.2.dta 35 IPI00168728.1 FLJ00385 protein (Fragment) 235 57272 18 18 3 3 3969 3819 1 0 1 634.3845 1266.7545 2 1266.7547 -0.0002 1 60.36 3.20E-06 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4775.4775.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 984 4566 1 0 1 418.2206 834.4267 2 834.4269 -0.0002 0 37.37 0.0056 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5569.5569.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 985 3944 1 0 1 418.2211 834.4276 2 834.4269 0.0007 0 53.37 0.00014 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4908.4908.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 986 4116 1 0 1 418.2211 834.4276 2 834.4269 0.0007 0 46.17 0.00074 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5089.5089.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 987 4423 1 0 1 418.2212 834.4278 2 834.4269 0.0009 0 40.57 0.0027 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5418.5418.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 988 3807 1 0 1 418.2225 834.4305 2 834.4269 0.0035 0 29.91 0.03 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4763.4763.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 995 2437 1 0 1 418.7408 835.4671 2 835.4664 0.0007 1 37.36 0.0027 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3266.3266.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 1129 3608 1 0 1 426.2171 850.4196 2 850.4218 -0.0022 0 27.22 0.036 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4550.4550.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 1130 3594 1 0 1 426.2176 850.4206 2 850.4218 -0.0013 0 31.33 0.013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4535.4535.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 1136 327 1 0 1 426.2181 850.4216 2 850.4218 -0.0002 0 28.06 0.042 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.10455.10455.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 1141 3451 1 0 1 426.2182 850.4218 2 850.4218 0 0 36.62 0.0058 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4384.4384.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 1144 6599 1 0 1 426.2183 850.422 2 850.4218 0.0002 0 29.82 0.028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7710.7710.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 1146 2956 1 0 1 426.2184 850.4223 2 850.4218 0.0004 0 45.02 0.00084 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3843.3843.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 1147 3892 1 0 1 426.2185 850.4224 2 850.4218 0.0006 0 33.5 0.012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4852.4852.2.dta 35 IPI00426051.3 Hypothetical protein DKFZp686C15213 168 51864 14 14 2 2 1149 3736 1 0 1 426.2187 850.4229 2 850.4218 0.0011 0 35.68 0.0072 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4687.4687.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 984 4566 1 0 1 418.2206 834.4267 2 834.4269 -0.0002 0 37.37 0.0056 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5569.5569.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 985 3944 1 0 1 418.2211 834.4276 2 834.4269 0.0007 0 53.37 0.00014 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4908.4908.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 986 4116 1 0 1 418.2211 834.4276 2 834.4269 0.0007 0 46.17 0.00074 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5089.5089.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 987 4423 1 0 1 418.2212 834.4278 2 834.4269 0.0009 0 40.57 0.0027 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5418.5418.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 988 3807 1 0 1 418.2225 834.4305 2 834.4269 0.0035 0 29.91 0.03 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4763.4763.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 1129 3608 1 0 1 426.2171 850.4196 2 850.4218 -0.0022 0 27.22 0.036 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4550.4550.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 1130 3594 1 0 1 426.2176 850.4206 2 850.4218 -0.0013 0 31.33 0.013 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4535.4535.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 1136 327 1 0 1 426.2181 850.4216 2 850.4218 -0.0002 0 28.06 0.042 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.10455.10455.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 1141 3451 1 0 1 426.2182 850.4218 2 850.4218 0 0 36.62 0.0058 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4384.4384.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 1144 6599 1 0 1 426.2183 850.422 2 850.4218 0.0002 0 29.82 0.028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7710.7710.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 1146 2956 1 0 1 426.2184 850.4223 2 850.4218 0.0004 0 45.02 0.00084 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3843.3843.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 1147 3892 1 0 1 426.2185 850.4224 2 850.4218 0.0006 0 33.5 0.012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4852.4852.2.dta 35 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 154 46716 13 13 1 1 1149 3736 1 0 1 426.2187 850.4229 2 850.4218 0.0011 0 35.68 0.0072 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4687.4687.2.dta 35 IPI00007899.2 Single chain Fv (Fragment) 37 12349 1 1 1 1 995 2437 1 0 1 418.7408 835.4671 2 835.4664 0.0007 1 37.36 0.0027 K GRFTISR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3266.3266.2.dta 36 1 IPI00100160.3 Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 241 137999 7 7 7 7 2000 3140 1 1 1 495.2578 988.501 2 988.5012 -0.0001 0 23.3 0.017 R NVVAECLGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4047.4047.2.dta 36 1 IPI00100160.3 Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 241 137999 7 7 7 7 2679 5445 1 1 1 542.3436 1082.6727 2 1082.6699 0.0028 0 49.95 2.10E-05 K ALTLIAGSPLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6503.6503.2.dta 36 1 IPI00100160.3 Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 241 137999 7 7 7 7 4161 5235 1 1 1 648.3427 1294.6708 2 1294.6703 0.0004 0 57.58 1.30E-05 R TYIQCIAAISR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6283.6283.2.dta 36 1 IPI00100160.3 Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 241 137999 7 7 7 7 4491 4901 1 1 1 672.8712 1343.7279 2 1343.7231 0.0048 0 25.75 0.006 R LSTLCPSAVLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5926.5926.2.dta 36 1 IPI00100160.3 Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 241 137999 7 7 7 7 5399 5898 1 1 1 743.8977 1485.7809 2 1485.7828 -0.0019 0 55.45 6.30E-06 K EGPAVVGQFIQDVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6989.6989.2.dta 36 1 IPI00100160.3 Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 241 137999 7 7 7 7 5655 5958 1 1 1 771.9576 1541.9006 2 1541.9028 -0.0022 0 92.75 1.60E-09 K ITSEALLVTQQLVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7050.7050.2.dta 36 1 IPI00100160.3 Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 241 137999 7 7 7 7 7571 5083 1 1 1 683.0324 2046.0754 3 2046.0786 -0.0032 0 38.12 0.00027 K VIRPLDQPSSFDATPYIK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6120.6120.3.dta 36 IPI00604431.1 Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 142 119182 5 5 5 5 2000 3140 1 0 1 495.2578 988.501 2 988.5012 -0.0001 0 23.3 0.017 R NVVAECLGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4047.4047.2.dta 36 IPI00604431.1 Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 142 119182 5 5 5 5 2679 5445 1 0 1 542.3436 1082.6727 2 1082.6699 0.0028 0 49.95 2.10E-05 K ALTLIAGSPLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6503.6503.2.dta 36 IPI00604431.1 Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 142 119182 5 5 5 5 4161 5235 1 0 1 648.3427 1294.6708 2 1294.6703 0.0004 0 57.58 1.30E-05 R TYIQCIAAISR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6283.6283.2.dta 36 IPI00604431.1 Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 142 119182 5 5 5 5 4491 4901 1 0 1 672.8712 1343.7279 2 1343.7231 0.0048 0 25.75 0.006 R LSTLCPSAVLQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5926.5926.2.dta 36 IPI00604431.1 Isoform 2 of Cullin-associated NEDD8-dissociated protein 1 142 119182 5 5 5 5 5399 5898 1 0 1 743.8977 1485.7809 2 1485.7828 -0.0019 0 55.45 6.30E-06 K EGPAVVGQFIQDVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6989.6989.2.dta 36 IPI00604731.1 Isoform 3 of Cullin-associated NEDD8-dissociated protein 1 131 46308 2 2 2 2 4161 5235 1 0 1 648.3427 1294.6708 2 1294.6703 0.0004 0 57.58 1.30E-05 R TYIQCIAAISR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6283.6283.2.dta 36 IPI00604731.1 Isoform 3 of Cullin-associated NEDD8-dissociated protein 1 131 46308 2 2 2 2 5655 5958 1 0 1 771.9576 1541.9006 2 1541.9028 -0.0022 0 92.75 1.60E-09 K ITSEALLVTQQLVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7050.7050.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 569 3926 1 1 1 379.232 756.4495 2 756.4494 0.0001 0 25.85 0.045 K LDIAAVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4888.4888.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 1288 1616 1 1 1 437.7351 873.4557 2 873.4556 0.0001 0 49.98 5.10E-05 R VGAGDSQLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2381.2381.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 1394 4547 1 1 1 450.7688 899.5231 2 899.5229 0.0002 0 29.18 0.025 R LVNQWIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5549.5549.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 1979 4130 1 1 1 494.2953 986.5761 2 986.576 0.0001 0 42.02 0.00083 K NLQSVVLSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5104.5104.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 2334 4205 1 1 1 518.7563 1035.4981 2 1035.4985 -0.0004 0 29.94 0.022 K DIYQDLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5184.5184.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 3381 3163 1 1 1 599.3027 1196.5909 2 1196.5925 -0.0015 0 67.01 5.20E-07 K LTSLNEEYTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4074.4074.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 3735 2575 1 1 1 619.7808 1237.547 2 1237.5509 -0.004 0 51.25 3.50E-05 R QAANLQDCYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3413.3413.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 3766 6581 1 1 1 622.3482 1242.6819 2 1242.6819 -0.0001 0 46.23 0.00054 K DSLIIIDELGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7691.7691.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 4358 4103 1 1 1 660.8477 1319.6809 2 1319.6834 -0.0025 0 69.06 2.40E-06 R QVGVGYVDSIQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5075.5075.2.dta 37 1 IPI00017303.1 DNA mismatch repair protein Msh2 235 105418 10 10 10 10 5533 3790 1 1 1 760.8391 1519.6637 2 1519.6647 -0.001 0 25.5 0.0045 K ECVLPGGETAGDMGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4744.4744.2.dta 37 IPI00783458.1 MSH2-Ex5 isoform (Fragment) 51 11803 1 1 1 1 3735 2575 1 0 1 619.7808 1237.547 2 1237.5509 -0.004 0 51.25 3.50E-05 R QAANLQDCYR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3413.3413.2.dta 37 IPI00783348.1 MSH2-Ex3 isoform (Fragment) 47 23694 2 2 2 2 1979 4130 1 0 1 494.2953 986.5761 2 986.576 0.0001 0 42.02 0.00083 K NLQSVVLSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5104.5104.2.dta 37 IPI00783348.1 MSH2-Ex3 isoform (Fragment) 47 23694 2 2 2 2 2334 4205 1 0 1 518.7563 1035.4981 2 1035.4985 -0.0004 0 29.94 0.022 K DIYQDLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5184.5184.2.dta 38 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 234 160023 6 6 6 6 938 5359 1 1 1 414.2711 826.5276 2 826.5276 0 0 40.24 0.0004 R LLAEILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6413.6413.2.dta 38 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 234 160023 6 6 6 6 3993 2217 1 1 1 636.8304 1271.6462 2 1271.647 -0.0008 0 77.03 4.10E-07 K TVLDQQQTPSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3030.3030.2.dta 38 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 234 160023 6 6 6 6 4295 2150 1 1 1 657.3313 1312.648 2 1312.651 -0.003 1 52.76 1.10E-05 K SYVSEKDVTSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2958.2958.2.dta 38 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 234 160023 6 6 6 6 4412 5523 1 1 1 664.8791 1327.7436 2 1327.7459 -0.0023 0 42.19 0.00077 K SNTLPISLQSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6588.6588.2.dta 38 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 234 160023 6 6 6 6 4681 2892 1 1 1 458.2608 1371.7606 3 1371.7609 -0.0003 1 19.19 0.04 K LVEKGETDLIQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3770.3770.3.dta 38 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 234 160023 6 6 6 6 6627 4518 1 1 1 848.9133 1695.812 2 1695.8138 -0.0018 0 105.9 2.00E-10 R LIASYCNVGDIEGASK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5518.5518.2.dta 39 1 IPI00021405.3 Isoform A of Lamin-A/C 226 74380 7 7 7 7 2279 4761 1 1 1 514.7903 1027.5661 2 1027.5662 0 0 69.31 2.00E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5777.5777.2.dta 39 1 IPI00021405.3 Isoform A of Lamin-A/C 226 74380 7 7 7 7 3764 3184 1 1 1 622.3357 1242.6568 2 1242.6568 0.0001 1 23.85 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4098.4098.2.dta 39 1 IPI00021405.3 Isoform A of Lamin-A/C 226 74380 7 7 7 7 4607 2401 1 1 1 680.3462 1358.6778 2 1358.679 -0.0012 0 46.93 4.00E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3226.3226.2.dta 39 1 IPI00021405.3 Isoform A of Lamin-A/C 226 74380 7 7 7 7 4627 3341 1 1 1 682.3115 1362.6085 2 1362.6099 -0.0014 0 53.15 1.00E-05 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4267.4267.2.dta 39 1 IPI00021405.3 Isoform A of Lamin-A/C 226 74380 7 7 7 7 5419 4255 1 1 1 746.3765 1490.7385 2 1490.7399 -0.0014 0 85 1.10E-08 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5237.5237.2.dta 39 1 IPI00021405.3 Isoform A of Lamin-A/C 226 74380 7 7 7 7 5518 456 1 1 1 506.9093 1517.7061 3 1517.707 -0.001 0 24.63 0.0068 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1150.1150.3.dta 39 1 IPI00021405.3 Isoform A of Lamin-A/C 226 74380 7 7 7 7 6867 3674 1 1 1 584.9592 1751.8557 3 1751.855 0.0006 0 23.84 0.0058 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4620.4620.3.dta 39 IPI00514320.3 Lamin A/C 195 57897 6 6 6 6 2279 4761 1 0 1 514.7903 1027.5661 2 1027.5662 0 0 69.31 2.00E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5777.5777.2.dta 39 IPI00514320.3 Lamin A/C 195 57897 6 6 6 6 3764 3184 1 0 1 622.3357 1242.6568 2 1242.6568 0.0001 1 23.85 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4098.4098.2.dta 39 IPI00514320.3 Lamin A/C 195 57897 6 6 6 6 4627 3341 1 0 1 682.3115 1362.6085 2 1362.6099 -0.0014 0 53.15 1.00E-05 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4267.4267.2.dta 39 IPI00514320.3 Lamin A/C 195 57897 6 6 6 6 5419 4255 1 0 1 746.3765 1490.7385 2 1490.7399 -0.0014 0 85 1.10E-08 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5237.5237.2.dta 39 IPI00514320.3 Lamin A/C 195 57897 6 6 6 6 5518 456 1 0 1 506.9093 1517.7061 3 1517.707 -0.001 0 24.63 0.0068 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1150.1150.3.dta 39 IPI00514320.3 Lamin A/C 195 57897 6 6 6 6 6867 3674 1 0 1 584.9592 1751.8557 3 1751.855 0.0006 0 23.84 0.0058 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4620.4620.3.dta 39 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 189 55605 6 6 6 6 2279 4761 1 0 1 514.7903 1027.5661 2 1027.5662 0 0 69.31 2.00E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5777.5777.2.dta 39 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 189 55605 6 6 6 6 3764 3184 1 0 1 622.3357 1242.6568 2 1242.6568 0.0001 1 23.85 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4098.4098.2.dta 39 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 189 55605 6 6 6 6 4607 2401 1 0 1 680.3462 1358.6778 2 1358.679 -0.0012 0 46.93 4.00E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3226.3226.2.dta 39 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 189 55605 6 6 6 6 5419 4255 1 0 1 746.3765 1490.7385 2 1490.7399 -0.0014 0 85 1.10E-08 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5237.5237.2.dta 39 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 189 55605 6 6 6 6 5518 456 1 0 1 506.9093 1517.7061 3 1517.707 -0.001 0 24.63 0.0068 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1150.1150.3.dta 39 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 189 55605 6 6 6 6 6867 3674 1 0 1 584.9592 1751.8557 3 1751.855 0.0006 0 23.84 0.0058 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4620.4620.3.dta 39 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 159 70903 6 6 6 6 2279 4761 1 0 1 514.7903 1027.5661 2 1027.5662 0 0 69.31 2.00E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5777.5777.2.dta 39 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 159 70903 6 6 6 6 3764 3184 1 0 1 622.3357 1242.6568 2 1242.6568 0.0001 1 23.85 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4098.4098.2.dta 39 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 159 70903 6 6 6 6 4607 2401 1 0 1 680.3462 1358.6778 2 1358.679 -0.0012 0 46.93 4.00E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3226.3226.2.dta 39 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 159 70903 6 6 6 6 4627 3341 1 0 1 682.3115 1362.6085 2 1362.6099 -0.0014 0 53.15 1.00E-05 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4267.4267.2.dta 39 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 159 70903 6 6 6 6 5518 456 1 0 1 506.9093 1517.7061 3 1517.707 -0.001 0 24.63 0.0068 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1150.1150.3.dta 39 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 159 70903 6 6 6 6 6867 3674 1 0 1 584.9592 1751.8557 3 1751.855 0.0006 0 23.84 0.0058 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4620.4620.3.dta 39 IPI00514204.3 Lamin A/C 122 53219 5 5 5 5 2279 4761 1 0 1 514.7903 1027.5661 2 1027.5662 0 0 69.31 2.00E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5777.5777.2.dta 39 IPI00514204.3 Lamin A/C 122 53219 5 5 5 5 3764 3184 1 0 1 622.3357 1242.6568 2 1242.6568 0.0001 1 23.85 0.0058 K LLEGEEERLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4098.4098.2.dta 39 IPI00514204.3 Lamin A/C 122 53219 5 5 5 5 4607 2401 1 0 1 680.3462 1358.6778 2 1358.679 -0.0012 0 46.93 4.00E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3226.3226.2.dta 39 IPI00514204.3 Lamin A/C 122 53219 5 5 5 5 5518 456 1 0 1 506.9093 1517.7061 3 1517.707 -0.001 0 24.63 0.0068 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1150.1150.3.dta 39 IPI00514204.3 Lamin A/C 122 53219 5 5 5 5 6867 3674 1 0 1 584.9592 1751.8557 3 1751.855 0.0006 0 23.84 0.0058 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4620.4620.3.dta 40 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 219 96250 9 9 9 9 692 3567 1 1 1 392.7566 783.4986 2 783.4966 0.0019 0 37.04 0.00083 R LIQIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4507.4507.2.dta 40 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 219 96250 9 9 9 9 1647 5919 1 1 1 470.2533 938.4921 2 938.4933 -0.0012 1 21.54 0.044 K HAASNPSKK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.701.701.2.dta 40 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 219 96250 9 9 9 9 1952 695 1 1 1 491.7202 981.4259 2 981.4264 -0.0005 0 67.9 1.30E-06 R SGGGGYSQNR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1404.1404.2.dta 40 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 219 96250 9 9 9 9 1973 2567 1 1 1 493.7851 985.5556 2 985.5556 0 1 34.81 0.0068 R GLKAELAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3404.3404.2.dta 40 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 219 96250 9 9 9 9 2714 597 1 1 1 364.5249 1090.553 3 1090.5519 0.0011 1 28.38 0.021 R KRPYEENR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1301.1301.3.dta 40 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 219 96250 9 9 9 9 4466 4953 1 1 1 671.3029 1340.5912 2 1340.5932 -0.002 0 52.1 1.30E-05 K NCAVEFNFGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5982.5982.2.dta 40 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 219 96250 9 9 9 9 5386 2405 1 1 1 495.2599 1482.758 3 1482.7579 0.0001 0 21.79 0.009 K HLPSTEPDPHVVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3230.3230.3.dta 40 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 219 96250 9 9 9 9 6219 3977 1 1 1 548.9467 1643.8183 3 1643.8189 -0.0005 1 17.45 0.042 K AIVICPTDEDLKDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4943.4943.3.dta 40 1 IPI00013070.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 219 96250 9 9 9 9 6819 4656 1 1 1 871.427 1740.8395 2 1740.8431 -0.0036 0 99.17 1.50E-09 R NYILDQTNVYGSAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5665.5665.2.dta 40 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 212 84903 8 8 8 8 692 3567 1 0 1 392.7566 783.4986 2 783.4966 0.0019 0 37.04 0.00083 R LIQIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4507.4507.2.dta 40 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 212 84903 8 8 8 8 1647 5919 1 0 1 470.2533 938.4921 2 938.4933 -0.0012 1 21.54 0.044 K HAASNPSKK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.701.701.2.dta 40 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 212 84903 8 8 8 8 1952 695 1 0 1 491.7202 981.4259 2 981.4264 -0.0005 0 67.9 1.30E-06 R SGGGGYSQNR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1404.1404.2.dta 40 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 212 84903 8 8 8 8 1973 2567 1 0 1 493.7851 985.5556 2 985.5556 0 1 34.81 0.0068 R GLKAELAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3404.3404.2.dta 40 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 212 84903 8 8 8 8 2714 597 1 0 1 364.5249 1090.553 3 1090.5519 0.0011 1 28.38 0.021 R KRPYEENR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1301.1301.3.dta 40 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 212 84903 8 8 8 8 4466 4953 1 0 1 671.3029 1340.5912 2 1340.5932 -0.002 0 52.1 1.30E-05 K NCAVEFNFGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5982.5982.2.dta 40 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 212 84903 8 8 8 8 6219 3977 1 0 1 548.9467 1643.8183 3 1643.8189 -0.0005 1 17.45 0.042 K AIVICPTDEDLKDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4943.4943.3.dta 40 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 212 84903 8 8 8 8 6819 4656 1 0 1 871.427 1740.8395 2 1740.8431 -0.0036 0 99.17 1.50E-09 R NYILDQTNVYGSAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5665.5665.2.dta 40 IPI00736859.1 Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 210 85311 8 8 8 8 692 3567 1 0 1 392.7566 783.4986 2 783.4966 0.0019 0 37.04 0.00083 R LIQIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4507.4507.2.dta 40 IPI00736859.1 Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 210 85311 8 8 8 8 1647 5919 1 0 1 470.2533 938.4921 2 938.4933 -0.0012 1 21.54 0.044 K HAASNPSKK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.701.701.2.dta 40 IPI00736859.1 Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 210 85311 8 8 8 8 1952 695 1 0 1 491.7202 981.4259 2 981.4264 -0.0005 0 67.9 1.30E-06 R SGGGGYSQNR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1404.1404.2.dta 40 IPI00736859.1 Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 210 85311 8 8 8 8 2714 597 1 0 1 364.5249 1090.553 3 1090.5519 0.0011 1 28.38 0.021 R KRPYEENR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1301.1301.3.dta 40 IPI00736859.1 Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 210 85311 8 8 8 8 4466 4953 1 0 1 671.3029 1340.5912 2 1340.5932 -0.002 0 52.1 1.30E-05 K NCAVEFNFGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5982.5982.2.dta 40 IPI00736859.1 Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 210 85311 8 8 8 8 5386 2405 1 0 1 495.2599 1482.758 3 1482.7579 0.0001 0 21.79 0.009 K HLPSTEPDPHVVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3230.3230.3.dta 40 IPI00736859.1 Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 210 85311 8 8 8 8 6219 3977 1 0 1 548.9467 1643.8183 3 1643.8189 -0.0005 1 17.45 0.042 K AIVICPTDEDLKDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4943.4943.3.dta 40 IPI00736859.1 Isoform 4 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 210 85311 8 8 8 8 6819 4656 1 0 1 871.427 1740.8395 2 1740.8431 -0.0036 0 99.17 1.50E-09 R NYILDQTNVYGSAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5665.5665.2.dta 40 IPI00386971.3 Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 68 42277 1 1 1 1 1952 695 1 0 1 491.7202 981.4259 2 981.4264 -0.0005 0 67.9 1.30E-06 R SGGGGYSQNR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1404.1404.2.dta 40 IPI00296805.5 Tetraspanin-10 37 37387 1 1 1 1 692 3567 1 0 1 392.7566 783.4986 2 783.4966 0.0019 0 37.04 0.00083 R LLGALAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4507.4507.2.dta 40 IPI00258093.2 Heterogeneous nuclear ribonucleoprotein U-like 1 35 13831 1 1 1 1 1973 2567 1 0 1 493.7851 985.5556 2 985.5556 0 1 34.81 0.0068 R GLKAELAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3404.3404.2.dta 41 1 IPI00032258.4 Complement C4-A precursor 203 194247 5 5 5 5 327 2153 1 1 1 346.1985 690.3824 2 690.3813 0.0011 0 28.21 0.032 R IQQFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2962.2962.2.dta 41 1 IPI00032258.4 Complement C4-A precursor 203 194247 5 5 5 5 1205 3344 1 1 1 433.2241 864.4337 2 864.4341 -0.0004 0 54.29 9.50E-05 K ANSFLGEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4270.4270.2.dta 41 1 IPI00032258.4 Complement C4-A precursor 203 194247 5 5 5 5 2345 2978 1 1 1 519.7822 1037.5498 2 1037.5506 -0.0008 0 48.76 9.40E-05 K DHAVDLIQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3869.3869.2.dta 41 1 IPI00032258.4 Complement C4-A precursor 203 194247 5 5 5 5 4655 7550 1 1 1 684.3632 1366.7119 2 1366.7133 -0.0014 0 59.75 7.90E-06 R DSSTWLTAFVLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8769.8769.2.dta 41 1 IPI00032258.4 Complement C4-A precursor 203 194247 5 5 5 5 5651 3922 1 1 1 771.4106 1540.8067 2 1540.8097 -0.0029 0 103.52 2.00E-10 K VLSLAQEQVGGSPEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4884.4884.2.dta 41 IPI00643525.1 Complement component 4A 175 194218 4 4 4 4 327 2153 1 0 1 346.1985 690.3824 2 690.3813 0.0011 0 28.21 0.032 R IQQFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2962.2962.2.dta 41 IPI00643525.1 Complement component 4A 175 194218 4 4 4 4 2345 2978 1 0 1 519.7822 1037.5498 2 1037.5506 -0.0008 0 48.76 9.40E-05 K DHAVDLIQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3869.3869.2.dta 41 IPI00643525.1 Complement component 4A 175 194218 4 4 4 4 4655 7550 1 0 1 684.3632 1366.7119 2 1366.7133 -0.0014 0 59.75 7.90E-06 R DSSTWLTAFVLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8769.8769.2.dta 41 IPI00643525.1 Complement component 4A 175 194218 4 4 4 4 5651 3922 1 0 1 771.4106 1540.8067 2 1540.8097 -0.0029 0 103.52 2.00E-10 K VLSLAQEQVGGSPEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4884.4884.2.dta 41 IPI00418163.3 complement component 4B preproprotein 136 194170 3 3 3 3 327 2153 1 0 1 346.1985 690.3824 2 690.3813 0.0011 0 28.21 0.032 R IQQFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2962.2962.2.dta 41 IPI00418163.3 complement component 4B preproprotein 136 194170 3 3 3 3 2345 2978 1 0 1 519.7822 1037.5498 2 1037.5506 -0.0008 0 48.76 9.40E-05 K DHAVDLIQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3869.3869.2.dta 41 IPI00418163.3 complement component 4B preproprotein 136 194170 3 3 3 3 5651 3922 1 0 1 771.4106 1540.8067 2 1540.8097 -0.0029 0 103.52 2.00E-10 K VLSLAQEQVGGSPEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4884.4884.2.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 198 42052 6 6 6 6 2942 3496 1 1 1 566.7657 1131.5168 2 1131.5197 -0.0028 0 58.02 1.60E-05 R GYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4432.4432.2.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 198 42052 6 6 6 6 3141 4131 1 1 1 581.3129 1160.6112 2 1160.6111 0.0001 0 33.08 0.013 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5105.5105.2.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 198 42052 6 6 6 6 4569 1680 1 1 1 677.815 1353.6155 2 1353.6161 -0.0006 1 50.94 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2448.2448.2.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 198 42052 6 6 6 6 5514 2788 1 1 1 506.2389 1515.6948 3 1515.6954 -0.0005 0 38.86 0.00038 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3656.3656.3.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 198 42052 6 6 6 6 6969 5675 1 1 1 895.9487 1789.8829 2 1789.8846 -0.0017 0 65.83 2.20E-06 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6750.6750.2.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 198 42052 6 6 6 6 7430 4787 1 1 1 652.0263 1953.0571 3 1953.0571 0 0 55.54 2.10E-05 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5805.5805.3.dta 42 IPI00794523.2 ACTG1 protein 130 28478 4 4 4 4 2942 3496 1 0 1 566.7657 1131.5168 2 1131.5197 -0.0028 0 58.02 1.60E-05 R GYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4432.4432.2.dta 42 IPI00794523.2 ACTG1 protein 130 28478 4 4 4 4 3141 4131 1 0 1 581.3129 1160.6112 2 1160.6111 0.0001 0 33.08 0.013 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5105.5105.2.dta 42 IPI00794523.2 ACTG1 protein 130 28478 4 4 4 4 5514 2788 1 0 1 506.2389 1515.6948 3 1515.6954 -0.0005 0 38.86 0.00038 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3656.3656.3.dta 42 IPI00794523.2 ACTG1 protein 130 28478 4 4 4 4 6969 5675 1 0 1 895.9487 1789.8829 2 1789.8846 -0.0017 0 65.83 2.20E-06 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6750.6750.2.dta 42 IPI00008603.1 "Actin, aortic smooth muscle" 107 42381 3 3 3 3 3141 4131 1 0 1 581.3129 1160.6112 2 1160.6111 0.0001 0 33.08 0.013 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5105.5105.2.dta 42 IPI00008603.1 "Actin, aortic smooth muscle" 107 42381 3 3 3 3 4569 1680 1 0 1 677.815 1353.6155 2 1353.6161 -0.0006 1 50.94 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2448.2448.2.dta 42 IPI00008603.1 "Actin, aortic smooth muscle" 107 42381 3 3 3 3 6969 5675 1 0 1 895.9487 1789.8829 2 1789.8846 -0.0017 0 65.83 2.20E-06 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6750.6750.2.dta 42 IPI00003269.1 hypothetical protein LOC345651 96 42318 2 2 2 2 6969 5675 1 0 1 895.9487 1789.8829 2 1789.8846 -0.0017 0 65.83 2.20E-06 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6750.6750.2.dta 42 IPI00003269.1 hypothetical protein LOC345651 96 42318 2 2 2 2 7430 4787 2 0 1 652.0263 1953.0571 3 1953.0571 0 0 51.95 4.80E-05 R VAPDEHPILLTEAPLNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5805.5805.3.dta 42 IPI00790339.1 22 kDa protein 88 22189 2 2 2 2 4569 1680 1 0 1 677.815 1353.6155 2 1353.6161 -0.0006 1 50.94 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2448.2448.2.dta 42 IPI00790339.1 22 kDa protein 88 22189 2 2 2 2 7430 4787 1 0 1 652.0263 1953.0571 3 1953.0571 0 0 55.54 2.10E-05 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5805.5805.3.dta 42 IPI00555900.1 FKSG30 85 42331 2 2 2 2 5514 2788 1 0 1 506.2389 1515.6948 3 1515.6954 -0.0005 0 38.86 0.00038 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3656.3656.3.dta 42 IPI00555900.1 FKSG30 85 42331 2 2 2 2 6969 5675 1 0 1 895.9487 1789.8829 2 1789.8846 -0.0017 0 65.83 2.20E-06 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6750.6750.2.dta 42 IPI00816229.1 ACTA2 protein (Fragment) 74 37125 2 2 2 2 3141 4131 1 0 1 581.3129 1160.6112 2 1160.6111 0.0001 0 33.08 0.013 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5105.5105.2.dta 42 IPI00816229.1 ACTA2 protein (Fragment) 74 37125 2 2 2 2 6969 5675 1 0 1 895.9487 1789.8829 2 1789.8846 -0.0017 0 65.83 2.20E-06 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6750.6750.2.dta 42 IPI00414057.2 Actin alpha 1 skeletal muscle protein 63 28454 2 2 2 2 3141 4131 1 0 1 581.3129 1160.6112 2 1160.6111 0.0001 0 33.08 0.013 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5105.5105.2.dta 42 IPI00414057.2 Actin alpha 1 skeletal muscle protein 63 28454 2 2 2 2 4569 1680 1 0 1 677.815 1353.6155 2 1353.6161 -0.0006 1 50.94 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2448.2448.2.dta 42 IPI00555733.1 Actin-like protein (Fragment) 56 11861 1 1 1 1 7430 4787 1 0 1 652.0263 1953.0571 3 1953.0571 0 0 55.54 2.10E-05 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5805.5805.3.dta 42 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 51 16919 1 1 1 1 4569 1680 1 0 1 677.815 1353.6155 2 1353.6161 -0.0006 1 50.94 1.70E-05 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2448.2448.2.dta 42 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 39 118740 1 1 1 1 5514 2788 1 0 1 506.2389 1515.6948 3 1515.6954 -0.0005 0 38.86 0.00038 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3656.3656.3.dta 42 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 33 23821 1 1 1 1 3141 4131 1 0 1 581.3129 1160.6112 2 1160.6111 0.0001 0 33.08 0.013 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5105.5105.2.dta 43 1 IPI00000873.3 Valyl-tRNA synthetase 198 141642 6 6 6 6 587 599 1 1 1 380.2398 758.4651 2 758.465 0.0001 1 41.24 0.0014 K TAAQLKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1303.1303.2.dta 43 1 IPI00000873.3 Valyl-tRNA synthetase 198 141642 6 6 6 6 3153 5032 1 1 1 582.3235 1162.6324 2 1162.6346 -0.0022 0 66.23 3.20E-06 K LSAAVTEAFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6066.6066.2.dta 43 1 IPI00000873.3 Valyl-tRNA synthetase 198 141642 6 6 6 6 3814 1103 1 1 1 625.3297 1248.6449 2 1248.6462 -0.0014 0 26.23 0.014 K IQQQQPPPGEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1836.1836.2.dta 43 1 IPI00000873.3 Valyl-tRNA synthetase 198 141642 6 6 6 6 5289 5260 1 1 1 735.3901 1468.7656 2 1468.7634 0.0022 0 88.06 8.60E-09 R SSAQDPQAVLGALGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6309.6309.2.dta 43 1 IPI00000873.3 Valyl-tRNA synthetase 198 141642 6 6 6 6 5912 2863 1 1 1 533.2424 1596.7055 3 1596.707 -0.0015 0 41.52 0.00013 R YGEAGEGPGWGGAHPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3739.3739.3.dta 43 1 IPI00000873.3 Valyl-tRNA synthetase 198 141642 6 6 6 6 5971 5231 1 1 1 807.3914 1612.7683 2 1612.7701 -0.0019 0 34.57 0.00074 R GIEDNPMVVPLCNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6278.6278.2.dta 43 IPI00646425.2 similar to Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (Protein G7a) isoform 1 137 40256 4 4 4 4 587 599 1 0 1 380.2398 758.4651 2 758.465 0.0001 1 41.24 0.0014 K TAAQLKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1303.1303.2.dta 43 IPI00646425.2 similar to Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (Protein G7a) isoform 1 137 40256 4 4 4 4 3814 1103 1 0 1 625.3297 1248.6449 2 1248.6462 -0.0014 0 26.23 0.014 K IQQQQPPPGEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1836.1836.2.dta 43 IPI00646425.2 similar to Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (Protein G7a) isoform 1 137 40256 4 4 4 4 5289 5260 1 0 1 735.3901 1468.7656 2 1468.7634 0.0022 0 88.06 8.60E-09 R SSAQDPQAVLGALGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6309.6309.2.dta 43 IPI00646425.2 similar to Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (Protein G7a) isoform 1 137 40256 4 4 4 4 5912 2863 1 0 1 533.2424 1596.7055 3 1596.707 -0.0015 0 41.52 0.00013 R YGEAGEGPGWGGAHPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3739.3739.3.dta 43 IPI00793323.1 Valyl-tRNA synthetase 112 18217 2 2 2 2 5289 5260 1 0 1 735.3901 1468.7656 2 1468.7634 0.0022 0 88.06 8.60E-09 R SSAQDPQAVLGALGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6309.6309.2.dta 43 IPI00793323.1 Valyl-tRNA synthetase 112 18217 2 2 2 2 5912 2863 1 0 1 533.2424 1596.7055 3 1596.707 -0.0015 0 41.52 0.00013 R YGEAGEGPGWGGAHPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3739.3739.3.dta 43 IPI00788898.1 Valyl-tRNA synthetase 35 32775 1 1 1 1 5971 5231 1 0 1 807.3914 1612.7683 2 1612.7701 -0.0019 0 34.57 0.00074 R GIEDNPMVVPLCNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6278.6278.2.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 103 3394 1 1 0 312.1734 622.3323 2 622.3326 -0.0003 0 26.82 0.043 R SLFEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4323.4323.2.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 411 806 1 1 1 356.2113 710.4081 2 710.4075 0.0005 0 25.97 0.005 R VHLSQK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1522.1522.2.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 658 2534 1 1 0 388.1762 774.3378 2 774.3371 0.0007 0 18.57 0.046 K TGFYCK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3369.3369.2.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 1115 4222 1 1 1 424.21 846.4055 2 846.4083 -0.0028 0 29.27 0.01 R DLDELSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5202.5202.2.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 1161 2308 1 1 1 427.2298 852.4451 2 852.4454 -0.0003 0 33.09 0.0025 R GPGPLQER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3127.3127.2.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 3056 4366 1 1 1 382.2026 1143.586 3 1143.5859 0.0001 0 43.2 0.0012 R VVHIMDFQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5356.5356.3.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 3057 4372 1 1 1 572.8009 1143.5873 2 1143.5859 0.0013 0 21.66 0.023 R VVHIMDFQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5362.5362.2.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 3136 3318 1 1 1 387.5341 1159.5803 3 1159.5808 -0.0005 0 36.28 0.0015 R VVHIMDFQR G Oxidation (M) 0.000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4242.4242.3.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 4377 2551 1 1 1 662.8402 1323.6659 2 1323.6644 0.0015 0 71.12 2.40E-07 R GNLGAGNGNLQGPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3387.3387.2.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 7458 6271 1 1 1 985.0415 1968.0685 2 1968.0721 -0.0036 0 22.69 0.0074 R IGPYQPNVPVGIDYVIPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7371.7371.2.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 7562 4250 1 1 1 679.696 2036.0661 3 2036.0691 -0.003 0 44.93 6.10E-05 R VIHLSNLPHSGYSDSAVLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5232.5232.3.dta 44 1 IPI00017297.1 Matrin-3 198 95078 12 12 10 10 7783 4896 1 1 1 788.0314 2361.0725 3 2361.0622 0.0103 1 31.22 0.0012 R DSFDDRGPSLNPVLDYDHGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5921.5921.3.dta 44 IPI00740968.1 similar to Matrin-3 29 12100 1 1 1 1 1115 4222 1 0 1 424.21 846.4055 2 846.4083 -0.0028 0 29.27 0.01 R DLDELSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5202.5202.2.dta 44 IPI00470923.2 Hypothetical protein DKFZp686L22104 25 31601 2 2 2 2 658 2534 1 0 0 388.1762 774.3378 2 774.3371 0.0007 0 18.57 0.046 K TGFYCK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3369.3369.2.dta 44 IPI00470923.2 Hypothetical protein DKFZp686L22104 25 31601 2 2 2 2 7458 6271 1 0 1 985.0415 1968.0685 2 1968.0721 -0.0036 0 22.69 0.0074 R IGPYQPNVPVGIDYVIPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7371.7371.2.dta 45 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 197 72953 5 5 5 5 2232 5738 1 1 1 511.2817 1020.5488 2 1020.5491 -0.0003 0 31.12 0.0042 R LIDFLESGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6817.6817.2.dta 45 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 197 72953 5 5 5 5 4388 3034 1 1 1 663.3566 1324.6987 2 1324.6986 0.0001 0 66.48 3.50E-06 K VLEEANQAINPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3931.3931.2.dta 45 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 197 72953 5 5 5 5 4660 5833 1 1 0 684.8681 1367.7217 2 1367.7231 -0.0015 0 30.47 0.0021 R GDGPICLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6923.6923.2.dta 45 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 197 72953 5 5 5 5 5204 3017 1 1 1 728.3443 1454.674 2 1454.675 -0.0009 0 89.05 4.50E-09 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3913.3913.2.dta 45 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 197 72953 5 5 5 5 6548 4933 1 1 1 846.4145 1690.8145 2 1690.8162 -0.0017 0 55.31 6.50E-06 R ELAQQVQQVADDYGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5960.5960.2.dta 45 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 46 69618 2 2 2 2 1967 4748 1 0 1 493.2873 984.5601 2 984.5604 -0.0003 0 34.98 0.0036 K LLQLVEDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5763.5763.2.dta 45 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 46 69618 2 2 2 2 4660 5833 1 0 0 684.8681 1367.7217 2 1367.7231 -0.0015 0 30.47 0.0021 R GDGPICLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6923.6923.2.dta 45 IPI00798375.1 23 kDa protein 35 23474 1 1 1 1 1967 4748 1 0 1 493.2873 984.5601 2 984.5604 -0.0003 0 34.98 0.0036 K LLQLVEDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5763.5763.2.dta 46 1 IPI00024661.4 Protein transport protein Sec24C 194 119779 8 8 8 8 651 4842 1 1 1 387.2295 772.4445 2 772.4443 0.0002 0 29.12 0.046 R GLIDSLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5863.5863.2.dta 46 1 IPI00024661.4 Protein transport protein Sec24C 194 119779 8 8 8 8 854 3109 1 1 1 407.2443 812.474 2 812.4756 -0.0016 0 23.02 0.011 R GVLNSPVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4014.4014.2.dta 46 1 IPI00024661.4 Protein transport protein Sec24C 194 119779 8 8 8 8 1558 3741 1 1 1 464.2498 926.4851 2 926.4862 -0.001 0 23.55 0.041 R VGFVTYNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4692.4692.2.dta 46 1 IPI00024661.4 Protein transport protein Sec24C 194 119779 8 8 8 8 2513 4040 1 1 1 531.7826 1061.5506 2 1061.5506 0.0001 0 45.16 0.0008 R GTEPFVTGVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5008.5008.2.dta 46 1 IPI00024661.4 Protein transport protein Sec24C 194 119779 8 8 8 8 4664 2606 1 1 1 685.3502 1368.6858 2 1368.6885 -0.0027 0 63.45 6.60E-06 K SPVESTTEPPAVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3446.3446.2.dta 46 1 IPI00024661.4 Protein transport protein Sec24C 194 119779 8 8 8 8 5389 3502 1 1 1 743.333 1484.6515 2 1484.6532 -0.0017 0 67.69 7.20E-07 K YASFQVENDQER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4438.4438.2.dta 46 1 IPI00024661.4 Protein transport protein Sec24C 194 119779 8 8 8 8 5506 6181 1 1 1 756.9425 1511.8705 2 1511.8712 -0.0007 0 33.94 0.0012 R GQVPPLVTTNFLVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7276.7276.2.dta 46 1 IPI00024661.4 Protein transport protein Sec24C 194 119779 8 8 8 8 6361 5034 1 1 1 833.9418 1665.8691 2 1665.8726 -0.0035 0 63.26 6.20E-06 K TLFQPQTGAYQTLAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6068.6068.2.dta 46 IPI00647787.1 112 kDa protein 192 113510 7 7 7 7 854 3109 1 0 1 407.2443 812.474 2 812.4756 -0.0016 0 23.02 0.011 R GVLNSPVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4014.4014.2.dta 46 IPI00647787.1 112 kDa protein 192 113510 7 7 7 7 1558 3741 1 0 1 464.2498 926.4851 2 926.4862 -0.001 0 23.55 0.041 R VGFVTYNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4692.4692.2.dta 46 IPI00647787.1 112 kDa protein 192 113510 7 7 7 7 2513 4040 1 0 1 531.7826 1061.5506 2 1061.5506 0.0001 0 45.16 0.0008 R GTEPFVTGVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5008.5008.2.dta 46 IPI00647787.1 112 kDa protein 192 113510 7 7 7 7 4664 2606 1 0 1 685.3502 1368.6858 2 1368.6885 -0.0027 0 63.45 6.60E-06 K SPVESTTEPPAVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3446.3446.2.dta 46 IPI00647787.1 112 kDa protein 192 113510 7 7 7 7 5389 3502 1 0 1 743.333 1484.6515 2 1484.6532 -0.0017 0 67.69 7.20E-07 K YASFQVENDQER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4438.4438.2.dta 46 IPI00647787.1 112 kDa protein 192 113510 7 7 7 7 5506 6181 1 0 1 756.9425 1511.8705 2 1511.8712 -0.0007 0 33.94 0.0012 R GQVPPLVTTNFLVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7276.7276.2.dta 46 IPI00647787.1 112 kDa protein 192 113510 7 7 7 7 6361 5034 1 0 1 833.9418 1665.8691 2 1665.8726 -0.0035 0 63.26 6.20E-06 K TLFQPQTGAYQTLAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6068.6068.2.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 1531 4699 1 1 1 462.7507 923.4868 2 923.4865 0.0003 0 39.18 0.00051 R VVFQEFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5711.5711.2.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 1800 868 1 1 1 480.2611 958.5077 2 958.5083 -0.0007 1 28.61 0.016 K VNKDDIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1587.1587.2.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 2356 3345 1 1 1 347.2267 1038.6581 3 1038.655 0.0032 0 21.08 0.025 K VKPLLQVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4271.4271.3.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 3350 4921 1 1 1 597.3115 1192.6084 2 1192.6088 -0.0004 0 67.06 8.60E-07 K ALELDSNLYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5948.5948.2.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 4243 5590 1 1 1 653.336 1304.6574 2 1304.6612 -0.0038 0 58.97 3.00E-06 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6659.6659.2.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 4717 3273 1 1 1 689.3898 1376.7651 2 1376.7663 -0.0012 1 43.26 0.00012 R TVGQLYKEQLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4194.4194.2.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 5755 5740 1 1 1 524.6228 1570.8466 3 1570.8468 -0.0002 0 15.61 0.034 K VSHLLGINVTDFTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6819.6819.3.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 5841 4055 1 1 1 527.2858 1578.8357 3 1578.8365 -0.0009 1 16.54 0.045 R AGVLAHLEEERDLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5024.5024.3.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 5978 6091 1 1 1 808.4121 1614.8097 2 1614.8109 -0.0012 0 25.05 0.025 R IMGIPEEEQMGLLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7184.7184.2.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 6774 7093 1 1 1 863.9778 1725.9411 2 1725.9413 -0.0002 0 36.38 0.0014 R QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8226.8226.2.dta 47 1 IPI00019502.3 Myosin-9 193 227646 11 11 11 11 7040 3994 1 1 1 605.9745 1814.9016 3 1814.901 0.0007 1 25.71 0.023 K IAQLEEQLDNETKER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4961.4961.3.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 1531 4699 1 0 1 462.7507 923.4868 2 923.4865 0.0003 0 39.18 0.00051 R VVFQEFR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5711.5711.2.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 2356 3345 1 0 1 347.2267 1038.6581 3 1038.655 0.0032 0 21.08 0.025 K VKPLLQVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4271.4271.3.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 3350 4921 1 0 1 597.3115 1192.6084 2 1192.6088 -0.0004 0 67.06 8.60E-07 K ALELDSNLYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5948.5948.2.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 4243 5590 1 0 1 653.336 1304.6574 2 1304.6612 -0.0038 0 58.97 3.00E-06 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6659.6659.2.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 4717 3273 1 0 1 689.3898 1376.7651 2 1376.7663 -0.0012 1 43.26 0.00012 R TVGQLYKEQLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4194.4194.2.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 5755 5740 1 0 1 524.6228 1570.8466 3 1570.8468 -0.0002 0 15.61 0.034 K VSHLLGINVTDFTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6819.6819.3.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 5841 4055 1 0 1 527.2858 1578.8357 3 1578.8365 -0.0009 1 16.54 0.045 R AGVLAHLEEERDLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5024.5024.3.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 5978 6091 1 0 1 808.4121 1614.8097 2 1614.8109 -0.0012 0 25.05 0.025 R IMGIPEEEQMGLLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7184.7184.2.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 6774 7093 1 0 1 863.9778 1725.9411 2 1725.9413 -0.0002 0 36.38 0.0014 R QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8226.8226.2.dta 47 IPI00395772.4 Hypothetical protein DKFZp451J0218 187 155148 10 10 10 10 7040 3994 1 0 1 605.9745 1814.9016 3 1814.901 0.0007 1 25.71 0.023 K IAQLEEQLDNETKER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4961.4961.3.dta 47 IPI00029818.4 Isoform 5 of Myosin-14 77 170107 2 2 2 2 4243 5590 1 0 1 653.336 1304.6574 2 1304.6612 -0.0038 0 58.97 3.00E-06 K EQADFALEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6659.6659.2.dta 47 IPI00029818.4 Isoform 5 of Myosin-14 77 170107 2 2 2 2 6774 7093 1 0 1 863.9778 1725.9411 2 1725.9413 -0.0002 0 36.38 0.0014 R QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8226.8226.2.dta 47 IPI00020501.1 Myosin-11 36 228054 1 1 1 1 6774 7093 1 0 1 863.9778 1725.9411 2 1725.9413 -0.0002 0 36.38 0.0014 K QLLQANPILEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8226.8226.2.dta 47 IPI00556012.1 MYH9 protein 29 24989 1 1 1 1 1800 868 1 0 1 480.2611 958.5077 2 958.5083 -0.0007 1 28.61 0.016 K VNKDDIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1587.1587.2.dta 47 IPI00742780.1 FLJ00279 protein (Fragment) 26 66015 1 1 1 1 7040 3994 1 0 1 605.9745 1814.9016 3 1814.901 0.0007 1 25.71 0.023 K IAQLEEQLDNETKER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4961.4961.3.dta 47 IPI00397526.2 Isoform 1 of Myosin-10 17 229824 1 1 1 1 5841 4055 1 0 1 527.2858 1578.8357 3 1578.8365 -0.0009 1 16.54 0.045 R AGVLAHLEEERDLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5024.5024.3.dta 48 1 IPI00022744.5 Isoform 1 of Exportin-2 188 111145 7 7 7 7 799 2457 1 1 1 402.7047 803.3948 2 803.396 -0.0012 0 38.33 0.0014 R AACDLVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3287.3287.2.dta 48 1 IPI00022744.5 Isoform 1 of Exportin-2 188 111145 7 7 7 7 1658 4162 1 1 1 470.7821 939.5497 2 939.5502 -0.0005 0 33.94 0.00066 R TGNIPALVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5138.5138.2.dta 48 1 IPI00022744.5 Isoform 1 of Exportin-2 188 111145 7 7 7 7 1753 5319 1 1 1 477.3052 952.5958 2 952.5957 0.0001 0 21.2 0.017 K IIIPEIQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6370.6370.2.dta 48 1 IPI00022744.5 Isoform 1 of Exportin-2 188 111145 7 7 7 7 2401 2171 1 1 1 349.542 1045.6042 3 1045.6032 0.001 0 44.54 0.00011 K IHLAQSLHK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2981.2981.3.dta 48 1 IPI00022744.5 Isoform 1 of Exportin-2 188 111145 7 7 7 7 5374 1526 1 1 1 494.2325 1479.6757 3 1479.6776 -0.0019 0 39.09 0.00022 K EHDPVGQMVNNPK I Oxidation (M) 0.0000000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2285.2285.3.dta 48 1 IPI00022744.5 Isoform 1 of Exportin-2 188 111145 7 7 7 7 7024 5402 1 1 1 906.4265 1810.8385 2 1810.8407 -0.0022 0 99.86 1.10E-09 K NLFEDQNTLTSICEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6459.6459.2.dta 48 1 IPI00022744.5 Isoform 1 of Exportin-2 188 111145 7 7 7 7 7567 4017 1 1 1 681.9676 2042.8809 3 2042.8817 -0.0007 1 20.49 0.038 R AADEEAFEDNSEEYIRR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4986.4986.3.dta 48 IPI00003935.6 Histone H2B type 2-E 21 13912 1 1 1 1 1753 5319 1 0 1 477.3052 952.5958 2 952.5957 0.0001 0 21.2 0.017 R LLLPGELAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6370.6370.2.dta 49 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 182 92970 6 6 6 6 329 2930 1 1 0 346.69 691.3655 2 691.3653 0.0001 0 27.65 0.031 K IAADFR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3813.3813.2.dta 49 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 182 92970 6 6 6 6 532 5288 1 1 0 374.7396 747.4646 2 747.4643 0.0003 0 21.65 0.034 K VLTFLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6339.6339.2.dta 49 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 182 92970 6 6 6 6 4362 6526 1 1 1 661.3607 1320.7069 2 1320.7078 -0.0009 0 46.85 0.00019 K VLGTAFDPFLGGK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7637.7637.2.dta 49 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 182 92970 6 6 6 6 5342 4461 1 1 0 738.3693 1474.724 2 1474.7263 -0.0024 0 96.53 3.70E-09 K DISTTLNADEAVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5457.5457.2.dta 49 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 182 92970 6 6 6 6 5597 5775 1 1 0 768.3889 1534.7632 2 1534.7636 -0.0004 0 68.67 3.10E-06 R GCALQCAILSPAFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6859.6859.2.dta 49 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 182 92970 6 6 6 6 6088 6463 1 1 1 814.9426 1627.8707 2 1627.8716 -0.0009 0 30.49 0.0014 R SVLDAAQIVGLNCLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7567.7567.2.dta 49 2 IPI00295485.1 Heat shock 70 kDa protein 4L 181 95453 5 5 5 5 4256 4376 1 0 1 653.8155 1305.6164 2 1305.6201 -0.0037 0 50.89 3.10E-05 R SFDDPIVQTER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5366.5366.2.dta 49 2 IPI00295485.1 Heat shock 70 kDa protein 4L 181 95453 5 5 5 5 4795 5409 1 0 1 694.8634 1387.7123 2 1387.7129 -0.0007 0 25.14 0.0044 K SIDLPIQSSLCR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6466.6466.2.dta 49 2 IPI00295485.1 Heat shock 70 kDa protein 4L 181 95453 5 5 5 5 5342 4461 1 0 0 738.3693 1474.724 2 1474.7263 -0.0024 0 96.53 3.70E-09 K DISTTLNADEAVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5457.5457.2.dta 49 2 IPI00295485.1 Heat shock 70 kDa protein 4L 181 95453 5 5 5 5 5502 4557 1 0 1 756.351 1510.6875 2 1510.6899 -0.0025 0 20.84 0.029 R SGGIETIANEYSDR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5559.5559.2.dta 49 2 IPI00295485.1 Heat shock 70 kDa protein 4L 181 95453 5 5 5 5 5597 5775 1 0 0 768.3889 1534.7632 2 1534.7636 -0.0004 0 68.67 3.10E-06 R GCALQCAILSPAFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6859.6859.2.dta 49 3 IPI00002966.1 Heat shock 70 kDa protein 4 93 95096 2 2 2 2 5442 4592 1 0 1 748.3527 1494.6908 2 1494.695 -0.0042 0 47.7 0.00013 R AGGIETIANEYSDR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5597.5597.2.dta 49 3 IPI00002966.1 Heat shock 70 kDa protein 4 93 95096 2 2 2 2 5597 5775 1 0 0 768.3889 1534.7632 2 1534.7636 -0.0004 0 68.67 3.10E-06 R GCALQCAILSPAFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6859.6859.2.dta 49 IPI00031022.1 heat shock 70kDa protein 4 isoform b 48 15851 1 1 1 1 5442 4592 1 0 1 748.3527 1494.6908 2 1494.695 -0.0042 0 47.7 0.00013 R AGGIETIANEYSDR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5597.5597.2.dta 50 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 182 136575 9 9 9 9 297 3493 1 1 1 343.2339 684.4532 2 684.4534 -0.0002 0 36.36 0.0018 R VLIGVGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4429.4429.2.dta 50 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 182 136575 9 9 9 9 1348 4815 1 1 1 445.7765 889.5384 2 889.5385 -0.0001 0 34.93 0.00069 K LVYILNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5835.5835.2.dta 50 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 182 136575 9 9 9 9 1787 2444 1 1 1 479.7692 957.5238 2 957.5243 -0.0005 0 37.76 0.0042 K QQEIVVSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3273.3273.2.dta 50 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 182 136575 9 9 9 9 2504 3285 1 1 1 531.2537 1060.4929 2 1060.4938 -0.0009 0 48.89 0.00016 K NFGDQPDIR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4207.4207.2.dta 50 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 182 136575 9 9 9 9 4069 5516 1 1 1 642.3703 1282.726 2 1282.7285 -0.0025 0 40.95 0.00075 R IVPGQFLAVDPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6581.6581.2.dta 50 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 182 136575 9 9 9 9 6500 5441 1 1 1 841.4489 1680.8833 2 1680.8835 -0.0002 0 58.58 2.20E-05 K TPVEEVPAAIAPFQGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6499.6499.2.dta 50 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 182 136575 9 9 9 9 6639 3232 1 1 1 850.4285 1698.8425 2 1698.8424 0.0001 1 26.2 0.0035 K NVSEELDRTPPEVSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4150.4150.2.dta 50 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 182 136575 9 9 9 9 6771 3501 1 1 1 575.6308 1723.8706 3 1723.8741 -0.0035 1 32.08 0.0013 R LTGGTKDYIVVGSDSGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4437.4437.3.dta 50 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 182 136575 9 9 9 9 7020 6243 1 1 1 904.9442 1807.8739 2 1807.8741 -0.0002 0 24.08 0.0055 R NENQLIIFADDTYPR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7342.7342.2.dta 50 IPI00828110.1 Isoform 3 of Splicing factor 3B subunit 3 90 44863 4 4 4 4 297 3493 1 0 1 343.2339 684.4532 2 684.4534 -0.0002 0 36.36 0.0018 R VLIGVGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4429.4429.2.dta 50 IPI00828110.1 Isoform 3 of Splicing factor 3B subunit 3 90 44863 4 4 4 4 6500 5441 1 0 1 841.4489 1680.8833 2 1680.8835 -0.0002 0 58.58 2.20E-05 K TPVEEVPAAIAPFQGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6499.6499.2.dta 50 IPI00828110.1 Isoform 3 of Splicing factor 3B subunit 3 90 44863 4 4 4 4 6639 3232 1 0 1 850.4285 1698.8425 2 1698.8424 0.0001 1 26.2 0.0035 K NVSEELDRTPPEVSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4150.4150.2.dta 50 IPI00828110.1 Isoform 3 of Splicing factor 3B subunit 3 90 44863 4 4 4 4 7020 6243 1 0 1 904.9442 1807.8739 2 1807.8741 -0.0002 0 24.08 0.0055 R NENQLIIFADDTYPR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7342.7342.2.dta 50 IPI00179138.3 Isoform 2 of Splicing factor 3B subunit 3 85 30419 4 4 4 4 1348 4815 1 0 1 445.7765 889.5384 2 889.5385 -0.0001 0 34.93 0.00069 K LVYILNR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5835.5835.2.dta 50 IPI00179138.3 Isoform 2 of Splicing factor 3B subunit 3 85 30419 4 4 4 4 1787 2444 1 0 1 479.7692 957.5238 2 957.5243 -0.0005 0 37.76 0.0042 K QQEIVVSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3273.3273.2.dta 50 IPI00179138.3 Isoform 2 of Splicing factor 3B subunit 3 85 30419 4 4 4 4 4069 5516 1 0 1 642.3703 1282.726 2 1282.7285 -0.0025 0 40.95 0.00075 R IVPGQFLAVDPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6581.6581.2.dta 50 IPI00179138.3 Isoform 2 of Splicing factor 3B subunit 3 85 30419 4 4 4 4 6771 3501 1 0 1 575.6308 1723.8706 3 1723.8741 -0.0035 1 32.08 0.0013 R LTGGTKDYIVVGSDSGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4437.4437.3.dta 51 1 IPI00644127.1 "Isoleucyl-tRNA synthetase, cytoplasmic" 181 146178 5 5 5 5 479 2385 1 1 0 365.2294 728.4442 2 728.4432 0.001 0 29 0.016 K VLIQEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3209.3209.2.dta 51 1 IPI00644127.1 "Isoleucyl-tRNA synthetase, cytoplasmic" 181 146178 5 5 5 5 3234 5437 1 1 1 587.3515 1172.6885 2 1172.6917 -0.0033 0 63.98 1.90E-06 R LYLINSPVVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6495.6495.2.dta 51 1 IPI00644127.1 "Isoleucyl-tRNA synthetase, cytoplasmic" 181 146178 5 5 5 5 3528 6001 1 1 1 608.8212 1215.6278 2 1215.6281 -0.0004 0 56.65 5.10E-05 R VENMVDQLLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7094.7094.2.dta 51 1 IPI00644127.1 "Isoleucyl-tRNA synthetase, cytoplasmic" 181 146178 5 5 5 5 4887 2315 1 1 1 701.2982 1400.5818 2 1400.5813 0.0005 0 38.5 0.00059 K MGITEYNNQCR A Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3134.3134.2.dta 51 1 IPI00644127.1 "Isoleucyl-tRNA synthetase, cytoplasmic" 181 146178 5 5 5 5 5260 4352 1 1 1 733.3607 1464.7068 2 1464.7096 -0.0028 0 79.35 7.30E-08 K QLSSEELEQFQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5341.5341.2.dta 51 IPI00013234.2 IARS protein 162 121576 4 4 4 4 479 2385 1 0 0 365.2294 728.4442 2 728.4432 0.001 0 29 0.016 K VLIQEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3209.3209.2.dta 51 IPI00013234.2 IARS protein 162 121576 4 4 4 4 3234 5437 1 0 1 587.3515 1172.6885 2 1172.6917 -0.0033 0 63.98 1.90E-06 R LYLINSPVVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6495.6495.2.dta 51 IPI00013234.2 IARS protein 162 121576 4 4 4 4 3528 6001 1 0 1 608.8212 1215.6278 2 1215.6281 -0.0004 0 56.65 5.10E-05 R VENMVDQLLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7094.7094.2.dta 51 IPI00013234.2 IARS protein 162 121576 4 4 4 4 5260 4352 1 0 1 733.3607 1464.7068 2 1464.7096 -0.0028 0 79.35 7.30E-08 K QLSSEELEQFQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5341.5341.2.dta 51 IPI00641574.1 Isoleucine-tRNA synthetase 38 38718 1 1 1 1 4887 2315 1 0 1 701.2982 1400.5818 2 1400.5813 0.0005 0 38.5 0.00059 K MGITEYNNQCR A Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3134.3134.2.dta 52 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 174 71082 5 5 5 5 2002 1826 1 1 1 495.2661 988.5176 2 988.5189 -0.0013 1 34.67 0.0086 R LSKEDIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2613.2613.2.dta 52 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 174 71082 5 5 5 5 3394 5606 1 1 1 600.3399 1198.6653 2 1198.667 -0.0017 0 109.43 1.80E-10 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6677.6677.2.dta 52 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 174 71082 5 5 5 5 5400 4530 1 1 0 744.3535 1486.6924 2 1486.694 -0.0016 0 57.19 4.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5531.5531.2.dta 52 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 174 71082 5 5 5 5 6546 2919 1 1 1 564.5795 1690.7166 3 1690.7183 -0.0018 0 34.28 0.0014 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3800.3800.3.dta 52 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 174 71082 5 5 5 5 6963 5117 1 1 1 596.6675 1786.9808 3 1786.9828 -0.0021 1 19.97 0.031 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6157.6157.3.dta 52 2 IPI00304925.4 Heat shock 70 kDa protein 1 80 70280 2 2 2 2 5400 4530 1 0 0 744.3535 1486.6924 2 1486.694 -0.0016 0 57.19 4.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5531.5531.2.dta 52 2 IPI00304925.4 Heat shock 70 kDa protein 1 80 70280 2 2 2 2 6530 5754 1 0 1 844.4539 1686.8933 2 1686.894 -0.0008 0 37.84 0.00028 R IINEPTAAAIAYGLDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6834.6834.2.dta 52 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 165 53598 4 4 4 4 3394 5606 1 0 1 600.3399 1198.6653 2 1198.667 -0.0017 0 109.43 1.80E-10 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6677.6677.2.dta 52 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 165 53598 4 4 4 4 5400 4530 1 0 0 744.3535 1486.6924 2 1486.694 -0.0016 0 57.19 4.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5531.5531.2.dta 52 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 165 53598 4 4 4 4 6546 2919 1 0 1 564.5795 1690.7166 3 1690.7183 -0.0018 0 34.28 0.0014 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3800.3800.3.dta 52 IPI00037070.2 Isoform 2 of Heat shock cognate 71 kDa protein 165 53598 4 4 4 4 6963 5117 1 0 1 596.6675 1786.9808 3 1786.9828 -0.0021 1 19.97 0.031 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6157.6157.3.dta 52 IPI00792459.1 23 kDa protein 149 23238 3 3 3 3 3394 5606 1 0 1 600.3399 1198.6653 2 1198.667 -0.0017 0 109.43 1.80E-10 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6677.6677.2.dta 52 IPI00792459.1 23 kDa protein 149 23238 3 3 3 3 5400 4530 1 0 0 744.3535 1486.6924 2 1486.694 -0.0016 0 57.19 4.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5531.5531.2.dta 52 IPI00792459.1 23 kDa protein 149 23238 3 3 3 3 6963 5117 1 0 1 596.6675 1786.9808 3 1786.9828 -0.0021 1 19.97 0.031 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6157.6157.3.dta 52 IPI00797523.1 20 kDa protein 147 20413 2 2 2 2 3394 5606 1 0 1 600.3399 1198.6653 2 1198.667 -0.0017 0 109.43 1.80E-10 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6677.6677.2.dta 52 IPI00797523.1 20 kDa protein 147 20413 2 2 2 2 5400 4530 1 0 0 744.3535 1486.6924 2 1486.694 -0.0016 0 57.19 4.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5531.5531.2.dta 52 IPI00793644.1 17 kDa protein 109 16567 2 2 2 2 3394 5606 1 0 1 600.3399 1198.6653 2 1198.667 -0.0017 0 109.43 1.80E-10 K DAGTIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6677.6677.2.dta 52 IPI00793644.1 17 kDa protein 109 16567 2 2 2 2 6963 5117 1 0 1 596.6675 1786.9808 3 1786.9828 -0.0021 1 19.97 0.031 R IINEPTAAAIAYGLDKK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6157.6157.3.dta 52 IPI00007702.1 Heat shock-related 70 kDa protein 2 77 70263 3 3 3 3 5400 4530 1 0 0 744.3535 1486.6924 2 1486.694 -0.0016 0 57.19 4.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5531.5531.2.dta 52 IPI00007702.1 Heat shock-related 70 kDa protein 2 77 70263 3 3 3 3 6546 2919 1 0 1 564.5795 1690.7166 3 1690.7183 -0.0018 0 34.28 0.0014 K STAGDTHLGGEDFDNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3800.3800.3.dta 52 IPI00007702.1 Heat shock-related 70 kDa protein 2 77 70263 3 3 3 3 6963 5117 1 0 1 596.6675 1786.9808 3 1786.9828 -0.0021 1 19.97 0.031 R IINEPTAAAIAYGLDKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6157.6157.3.dta 52 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 57 27004 1 1 1 1 5400 4530 1 0 0 744.3535 1486.6924 2 1486.694 -0.0016 0 57.19 4.30E-06 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5531.5531.2.dta 53 1 IPI00026970.4 FACT complex subunit SPT16 168 120409 7 7 7 7 650 3071 1 1 1 387.2291 772.4436 2 772.4443 -0.0007 0 34.55 0.0011 R AALLTER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3972.3972.2.dta 53 1 IPI00026970.4 FACT complex subunit SPT16 168 120409 7 7 7 7 1566 6368 1 1 1 464.7511 927.4876 2 927.4886 -0.001 1 30.52 0.0026 R KASVHSSGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.747.747.2.dta 53 1 IPI00026970.4 FACT complex subunit SPT16 168 120409 7 7 7 7 4571 5175 1 1 1 677.8319 1353.6493 2 1353.6499 -0.0007 0 43.27 8.80E-05 R INFYCPGSALGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6219.6219.2.dta 53 1 IPI00026970.4 FACT complex subunit SPT16 168 120409 7 7 7 7 5013 4725 1 1 1 713.3531 1424.6916 2 1424.6936 -0.002 0 71.3 5.60E-07 K YTEGVQSLNWTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5739.5739.2.dta 53 1 IPI00026970.4 FACT complex subunit SPT16 168 120409 7 7 7 7 5047 1278 1 1 1 715.3853 1428.7561 2 1428.7572 -0.0012 1 31.39 0.0011 R LTEQKGEQQIQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2021.2021.2.dta 53 1 IPI00026970.4 FACT complex subunit SPT16 168 120409 7 7 7 7 6444 5747 1 1 1 838.9169 1675.8193 2 1675.8206 -0.0013 0 25.95 0.048 R NEGNIFPNPEATFVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6827.6827.2.dta 53 1 IPI00026970.4 FACT complex subunit SPT16 168 120409 7 7 7 7 7058 5992 1 1 1 913.4796 1824.9447 2 1824.9482 -0.0036 0 36.96 0.00034 K APGEQTVPALNLQNAFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7085.7085.2.dta 54 1 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 165 124610 4 4 4 4 1568 5049 1 1 1 464.7764 927.5382 2 927.5389 -0.0007 0 36.07 0.0016 K GAIENLLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6084.6084.2.dta 54 1 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 165 124610 4 4 4 4 3488 4865 1 1 1 605.848 1209.6815 2 1209.683 -0.0015 0 67.66 8.70E-07 K TPGQINLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5888.5888.2.dta 54 1 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 165 124610 4 4 4 4 5393 4070 1 1 1 743.4041 1484.7937 2 1484.7947 -0.001 0 84.57 5.80E-08 K LLQQQNDITGLSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5040.5040.2.dta 54 1 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 165 124610 4 4 4 4 5658 5691 1 1 1 772.8722 1543.7298 2 1543.7307 -0.0008 0 37.19 0.00033 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6767.6767.2.dta 54 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 107 118696 4 4 4 4 1605 1096 1 0 1 467.7326 933.4507 2 933.4516 -0.0009 0 53.67 0.00011 R SPSASSVGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1829.1829.2.dta 54 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 107 118696 4 4 4 4 2621 1936 1 0 1 539.2738 1076.5331 2 1076.5363 -0.0032 0 51.19 0.00015 K FTGNQIQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2730.2730.2.dta 54 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 107 118696 4 4 4 4 2688 2206 1 0 1 543.3005 1084.5865 2 1084.5876 -0.0011 0 32.31 0.0075 R IIEVNQNQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3018.3018.2.dta 54 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 107 118696 4 4 4 4 5658 5691 1 0 1 772.8722 1543.7298 2 1543.7307 -0.0008 0 37.19 0.00033 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6767.6767.2.dta 54 3 IPI00021885.1 Isoform 1 of Fibrinogen alpha chain precursor 47 95656 2 2 2 2 677 2479 1 0 1 391.1972 780.3799 2 780.3766 0.0033 0 32.05 0.0057 R GADYSLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3310.3310.2.dta 54 3 IPI00021885.1 Isoform 1 of Fibrinogen alpha chain precursor 47 95656 2 2 2 2 1568 5049 1 0 1 464.7764 927.5382 2 927.5389 -0.0007 0 36.07 0.0016 K QLEQVIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6084.6084.2.dta 54 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 78 63509 3 3 3 3 2621 1936 1 0 1 539.2738 1076.5331 2 1076.5363 -0.0032 0 51.19 0.00015 K FTGNQIQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2730.2730.2.dta 54 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 78 63509 3 3 3 3 2688 2206 1 0 1 543.3005 1084.5865 2 1084.5876 -0.0011 0 32.31 0.0075 R IIEVNQNQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3018.3018.2.dta 54 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 78 63509 3 3 3 3 5658 5691 1 0 1 772.8722 1543.7298 2 1543.7307 -0.0008 0 37.19 0.00033 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6767.6767.2.dta 54 IPI00029717.1 Isoform 2 of Fibrinogen alpha chain precursor 36 70227 1 1 1 1 1568 5049 1 0 1 464.7764 927.5382 2 927.5389 -0.0007 0 36.07 0.0016 K QLEQVIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6084.6084.2.dta 55 1 IPI00409671.2 DEAD box polypeptide 42 protein 165 103197 2 2 1 1 4458 5803 1 1 1 670.3821 1338.7497 2 1338.7507 -0.001 0 102.61 6.60E-10 K DIPVLVATDVAAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6891.6891.2.dta 55 1 IPI00409671.2 DEAD box polypeptide 42 protein 165 103197 2 2 1 1 4459 5793 1 1 1 670.3851 1338.7557 2 1338.7507 0.005 0 84.5 3.40E-08 K DIPVLVATDVAAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6880.6880.2.dta 56 1 IPI00743335.1 MYO1C variant protein 157 122461 7 7 7 7 1737 5970 1 1 1 476.2684 950.5223 2 950.5226 -0.0003 0 20.14 0.021 R TFTWLVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7063.7063.2.dta 56 1 IPI00743335.1 MYO1C variant protein 157 122461 7 7 7 7 1977 2818 1 1 1 494.2584 986.5023 2 986.5033 -0.001 0 70.04 2.40E-06 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3690.3690.2.dta 56 1 IPI00743335.1 MYO1C variant protein 157 122461 7 7 7 7 2598 4294 1 1 1 537.8111 1073.6076 2 1073.6081 -0.0004 0 42.53 0.00082 R LLSVEGSTLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5279.5279.2.dta 56 1 IPI00743335.1 MYO1C variant protein 157 122461 7 7 7 7 3583 5348 1 1 1 612.834 1223.6535 2 1223.655 -0.0015 0 51.7 1.40E-05 R NPQSYLYLVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6401.6401.2.dta 56 1 IPI00743335.1 MYO1C variant protein 157 122461 7 7 7 7 6613 5245 1 1 1 847.9124 1693.8103 2 1693.8134 -0.0031 0 26.17 0.0042 R LLQFYAETCPAPER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6293.6293.2.dta 56 1 IPI00743335.1 MYO1C variant protein 157 122461 7 7 7 7 6673 6241 1 1 1 853.9453 1705.8761 2 1705.8774 -0.0014 0 23.97 0.0056 R DGTIDFTPGSELLITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7339.7339.2.dta 56 1 IPI00743335.1 MYO1C variant protein 157 122461 7 7 7 7 7208 6478 1 1 1 937.4845 1872.9544 2 1872.9581 -0.0036 0 35.21 0.0023 K GEELLSPLNLEQAAYAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7583.7583.2.dta 56 IPI00010418.4 Myosin-Ic 146 118763 6 6 6 6 1737 5970 1 0 1 476.2684 950.5223 2 950.5226 -0.0003 0 20.14 0.021 R TFTWLVGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7063.7063.2.dta 56 IPI00010418.4 Myosin-Ic 146 118763 6 6 6 6 1977 2818 1 0 1 494.2584 986.5023 2 986.5033 -0.001 0 70.04 2.40E-06 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3690.3690.2.dta 56 IPI00010418.4 Myosin-Ic 146 118763 6 6 6 6 2598 4294 1 0 1 537.8111 1073.6076 2 1073.6081 -0.0004 0 42.53 0.00082 R LLSVEGSTLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5279.5279.2.dta 56 IPI00010418.4 Myosin-Ic 146 118763 6 6 6 6 3583 5348 1 0 1 612.834 1223.6535 2 1223.655 -0.0015 0 51.7 1.40E-05 R NPQSYLYLVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6401.6401.2.dta 56 IPI00010418.4 Myosin-Ic 146 118763 6 6 6 6 6673 6241 1 0 1 853.9453 1705.8761 2 1705.8774 -0.0014 0 23.97 0.0056 R DGTIDFTPGSELLITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7339.7339.2.dta 56 IPI00010418.4 Myosin-Ic 146 118763 6 6 6 6 7208 6478 1 0 1 937.4845 1872.9544 2 1872.9581 -0.0036 0 35.21 0.0023 K GEELLSPLNLEQAAYAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7583.7583.2.dta 56 IPI00791026.1 56 kDa protein 74 56638 2 2 2 2 1977 2818 1 0 1 494.2584 986.5023 2 986.5033 -0.001 0 70.04 2.40E-06 R LGTDEISPR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3690.3690.2.dta 56 IPI00791026.1 56 kDa protein 74 56638 2 2 2 2 6673 6241 1 0 1 853.9453 1705.8761 2 1705.8774 -0.0014 0 23.97 0.0056 R DGTIDFTPGSELLITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7339.7339.2.dta 57 1 IPI00456887.2 Heterogeneous nuclear ribonucleoprotein U-like protein 2 156 85622 4 4 4 4 3279 3408 1 1 1 592.2614 1182.5082 2 1182.5094 -0.0012 0 27.77 0.0028 R NYYGYQGYR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4338.4338.2.dta 57 1 IPI00456887.2 Heterogeneous nuclear ribonucleoprotein U-like protein 2 156 85622 4 4 4 4 5411 4935 1 1 1 745.3864 1488.7582 2 1488.7606 -0.0025 0 73.53 3.80E-07 R DLLVQQASQCLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5963.5963.2.dta 57 1 IPI00456887.2 Heterogeneous nuclear ribonucleoprotein U-like protein 2 156 85622 4 4 4 4 6786 4166 1 1 1 578.3051 1731.8933 3 1731.8938 -0.0004 1 36.67 0.00053 K SRDLLVQQASQCLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5142.5142.3.dta 57 1 IPI00456887.2 Heterogeneous nuclear ribonucleoprotein U-like protein 2 156 85622 4 4 4 4 7060 5073 1 1 1 914.425 1826.8354 2 1826.837 -0.0016 0 70.13 2.70E-07 R NFILDQCNVYNSGQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6110.6110.2.dta 58 1 IPI00787362.1 similar to Hornerin 154 188565 7 7 7 7 746 1111 1 1 1 397.6934 793.3722 2 793.3719 0.0004 0 31.16 0.0093 R QSPSYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1845.1845.2.dta 58 1 IPI00787362.1 similar to Hornerin 154 188565 7 7 7 7 2905 926 1 1 1 563.2669 1124.5193 2 1124.521 -0.0018 1 31.09 0.01 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1648.1648.2.dta 58 1 IPI00787362.1 similar to Hornerin 154 188565 7 7 7 7 2927 815 1 1 1 565.2465 1128.4785 2 1128.4796 -0.0011 0 36.23 0.001 R GSGSSQSSGYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1531.1531.2.dta 58 1 IPI00787362.1 similar to Hornerin 154 188565 7 7 7 7 3015 1163 1 1 1 570.2573 1138.5 2 1138.5003 -0.0003 0 52.1 3.80E-05 R GSGSGQSPSYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1900.1900.2.dta 58 1 IPI00787362.1 similar to Hornerin 154 188565 7 7 7 7 3744 419 1 1 1 620.7864 1239.5583 2 1239.5592 -0.0009 0 36.46 0.00038 R HGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1109.1109.2.dta 58 1 IPI00787362.1 similar to Hornerin 154 188565 7 7 7 7 7421 771 1 1 1 649.9719 1946.8938 3 1946.8943 -0.0006 0 63.43 2.80E-06 R QSLGHGQHGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1484.1484.3.dta 58 1 IPI00787362.1 similar to Hornerin 154 188565 7 7 7 7 7637 537 1 1 1 718.3005 2151.8798 3 2151.8802 -0.0004 0 18.33 0.015 R SEQHGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1235.1235.3.dta 58 IPI00783478.1 129 kDa protein 31 129438 1 1 1 1 2905 926 1 0 1 563.2669 1124.5193 2 1124.521 -0.0018 1 31.09 0.01 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1648.1648.2.dta 59 1 IPI00251559.8 E3 ubiquitin-protein ligase BRE1A 145 114534 4 4 4 4 1870 2947 1 1 1 483.7716 965.5287 2 965.5294 -0.0007 0 32.8 0.0049 R HLAEVLER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3831.3831.2.dta 59 1 IPI00251559.8 E3 ubiquitin-protein ligase BRE1A 145 114534 4 4 4 4 4417 5882 1 1 1 665.3668 1328.7191 2 1328.7187 0.0004 0 55.11 5.80E-05 R LQELTDLLQEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6972.6972.2.dta 59 1 IPI00251559.8 E3 ubiquitin-protein ligase BRE1A 145 114534 4 4 4 4 4535 4208 1 1 1 675.3505 1348.6864 2 1348.6874 -0.001 0 41.93 0.0011 R AVEEQIEYLQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5187.5187.2.dta 59 1 IPI00251559.8 E3 ubiquitin-protein ligase BRE1A 145 114534 4 4 4 4 4982 3007 1 1 1 710.8625 1419.7105 2 1419.7093 0.0012 0 88.8 2.70E-08 K AAVEDSGTTVETIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3902.3902.2.dta 60 1 IPI00022434.2 ALB protein 145 73881 5 5 5 5 1294 1979 1 1 1 438.2584 874.5023 2 874.5025 -0.0002 1 41.12 0.00093 R LSQRFPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2776.2776.2.dta 60 1 IPI00022434.2 ALB protein 145 73881 5 5 5 5 1559 4369 1 1 1 464.2503 926.4861 2 926.4861 0 0 29.98 0.0019 K YLYEIAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5359.5359.2.dta 60 1 IPI00022434.2 ALB protein 145 73881 5 5 5 5 2086 4950 1 1 1 500.8057 999.5969 2 999.5964 0.0005 0 57.96 1.70E-05 K QTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5979.5979.2.dta 60 1 IPI00022434.2 ALB protein 145 73881 5 5 5 5 2926 4100 1 1 1 376.9043 1127.6912 3 1127.6914 -0.0002 1 50.2 6.20E-05 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5072.5072.3.dta 60 1 IPI00022434.2 ALB protein 145 73881 5 5 5 5 6209 4248 1 1 1 547.3174 1638.9305 3 1638.9305 0 1 46.25 0.00011 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5230.5230.3.dta 60 IPI00384697.2 Isoform 2 of Serum albumin precursor 131 48641 4 4 4 4 1294 1979 1 0 1 438.2584 874.5023 2 874.5025 -0.0002 1 41.12 0.00093 R LSQRFPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2776.2776.2.dta 60 IPI00384697.2 Isoform 2 of Serum albumin precursor 131 48641 4 4 4 4 2086 4950 1 0 1 500.8057 999.5969 2 999.5964 0.0005 0 57.96 1.70E-05 K QTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5979.5979.2.dta 60 IPI00384697.2 Isoform 2 of Serum albumin precursor 131 48641 4 4 4 4 2926 4100 1 0 1 376.9043 1127.6912 3 1127.6914 -0.0002 1 50.2 6.20E-05 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5072.5072.3.dta 60 IPI00384697.2 Isoform 2 of Serum albumin precursor 131 48641 4 4 4 4 6209 4248 1 0 1 547.3174 1638.9305 3 1638.9305 0 1 46.25 0.00011 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5230.5230.3.dta 60 IPI00216773.4 ALB protein 112 46442 3 3 3 3 2086 4950 1 0 1 500.8057 999.5969 2 999.5964 0.0005 0 57.96 1.70E-05 K QTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5979.5979.2.dta 60 IPI00216773.4 ALB protein 112 46442 3 3 3 3 2926 4100 1 0 1 376.9043 1127.6912 3 1127.6914 -0.0002 1 50.2 6.20E-05 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5072.5072.3.dta 60 IPI00216773.4 ALB protein 112 46442 3 3 3 3 6209 4248 1 0 1 547.3174 1638.9305 3 1638.9305 0 1 46.25 0.00011 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5230.5230.3.dta 61 1 IPI00182757.9 Isoform 2 of Protein KIAA1967 142 103593 5 5 5 5 3489 5320 1 1 1 605.8613 1209.708 2 1209.7081 -0.0001 0 51.35 4.10E-05 R LTPLQLEIQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6371.6371.2.dta 61 1 IPI00182757.9 Isoform 2 of Protein KIAA1967 142 103593 5 5 5 5 3745 4160 1 1 1 620.8661 1239.7177 2 1239.7187 -0.0009 0 50 8.20E-05 K VQTLSNQPLLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5136.5136.2.dta 61 1 IPI00182757.9 Isoform 2 of Protein KIAA1967 142 103593 5 5 5 5 4051 3088 1 1 1 640.824 1279.6334 2 1279.6343 -0.0009 0 54.04 4.40E-05 R VVTQNICQYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3992.3992.2.dta 61 1 IPI00182757.9 Isoform 2 of Protein KIAA1967 142 103593 5 5 5 5 5673 5514 1 1 1 775.3925 1548.7705 2 1548.7725 -0.002 0 23.87 0.0066 R FAEFQYLQPGPPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6578.6578.2.dta 61 1 IPI00182757.9 Isoform 2 of Protein KIAA1967 142 103593 5 5 5 5 5876 6756 1 1 1 794.9508 1587.8871 2 1587.8872 -0.0001 0 38.98 0.00022 K VLLLSSPGLEELYR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7883.7883.2.dta 61 IPI00382429.2 30 kDa protein 54 30531 1 1 1 1 4051 3088 1 0 1 640.824 1279.6334 2 1279.6343 -0.0009 0 54.04 4.40E-05 R VVTQNICQYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3992.3992.2.dta 62 1 IPI00180675.4 Tubulin alpha-3 chain 141 50788 5 5 5 5 1465 2138 1 1 1 303.8396 908.4969 3 908.4967 0.0002 1 23.04 0.024 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2946.2946.3.dta 62 1 IPI00180675.4 Tubulin alpha-3 chain 141 50788 5 5 5 5 2190 4279 1 1 1 508.2924 1014.5703 2 1014.5709 -0.0006 0 61.78 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5263.5263.2.dta 62 1 IPI00180675.4 Tubulin alpha-3 chain 141 50788 5 5 5 5 6654 6531 1 1 1 851.4559 1700.8972 2 1700.8985 -0.0013 0 42.91 9.50E-05 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7641.7641.2.dta 62 1 IPI00180675.4 Tubulin alpha-3 chain 141 50788 5 5 5 5 7054 5095 1 1 1 912.995 1823.9754 2 1823.9782 -0.0027 0 53.04 1.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6133.6133.2.dta 62 1 IPI00180675.4 Tubulin alpha-3 chain 141 50788 5 5 5 5 7513 6116 1 1 1 1004.449 2006.8834 2 2006.8858 -0.0024 0 31.98 0.001 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7211.7211.2.dta 62 IPI00166768.2 TUBA6 protein 136 37681 4 4 4 4 2190 4279 1 0 1 508.2924 1014.5703 2 1014.5709 -0.0006 0 61.78 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5263.5263.2.dta 62 IPI00166768.2 TUBA6 protein 136 37681 4 4 4 4 6654 6531 1 0 1 851.4559 1700.8972 2 1700.8985 -0.0013 0 42.91 9.50E-05 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7641.7641.2.dta 62 IPI00166768.2 TUBA6 protein 136 37681 4 4 4 4 7054 5095 1 0 1 912.995 1823.9754 2 1823.9782 -0.0027 0 53.04 1.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6133.6133.2.dta 62 IPI00166768.2 TUBA6 protein 136 37681 4 4 4 4 7513 6116 1 0 1 1004.449 2006.8834 2 2006.8858 -0.0024 0 31.98 0.001 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7211.7211.2.dta 62 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 114 50612 4 4 4 4 1465 2138 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.04 0.024 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2946.2946.3.dta 62 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 114 50612 4 4 4 4 2190 4279 1 0 1 508.2924 1014.5703 2 1014.5709 -0.0006 0 61.78 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5263.5263.2.dta 62 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 114 50612 4 4 4 4 7054 5095 1 0 1 912.995 1823.9754 2 1823.9782 -0.0027 0 53.04 1.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6133.6133.2.dta 62 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 114 50612 4 4 4 4 7513 6116 1 0 1 1004.449 2006.8834 2 2006.8858 -0.0024 0 31.98 0.001 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7211.7211.2.dta 62 IPI00410402.2 Similar to alpha tubulin 109 50568 3 3 3 3 2190 4279 1 0 1 508.2924 1014.5703 2 1014.5709 -0.0006 0 61.78 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5263.5263.2.dta 62 IPI00410402.2 Similar to alpha tubulin 109 50568 3 3 3 3 7054 5095 1 0 1 912.995 1823.9754 2 1823.9782 -0.0027 0 53.04 1.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6133.6133.2.dta 62 IPI00410402.2 Similar to alpha tubulin 109 50568 3 3 3 3 7513 6116 1 0 1 1004.449 2006.8834 2 2006.8858 -0.0024 0 31.98 0.001 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7211.7211.2.dta 62 IPI00784332.1 Similar to Tubulin alpha-2 chain 94 17148 2 2 2 2 2190 4279 1 0 1 508.2924 1014.5703 2 1014.5709 -0.0006 0 61.78 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5263.5263.2.dta 62 IPI00784332.1 Similar to Tubulin alpha-2 chain 94 17148 2 2 2 2 7054 5095 1 0 1 912.995 1823.9754 2 1823.9782 -0.0027 0 53.04 1.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6133.6133.2.dta 62 IPI00478908.3 29 kDa protein 66 28716 3 3 3 3 1465 2138 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.04 0.024 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2946.2946.3.dta 62 IPI00478908.3 29 kDa protein 66 28716 3 3 3 3 6654 6531 1 0 1 851.4559 1700.8972 2 1700.8985 -0.0013 0 42.91 9.50E-05 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7641.7641.2.dta 62 IPI00478908.3 29 kDa protein 66 28716 3 3 3 3 7513 6116 1 0 1 1004.449 2006.8834 2 2006.8858 -0.0024 0 31.98 0.001 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7211.7211.2.dta 62 IPI00414274.3 similar to Tubulin alpha-3 chain 62 23560 2 2 2 2 1465 2138 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.04 0.024 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2946.2946.3.dta 62 IPI00414274.3 similar to Tubulin alpha-3 chain 62 23560 2 2 2 2 2190 4279 1 0 1 508.2924 1014.5703 2 1014.5709 -0.0006 0 61.78 1.40E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5263.5263.2.dta 62 IPI00007750.1 Tubulin alpha-1 chain 59 50634 2 2 2 2 1465 2138 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.04 0.024 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2946.2946.3.dta 62 IPI00007750.1 Tubulin alpha-1 chain 59 50634 2 2 2 2 7054 5095 1 0 1 912.995 1823.9754 2 1823.9782 -0.0027 0 53.04 1.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6133.6133.2.dta 62 IPI00646909.2 Tubulin alpha-8 chain 53 50746 1 1 1 1 7054 5095 1 0 1 912.995 1823.9754 2 1823.9782 -0.0027 0 53.04 1.10E-05 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6133.6133.2.dta 62 IPI00062209.5 Alpha tubulin-like 23 16843 1 1 1 1 1465 2138 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.04 0.024 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2946.2946.3.dta 63 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 141 92833 6 6 6 6 1579 5145 1 1 1 465.7557 929.4969 2 929.4971 -0.0001 0 36.34 0.0057 R GIALWGGEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6187.6187.2.dta 63 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 141 92833 6 6 6 6 1615 1566 1 1 1 468.2505 934.4865 2 934.4872 -0.0007 1 34.95 0.0087 K IFEQKDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2328.2328.2.dta 63 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 141 92833 6 6 6 6 5275 6104 1 1 1 734.3829 1466.7513 2 1466.7518 -0.0005 0 59.5 2.60E-06 K GTQGVVTNFEIFR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7198.7198.2.dta 63 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 141 92833 6 6 6 6 7014 1480 1 1 1 602.603 1804.7871 3 1804.7936 -0.0065 1 25.19 0.017 R SDSRAQAVSEDAGGNEGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2236.2236.3.dta 63 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 141 92833 6 6 6 6 7366 5282 1 1 1 640.6398 1918.8977 3 1918.8996 -0.0019 0 38.14 0.00027 R FSHQGVQLIDFSPCER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6333.6333.3.dta 63 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 141 92833 6 6 6 6 7595 1871 1 1 1 695.6571 2083.9495 3 2083.9518 -0.0024 1 45.79 5.10E-05 R AQAVSEDAGGNEGRAAEAEPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2661.2661.3.dta 63 IPI00749239.1 "CDNA FLJ44714 fis, clone BRACE3020669, highly similar to Eukaryotic translation initiation factor 3 subunit 9" 35 17827 1 1 1 1 1615 1566 1 0 1 468.2505 934.4865 2 934.4872 -0.0007 1 34.95 0.0087 K IFEQKDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2328.2328.2.dta 64 1 IPI00025057.1 Isoform 2 of Double-stranded RNA-specific adenosine deaminase 139 134317 4 4 4 4 1953 2634 1 1 1 491.724 981.4335 2 981.4338 -0.0003 0 63.03 4.60E-06 K LGNSCEFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3476.3476.2.dta 64 1 IPI00025057.1 Isoform 2 of Double-stranded RNA-specific adenosine deaminase 139 134317 4 4 4 4 3859 2267 1 1 1 629.3441 1256.6737 2 1256.6724 0.0013 1 49.36 9.60E-05 R VLIGENEKAER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3083.3083.2.dta 64 1 IPI00025057.1 Isoform 2 of Double-stranded RNA-specific adenosine deaminase 139 134317 4 4 4 4 4108 6440 1 1 1 644.8314 1287.6482 2 1287.6493 -0.0011 0 54.54 6.80E-05 R DINAVLIDMER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7543.7543.2.dta 64 1 IPI00025057.1 Isoform 2 of Double-stranded RNA-specific adenosine deaminase 139 134317 4 4 4 4 6492 6458 1 1 1 840.4399 1678.8652 2 1678.8678 -0.0026 0 35.55 0.00046 R YLNTNPVGGLLEYAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7561.7561.2.dta 65 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 138 165975 5 5 5 5 3084 3398 1 1 1 574.7894 1147.5643 2 1147.5656 -0.0012 0 64.49 2.80E-06 K CLGLTEAQTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4327.4327.2.dta 65 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 138 165975 5 5 5 5 3157 6614 1 1 1 582.3731 1162.7317 2 1162.7325 -0.0008 0 17.12 0.019 K IALGIPLPEIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7728.7728.2.dta 65 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 138 165975 5 5 5 5 3575 6026 1 1 1 611.8445 1221.6744 2 1221.6757 -0.0013 0 22.84 0.0072 K ATGYPLAFIAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7118.7118.2.dta 65 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 138 165975 5 5 5 5 4390 3688 1 1 1 663.3627 1324.7109 2 1324.7099 0.001 0 66.51 2.60E-06 R GQNQPVLNITNK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4635.4635.2.dta 65 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 138 165975 5 5 5 5 4978 5714 1 1 1 710.3767 1418.7389 2 1418.7405 -0.0016 0 39.28 0.00041 K AVNTLNEALEFAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6792.6792.2.dta 65 IPI00397498.1 "Isoform 2 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 93 117048 4 4 4 4 3084 3398 1 0 1 574.7894 1147.5643 2 1147.5656 -0.0012 0 64.49 2.80E-06 K CLGLTEAQTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4327.4327.2.dta 65 IPI00397498.1 "Isoform 2 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 93 117048 4 4 4 4 3157 6614 1 0 1 582.3731 1162.7317 2 1162.7325 -0.0008 0 17.12 0.019 K IALGIPLPEIK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7728.7728.2.dta 65 IPI00397498.1 "Isoform 2 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 93 117048 4 4 4 4 3575 6026 1 0 1 611.8445 1221.6744 2 1221.6757 -0.0013 0 22.84 0.0072 K ATGYPLAFIAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7118.7118.2.dta 65 IPI00397498.1 "Isoform 2 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 93 117048 4 4 4 4 4978 5714 1 0 1 710.3767 1418.7389 2 1418.7405 -0.0016 0 39.28 0.00041 K AVNTLNEALEFAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6792.6792.2.dta 66 1 IPI00013508.5 Alpha-actinin-1 133 103563 7 7 7 7 1203 4652 1 1 0 432.7448 863.4751 2 863.4752 -0.0002 0 39.99 0.0017 K ALDFIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5661.5661.2.dta 66 1 IPI00013508.5 Alpha-actinin-1 133 103563 7 7 7 7 3237 6177 1 1 0 587.8052 1173.5958 2 1173.5965 -0.0007 0 34.64 0.0082 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7272.7272.2.dta 66 1 IPI00013508.5 Alpha-actinin-1 133 103563 7 7 7 7 3606 2803 1 1 1 409.8873 1226.6401 3 1226.6407 -0.0007 0 28.28 0.012 R HRPELIDYGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3672.3672.3.dta 66 1 IPI00013508.5 Alpha-actinin-1 133 103563 7 7 7 7 4386 1034 1 1 1 442.5564 1324.6474 3 1324.6483 -0.001 1 51.51 0.00014 R RDQALTEEHAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1763.1763.3.dta 66 1 IPI00013508.5 Alpha-actinin-1 133 103563 7 7 7 7 4784 7484 1 1 0 693.8907 1385.7669 2 1385.7667 0.0003 0 17.22 0.024 R VGWEQLLTTIAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8678.8678.2.dta 66 1 IPI00013508.5 Alpha-actinin-1 133 103563 7 7 7 7 5637 5164 1 1 0 769.3902 1536.7658 2 1536.7671 -0.0013 0 55.83 2.30E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6207.6207.2.dta 66 1 IPI00013508.5 Alpha-actinin-1 133 103563 7 7 7 7 5713 3971 1 1 0 781.3687 1560.7228 2 1560.7242 -0.0015 0 32.49 0.0009 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4936.4936.2.dta 66 2 IPI00013808.1 Alpha-actinin-4 104 105245 6 6 6 6 1203 4652 1 0 0 432.7448 863.4751 2 863.4752 -0.0002 0 39.99 0.0017 K ALDFIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5661.5661.2.dta 66 2 IPI00013808.1 Alpha-actinin-4 104 105245 6 6 6 6 1474 1008 1 0 1 456.2507 910.4868 2 910.4872 -0.0004 0 24.72 0.015 R IAESNHIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1736.1736.2.dta 66 2 IPI00013808.1 Alpha-actinin-4 104 105245 6 6 6 6 3237 6177 1 0 0 587.8052 1173.5958 2 1173.5965 -0.0007 0 34.64 0.0082 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7272.7272.2.dta 66 2 IPI00013808.1 Alpha-actinin-4 104 105245 6 6 6 6 4784 7484 1 0 0 693.8907 1385.7669 2 1385.7667 0.0003 0 17.22 0.024 R VGWEQLLTTIAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8678.8678.2.dta 66 2 IPI00013808.1 Alpha-actinin-4 104 105245 6 6 6 6 5637 5164 1 0 0 769.3902 1536.7658 2 1536.7671 -0.0013 0 55.83 2.30E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6207.6207.2.dta 66 2 IPI00013808.1 Alpha-actinin-4 104 105245 6 6 6 6 5713 3971 1 0 0 781.3687 1560.7228 2 1560.7242 -0.0015 0 32.49 0.0009 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4936.4936.2.dta 66 IPI00032137.1 Alpha-actinin-3 82 103913 3 3 3 3 1203 4652 1 0 0 432.7448 863.4751 2 863.4752 -0.0002 0 39.99 0.0017 K ALDFIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5661.5661.2.dta 66 IPI00032137.1 Alpha-actinin-3 82 103913 3 3 3 3 3237 6177 1 0 0 587.8052 1173.5958 2 1173.5965 -0.0007 0 34.64 0.0082 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7272.7272.2.dta 66 IPI00032137.1 Alpha-actinin-3 82 103913 3 3 3 3 5637 5164 1 0 0 769.3902 1536.7658 2 1536.7671 -0.0013 0 55.83 2.30E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6207.6207.2.dta 66 IPI00019884.1 Alpha-actinin-2 66 104358 2 2 2 2 3237 6177 1 0 0 587.8052 1173.5958 2 1173.5965 -0.0007 0 34.64 0.0082 K EGLLLWCQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7272.7272.2.dta 66 IPI00019884.1 Alpha-actinin-2 66 104358 2 2 2 2 5637 5164 1 0 0 769.3902 1536.7658 2 1536.7671 -0.0013 0 55.83 2.30E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6207.6207.2.dta 66 IPI00793285.1 39 kDa protein 42 39035 3 3 3 3 1474 1008 1 0 1 456.2507 910.4868 2 910.4872 -0.0004 0 24.72 0.015 R IAESNHIK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1736.1736.2.dta 66 IPI00793285.1 39 kDa protein 42 39035 3 3 3 3 4784 7484 1 0 0 693.8907 1385.7669 2 1385.7667 0.0003 0 17.22 0.024 R VGWEQLLTTIAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8678.8678.2.dta 66 IPI00793285.1 39 kDa protein 42 39035 3 3 3 3 5713 3971 1 0 0 781.3687 1560.7228 2 1560.7242 -0.0015 0 32.49 0.0009 R ELPPDQAEYCIAR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4936.4936.2.dta 67 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 132 473749 5 5 5 5 1107 5680 1 1 1 423.2656 844.5166 2 844.5171 -0.0004 0 15.04 0.039 R TFPVLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6755.6755.2.dta 67 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 132 473749 5 5 5 5 1769 5278 1 1 1 478.7923 955.57 2 955.5702 -0.0002 0 52.08 3.20E-05 R LLEEALLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6328.6328.2.dta 67 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 132 473749 5 5 5 5 2428 4685 1 1 1 526.2745 1050.5344 2 1050.5346 -0.0002 0 41.41 0.00034 R SIGEYDVLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5696.5696.2.dta 67 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 132 473749 5 5 5 5 2440 4733 1 1 1 526.7845 1051.5544 2 1051.555 -0.0006 0 30.88 0.0067 R GIFTSEIGTK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5747.5747.2.dta 67 1 IPI00296337.2 Isoform 1 of DNA-dependent protein kinase catalytic subunit 132 473749 5 5 5 5 3248 3955 1 1 1 588.3167 1174.6189 2 1174.6194 -0.0005 0 72.17 9.90E-07 R VTELALTASDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4919.4919.2.dta 68 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 132 129274 8 8 7 7 1855 5090 1 1 1 482.789 963.5635 2 963.5641 -0.0005 0 59.47 5.60E-06 R LLEIVSYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6128.6128.2.dta 68 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 132 129274 8 8 7 7 1999 1725 1 1 1 495.2434 988.4723 2 988.4726 -0.0004 0 21.09 0.027 R HNYEGTLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2506.2506.2.dta 68 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 132 129274 8 8 7 7 2324 2651 1 1 1 517.7631 1033.5116 2 1033.5114 0.0002 1 18.93 0.025 R DLLEECKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3495.3495.2.dta 68 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 132 129274 8 8 7 7 2506 2664 1 1 1 531.2673 1060.52 2 1060.5223 -0.0023 0 45.95 0.0004 K GTCVEGTIPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3511.3511.2.dta 68 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 132 129274 8 8 7 7 2676 3018 1 1 1 542.313 1082.6115 2 1082.6124 -0.0009 1 19.25 0.023 K KLYYQQLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3914.3914.2.dta 68 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 132 129274 8 8 7 7 3155 6574 1 1 1 582.332 1162.6495 2 1162.6499 -0.0004 0 23.72 0.006 R DLLQFFKPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7683.7683.2.dta 68 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 132 129274 8 8 7 7 5267 7454 1 1 1 733.8897 1465.7649 2 1465.7639 0.0009 0 39.66 0.00019 R LNTDPMLLQFFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8638.8638.2.dta 68 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 132 129274 8 8 7 7 5383 6861 1 1 1 741.8856 1481.7567 2 1481.7588 -0.0022 0 21.36 0.0099 R LNTDPMLLQFFK S Oxidation (M) 0.000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7990.7990.2.dta 68 IPI00783739.1 128 kDa protein 91 129318 7 7 6 6 1999 1725 1 0 1 495.2434 988.4723 2 988.4726 -0.0004 0 21.09 0.027 R HNYEGTLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2506.2506.2.dta 68 IPI00783739.1 128 kDa protein 91 129318 7 7 6 6 2324 2651 1 0 1 517.7631 1033.5116 2 1033.5114 0.0002 1 18.93 0.025 R DLLEECKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3495.3495.2.dta 68 IPI00783739.1 128 kDa protein 91 129318 7 7 6 6 2506 2664 1 0 1 531.2673 1060.52 2 1060.5223 -0.0023 0 45.95 0.0004 K GTCVEGTIPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3511.3511.2.dta 68 IPI00783739.1 128 kDa protein 91 129318 7 7 6 6 2676 3018 1 0 1 542.313 1082.6115 2 1082.6124 -0.0009 1 19.25 0.023 K KLYYQQLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3914.3914.2.dta 68 IPI00783739.1 128 kDa protein 91 129318 7 7 6 6 3155 6574 1 0 1 582.332 1162.6495 2 1162.6499 -0.0004 0 23.72 0.006 R DLLQFFKPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7683.7683.2.dta 68 IPI00783739.1 128 kDa protein 91 129318 7 7 6 6 5267 7454 1 0 1 733.8897 1465.7649 2 1465.7639 0.0009 0 39.66 0.00019 R LNTDPMLLQFFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8638.8638.2.dta 68 IPI00783739.1 128 kDa protein 91 129318 7 7 6 6 5383 6861 1 0 1 741.8856 1481.7567 2 1481.7588 -0.0022 0 21.36 0.0099 R LNTDPMLLQFFK S Oxidation (M) 0.000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7990.7990.2.dta 69 1 IPI00018349.5 DNA replication licensing factor MCM4 132 97068 3 3 3 3 1985 2496 1 1 1 494.748 987.4815 2 987.4808 0.0007 0 47.21 0.00032 R IAEPSVCGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3328.3328.2.dta 69 1 IPI00018349.5 DNA replication licensing factor MCM4 132 97068 3 3 3 3 4643 5493 1 1 1 683.3456 1364.6766 2 1364.6824 -0.0058 0 77.32 6.60E-08 R ALADDDFLTVTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6556.6556.2.dta 69 1 IPI00018349.5 DNA replication licensing factor MCM4 132 97068 3 3 3 3 7057 5510 1 1 1 913.4742 1824.9338 2 1824.937 -0.0032 0 46.01 4.80E-05 R TSVLAAANPIESQWNPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6574.6574.2.dta 69 IPI00795318.1 20 kDa protein 77 20079 1 1 1 1 4643 5493 1 0 1 683.3456 1364.6766 2 1364.6824 -0.0058 0 77.32 6.60E-08 R ALADDDFLTVTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6556.6556.2.dta 70 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 131 49484 4 4 4 4 2721 3324 1 1 1 364.8644 1091.5714 3 1091.5724 -0.001 0 22.96 0.023 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4248.4248.3.dta 70 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 131 49484 4 4 4 4 5469 4759 1 1 1 752.8455 1503.6764 2 1503.6776 -0.0013 0 82.19 2.30E-08 R GLPWSCSADEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5775.5775.2.dta 70 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 131 49484 4 4 4 4 6513 2639 1 1 1 562.2606 1683.76 3 1683.7601 -0.0001 0 29.3 0.0028 K HTGPNSPDTANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3481.3481.3.dta 70 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 131 49484 4 4 4 4 7109 6163 1 1 1 921.4483 1840.8821 2 1840.8843 -0.0022 0 48.3 3.00E-05 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7258.7258.2.dta 70 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 67 49517 3 3 3 3 2721 3324 1 0 1 364.8644 1091.5714 3 1091.5724 -0.001 0 22.96 0.023 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4248.4248.3.dta 70 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 67 49517 3 3 3 3 6513 2639 1 0 1 562.2606 1683.76 3 1683.7601 -0.0001 0 29.3 0.0028 K HTGPNSPDTANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3481.3481.3.dta 70 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 67 49517 3 3 3 3 7109 6163 1 0 1 921.4483 1840.8821 2 1840.8843 -0.0022 0 48.3 3.00E-05 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7258.7258.2.dta 70 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 23 45985 1 1 1 1 2721 3324 1 0 1 364.8644 1091.5714 3 1091.5724 -0.001 0 22.96 0.023 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4248.4248.3.dta 71 1 IPI00797279.1 "ubiquitin-like, containing PHD and RING finger domains, 1 isoform 2" 130 92582 4 4 4 4 1202 6065 1 1 1 432.74 863.4654 2 863.4654 0 0 41.38 0.0012 K SGFLVWR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7159.7159.2.dta 71 1 IPI00797279.1 "ubiquitin-like, containing PHD and RING finger domains, 1 isoform 2" 130 92582 4 4 4 4 3360 3003 1 1 1 598.271 1194.5274 2 1194.5274 0 0 51.53 4.40E-05 R AQVFSCPACR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3899.3899.2.dta 71 1 IPI00797279.1 "ubiquitin-like, containing PHD and RING finger domains, 1 isoform 2" 130 92582 4 4 4 4 3874 3663 1 1 1 630.3134 1258.6123 2 1258.6153 -0.0031 0 73.73 7.30E-07 R NDASEVVLAGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4608.4608.2.dta 71 1 IPI00797279.1 "ubiquitin-like, containing PHD and RING finger domains, 1 isoform 2" 130 92582 4 4 4 4 6919 1400 1 1 1 589.2752 1764.8038 3 1764.8061 -0.0023 1 26.1 0.0036 R TAEQSCDQKLTNTNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2151.2151.3.dta 71 IPI00066641.4 81 kDa protein 99 81849 3 3 3 3 1202 6065 1 0 1 432.74 863.4654 2 863.4654 0 0 41.38 0.0012 K SGFLVWR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7159.7159.2.dta 71 IPI00066641.4 81 kDa protein 99 81849 3 3 3 3 3874 3663 1 0 1 630.3134 1258.6123 2 1258.6153 -0.0031 0 73.73 7.30E-07 R NDASEVVLAGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4608.4608.2.dta 71 IPI00066641.4 81 kDa protein 99 81849 3 3 3 3 6919 1400 1 0 1 589.2752 1764.8038 3 1764.8061 -0.0023 1 26.1 0.0036 R TAEQSCDQKLTNTNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2151.2151.3.dta 71 IPI00044681.1 Isoform 1 of E3 ubiquitin-protein ligase UHRF2 52 91696 1 1 1 1 3360 3003 1 0 1 598.271 1194.5274 2 1194.5274 0 0 51.53 4.40E-05 K AQVFSCPACR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3899.3899.2.dta 72 1 IPI00220219.6 Coatomer subunit beta~ 128 103278 5 5 5 5 2421 3211 1 1 1 525.7819 1049.5493 2 1049.5506 -0.0013 0 16.4 0.038 R TYLPSQVSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4128.4128.2.dta 72 1 IPI00220219.6 Coatomer subunit beta~ 128 103278 5 5 5 5 3102 1372 1 1 1 577.3007 1152.5868 2 1152.5887 -0.002 0 43.77 7.90E-05 K HSEVQQANLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2121.2121.2.dta 72 1 IPI00220219.6 Coatomer subunit beta~ 128 103278 5 5 5 5 3112 4356 1 1 1 578.2931 1154.5716 2 1154.572 -0.0004 0 56.81 2.30E-05 R VFNYNTLER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5345.5345.2.dta 72 1 IPI00220219.6 Coatomer subunit beta~ 128 103278 5 5 5 5 3700 5190 1 1 1 618.3079 1234.6013 2 1234.6016 -0.0003 0 35.91 0.0013 K TFEVCDLPVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6235.6235.2.dta 72 1 IPI00220219.6 Coatomer subunit beta~ 128 103278 5 5 5 5 4447 3576 1 1 1 669.3077 1336.6009 2 1336.6007 0.0002 0 50.8 6.40E-05 K DNNQFASASLDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4516.4516.2.dta 73 1 IPI00010951.1 Epiplakin 128 555149 4 4 4 4 1580 799 1 1 1 465.7593 929.5041 2 929.5043 -0.0001 1 41.11 0.0015 R RQEQTLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1514.1514.2.dta 73 1 IPI00010951.1 Epiplakin 128 555149 4 4 4 4 4559 1158 1 1 1 451.5568 1351.6486 3 1351.648 0.0006 0 28.85 0.027 R AEAEAGSPRPDPR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1895.1895.3.dta 73 1 IPI00010951.1 Epiplakin 128 555149 4 4 4 4 6961 3090 1 1 1 894.4113 1786.808 2 1786.8081 -0.0002 0 87.24 2.50E-08 R EGQGEGETQEAAAAAAAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3994.3994.2.dta 73 1 IPI00010951.1 Epiplakin 128 555149 4 4 4 4 7641 2682 1 1 1 720.3409 2158.001 3 2157.9998 0.0011 1 38.91 0.00029 R SQREGQGEGETQEAAAAAAAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3531.3531.3.dta 74 1 IPI00305152.6 SEC31 homolog A isoform 4 127 122544 5 5 5 5 1929 4393 1 1 1 489.2744 976.5342 2 976.5342 0 0 32.87 0.0068 K LVTFENVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5386.5386.2.dta 74 1 IPI00305152.6 SEC31 homolog A isoform 4 127 122544 5 5 5 5 1990 3983 1 1 1 494.7824 987.5503 2 987.5502 0.0001 1 21.77 0.018 R ATVWDLRK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4949.4949.2.dta 74 1 IPI00305152.6 SEC31 homolog A isoform 4 127 122544 5 5 5 5 3469 1687 1 1 1 604.2849 1206.5553 2 1206.5551 0.0002 0 46.5 0.00011 R CLSSATDPQTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2459.2459.2.dta 74 1 IPI00305152.6 SEC31 homolog A isoform 4 127 122544 5 5 5 5 4233 4705 1 1 1 652.8325 1303.6504 2 1303.6521 -0.0017 0 73.51 1.10E-06 R NPAVLSAASFDGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5717.5717.2.dta 74 1 IPI00305152.6 SEC31 homolog A isoform 4 127 122544 5 5 5 5 5693 6123 1 1 1 778.3922 1554.7698 2 1554.7712 -0.0014 0 34.9 0.00053 R ISVYSIMGGSTDGLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7218.7218.2.dta 74 IPI00445429.1 "CDNA FLJ43909 fis, clone TESTI4010831" 123 106512 4 4 4 4 1929 4393 1 0 1 489.2744 976.5342 2 976.5342 0 0 32.87 0.0068 K LVTFENVR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5386.5386.2.dta 74 IPI00445429.1 "CDNA FLJ43909 fis, clone TESTI4010831" 123 106512 4 4 4 4 3469 1687 1 0 1 604.2849 1206.5553 2 1206.5551 0.0002 0 46.5 0.00011 R CLSSATDPQTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2459.2459.2.dta 74 IPI00445429.1 "CDNA FLJ43909 fis, clone TESTI4010831" 123 106512 4 4 4 4 4233 4705 1 0 1 652.8325 1303.6504 2 1303.6521 -0.0017 0 73.51 1.10E-06 R NPAVLSAASFDGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5717.5717.2.dta 74 IPI00445429.1 "CDNA FLJ43909 fis, clone TESTI4010831" 123 106512 4 4 4 4 5693 6123 1 0 1 778.3922 1554.7698 2 1554.7712 -0.0014 0 34.9 0.00053 R ISVYSIMGGSTDGLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7218.7218.2.dta 75 1 IPI00183462.7 Isoform 2 of Exosome complex exonuclease RRP44 121 106241 6 6 6 6 299 1386 1 1 1 343.7141 685.4136 2 685.4123 0.0013 0 27.65 0.034 K LQQGIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2136.2136.2.dta 75 1 IPI00183462.7 Isoform 2 of Exosome complex exonuclease RRP44 121 106241 6 6 6 6 2683 1982 1 1 1 362.2018 1083.5837 3 1083.5825 0.0012 1 25.65 0.012 R RHLFTPADK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2779.2779.3.dta 75 1 IPI00183462.7 Isoform 2 of Exosome complex exonuclease RRP44 121 106241 6 6 6 6 2934 4132 1 1 1 565.3141 1128.6137 2 1128.6139 -0.0001 0 56.69 1.60E-05 K GALTLSSPEVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5106.5106.2.dta 75 1 IPI00183462.7 Isoform 2 of Exosome complex exonuclease RRP44 121 106241 6 6 6 6 3610 4189 1 1 1 614.8291 1227.6437 2 1227.6459 -0.0022 0 54.51 7.70E-06 K SLTANPELIDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5167.5167.2.dta 75 1 IPI00183462.7 Isoform 2 of Exosome complex exonuclease RRP44 121 106241 6 6 6 6 5587 5570 1 1 1 511.6277 1531.8614 3 1531.861 0.0004 0 33.02 0.0008 R AVHEDIVAVELLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6638.6638.3.dta 75 1 IPI00183462.7 Isoform 2 of Exosome complex exonuclease RRP44 121 106241 6 6 6 6 7154 5613 1 1 1 928.442 1854.8694 2 1854.8709 -0.0016 0 16.85 0.039 K AIEEGIPAFTCEEYVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6684.6684.2.dta 75 IPI00827723.1 64 kDa protein 85 64376 5 5 5 5 299 1386 1 0 1 343.7141 685.4136 2 685.4123 0.0013 0 27.65 0.034 K LQQGIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2136.2136.2.dta 75 IPI00827723.1 64 kDa protein 85 64376 5 5 5 5 2683 1982 1 0 1 362.2018 1083.5837 3 1083.5825 0.0012 1 25.65 0.012 R RHLFTPADK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2779.2779.3.dta 75 IPI00827723.1 64 kDa protein 85 64376 5 5 5 5 3610 4189 1 0 1 614.8291 1227.6437 2 1227.6459 -0.0022 0 54.51 7.70E-06 K SLTANPELIDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5167.5167.2.dta 75 IPI00827723.1 64 kDa protein 85 64376 5 5 5 5 5587 5570 1 0 1 511.6277 1531.8614 3 1531.861 0.0004 0 33.02 0.0008 R AVHEDIVAVELLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6638.6638.3.dta 75 IPI00827723.1 64 kDa protein 85 64376 5 5 5 5 7154 5613 1 0 1 928.442 1854.8694 2 1854.8709 -0.0016 0 16.85 0.039 K AIEEGIPAFTCEEYVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6684.6684.2.dta 76 1 IPI00306369.3 NOL1/NOP2/Sun domain family 2 protein 118 87214 4 4 4 4 517 2390 1 1 1 372.7347 743.4548 2 743.4541 0.0007 0 27.89 0.04 K VINTGIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3214.3214.2.dta 76 1 IPI00306369.3 NOL1/NOP2/Sun domain family 2 protein 118 87214 4 4 4 4 1976 2081 1 1 1 494.2462 986.4778 2 986.4781 -0.0004 0 78.55 1.50E-07 R GAEQLAEGGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2885.2885.2.dta 76 1 IPI00306369.3 NOL1/NOP2/Sun domain family 2 protein 118 87214 4 4 4 4 2293 2907 1 1 1 515.7797 1029.5449 2 1029.5454 -0.0005 0 26 0.0085 R NVLLNNSEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3786.3786.2.dta 76 1 IPI00306369.3 NOL1/NOP2/Sun domain family 2 protein 118 87214 4 4 4 4 3750 1468 1 1 1 621.3217 1240.6289 2 1240.6299 -0.001 1 49.61 4.90E-05 R KLSSETYSQAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2223.2223.2.dta 77 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 117 79336 3 3 3 3 4888 4608 1 1 1 701.3455 1400.6765 2 1400.6783 -0.0018 0 38 0.0014 R ASLEDAPVDDLTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5614.5614.2.dta 77 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 117 79336 3 3 3 3 5171 1670 1 1 1 725.3502 1448.6859 2 1448.6856 0.0003 0 87.83 1.10E-08 K ATDLGGTSQAGTSQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2438.2438.2.dta 77 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 117 79336 3 3 3 3 5665 4179 1 1 1 773.9061 1545.7976 2 1545.7998 -0.0023 0 30.98 0.0024 R SSLGSLQTPEAVTTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5156.5156.2.dta 78 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 113 141853 6 6 6 6 493 2117 1 1 1 366.2369 730.4593 2 730.4589 0.0005 1 43.26 0.00068 R TKLELK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2923.2923.2.dta 78 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 113 141853 6 6 6 6 583 1568 1 0 0 379.7425 757.4704 2 757.4698 0.0006 1 33.59 0.0095 R QKLLEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2330.2330.2.dta 78 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 113 141853 6 6 6 6 3192 1192 1 1 1 584.7832 1167.5519 2 1167.552 -0.0001 1 18.6 0.03 R GSQFTSKEER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1931.1931.2.dta 78 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 113 141853 6 6 6 6 4512 1306 1 1 1 674.3198 1346.625 2 1346.6248 0.0001 0 41.63 0.00025 K INQMATAPDSQR L Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2051.2051.2.dta 78 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 113 141853 6 6 6 6 6502 4866 1 1 1 561.6169 1681.8288 3 1681.8311 -0.0023 1 17.04 0.028 K ALDQFVNFSEQKEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5889.5889.3.dta 78 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 113 141853 6 6 6 6 7156 5075 1 1 1 928.9539 1855.8933 2 1855.8952 -0.0019 0 56.93 1.20E-05 R ALEYTIYNQELNETR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6112.6112.2.dta 79 1 IPI00376317.3 autoantigen RCD8 110 152992 6 6 6 6 1276 1009 1 1 1 436.7328 871.451 2 871.4512 -0.0001 0 37.93 0.0025 R ALAEGQQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1737.1737.2.dta 79 1 IPI00376317.3 autoantigen RCD8 110 152992 6 6 6 6 1284 3573 1 1 1 437.2425 872.4705 2 872.4716 -0.0011 0 50.73 0.00015 K NLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4513.4513.2.dta 79 1 IPI00376317.3 autoantigen RCD8 110 152992 6 6 6 6 1926 2475 1 1 1 489.2658 976.5171 2 976.5189 -0.0018 0 31.34 0.0016 R VISVSTSER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3306.3306.2.dta 79 1 IPI00376317.3 autoantigen RCD8 110 152992 6 6 6 6 4862 650 1 1 1 466.2353 1395.684 3 1395.6855 -0.0015 1 21.58 0.014 R ALETRHEQEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1357.1357.3.dta 79 1 IPI00376317.3 autoantigen RCD8 110 152992 6 6 6 6 5255 6183 1 1 1 732.8903 1463.7661 2 1463.766 0.0001 0 41.12 0.0003 R EAFQSVVLPAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7278.7278.2.dta 79 1 IPI00376317.3 autoantigen RCD8 110 152992 6 6 6 6 5641 4080 1 1 1 513.6143 1537.8209 3 1537.8212 -0.0003 1 28.49 0.018 R EQEAREPVLAQLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5051.5051.3.dta 79 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 95 123252 5 5 5 5 1276 1009 1 0 1 436.7328 871.451 2 871.4512 -0.0001 0 37.93 0.0025 R ALAEGQQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1737.1737.2.dta 79 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 95 123252 5 5 5 5 1284 3573 1 0 1 437.2425 872.4705 2 872.4716 -0.0011 0 50.73 0.00015 K NLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4513.4513.2.dta 79 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 95 123252 5 5 5 5 4862 650 1 0 1 466.2353 1395.684 3 1395.6855 -0.0015 1 21.58 0.014 R ALETRHEQEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1357.1357.3.dta 79 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 95 123252 5 5 5 5 5255 6183 1 0 1 732.8903 1463.7661 2 1463.766 0.0001 0 41.12 0.0003 R EAFQSVVLPAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7278.7278.2.dta 79 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 95 123252 5 5 5 5 5641 4080 1 0 1 513.6143 1537.8209 3 1537.8212 -0.0003 1 28.49 0.018 R EQEAREPVLAQLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5051.5051.3.dta 80 1 IPI00256684.1 Isoform B of AP-2 complex subunit alpha-1 107 106387 5 5 5 5 2285 5330 1 1 1 515.2974 1028.5802 2 1028.5801 0.0001 0 34.68 0.0018 K ALQVGCLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6382.6382.2.dta 80 1 IPI00256684.1 Isoform B of AP-2 complex subunit alpha-1 107 106387 5 5 5 5 2800 6149 1 1 1 554.805 1107.5954 2 1107.5964 -0.001 0 30.69 0.0034 K FINLFPETK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7244.7244.2.dta 80 1 IPI00256684.1 Isoform B of AP-2 complex subunit alpha-1 107 106387 5 5 5 5 4255 5197 1 1 1 653.808 1305.6015 2 1305.6023 -0.0008 0 39.52 0.0002 R EMGEAFAADIPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6242.6242.2.dta 80 1 IPI00256684.1 Isoform B of AP-2 complex subunit alpha-1 107 106387 5 5 5 5 4333 5383 1 1 1 659.3568 1316.6991 2 1316.701 -0.0019 0 51.69 0.00014 R LVECLETVLNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6438.6438.2.dta 80 1 IPI00256684.1 Isoform B of AP-2 complex subunit alpha-1 107 106387 5 5 5 5 5294 4609 1 1 1 491.2453 1470.714 3 1470.715 -0.001 0 29.68 0.0046 R ACNQLGQFLQHR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5615.5615.3.dta 80 IPI00016621.6 AP-2 complex subunit alpha-2 30 104997 1 1 1 1 5294 4609 1 0 1 491.2453 1470.714 3 1470.715 -0.001 0 29.68 0.0046 R ACNQLGQFLQHR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5615.5615.3.dta 81 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 101 127371 5 5 5 5 606 704 1 1 1 381.7271 761.4397 2 761.4395 0.0002 1 26.09 0.02 K KSTALSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1414.1414.2.dta 81 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 101 127371 5 5 5 5 1332 4775 1 1 1 441.7866 881.5586 2 881.5586 0 0 40.94 0.00012 K LLAIPVEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5792.5792.2.dta 81 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 101 127371 5 5 5 5 1832 4783 1 1 1 481.787 961.5594 2 961.5597 -0.0003 0 22.94 0.042 R LFTIGGVQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5800.5800.2.dta 81 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 101 127371 5 5 5 5 5410 4864 1 1 1 745.3642 1488.7138 2 1488.7144 -0.0005 0 63.58 1.10E-06 R GLGNTWTPICNTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5887.5887.2.dta 81 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 101 127371 5 5 5 5 6984 4062 1 1 1 897.9222 1793.8299 2 1793.8333 -0.0033 0 18.16 0.02 K LNAGYSNTATEWSQPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5031.5031.2.dta 81 IPI00217920.5 Aldehyde dehydrogenase family 16 member A1 26 86100 1 1 1 1 606 704 1 0 1 381.7271 761.4397 2 761.4395 0.0002 1 26.09 0.02 R KSTLASR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1414.1414.2.dta 82 1 IPI00644231.2 cytoplasmic FMR1 interacting protein 1 isoform a 101 146742 3 3 3 3 3189 3905 1 1 1 584.3455 1166.6764 2 1166.6771 -0.0008 0 45.31 5.60E-05 R LGTPQQIAIAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4866.4866.2.dta 82 1 IPI00644231.2 cytoplasmic FMR1 interacting protein 1 isoform a 101 146742 3 3 3 3 3845 2056 1 1 1 628.2979 1254.5813 2 1254.584 -0.0028 0 66.75 2.40E-06 R YSNSEVVTGSGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2858.2858.2.dta 82 1 IPI00644231.2 cytoplasmic FMR1 interacting protein 1 isoform a 101 146742 3 3 3 3 4555 5746 1 1 1 676.353 1350.6915 2 1350.6932 -0.0017 0 29.12 0.012 R TVLPFSQEFQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6826.6826.2.dta 82 IPI00550212.3 cytoplasmic FMR1 interacting protein 1 isoform b 56 95660 2 2 2 2 3189 3905 1 0 1 584.3455 1166.6764 2 1166.6771 -0.0008 0 45.31 5.60E-05 R LGTPQQIAIAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4866.4866.2.dta 82 IPI00550212.3 cytoplasmic FMR1 interacting protein 1 isoform b 56 95660 2 2 2 2 4555 5746 1 0 1 676.353 1350.6915 2 1350.6932 -0.0017 0 29.12 0.012 R TVLPFSQEFQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6826.6826.2.dta 82 IPI00719600.3 cytoplasmic FMR1 interacting protein 2 45 147461 1 1 1 1 3189 3905 1 0 1 584.3455 1166.6764 2 1166.6771 -0.0008 0 45.31 5.60E-05 R LGTPQQIAIAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4866.4866.2.dta 82 IPI00790459.1 57 kDa protein 29 57627 1 1 1 1 4555 5746 1 0 1 676.353 1350.6915 2 1350.6932 -0.0017 0 29.12 0.012 R TVLPFSQEFQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6826.6826.2.dta 83 1 IPI00034049.1 Isoform 1 of Regulator of nonsense transcripts 1 101 125578 3 3 3 3 1745 5572 1 1 1 476.7787 951.5428 2 951.5429 -0.0002 0 38.45 0.0014 R IAYFTLPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6640.6640.2.dta 83 1 IPI00034049.1 Isoform 1 of Regulator of nonsense transcripts 1 101 125578 3 3 3 3 2795 5026 1 1 1 554.2915 1106.5685 2 1106.572 -0.0036 0 71.64 1.90E-06 K AGLSQSLFER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6060.6060.2.dta 83 1 IPI00034049.1 Isoform 1 of Regulator of nonsense transcripts 1 101 125578 3 3 3 3 3579 5213 1 1 1 612.3581 1222.7016 2 1222.7034 -0.0017 0 34.7 0.001 K VLVEGPLNNLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6259.6259.2.dta 84 1 IPI00026089.3 Splicing factor 3B subunit 1 98 146464 3 3 3 3 2094 3059 1 1 1 501.2721 1000.5297 2 1000.5301 -0.0004 0 33.51 0.00072 R QQAADLISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3958.3958.2.dta 84 1 IPI00026089.3 Splicing factor 3B subunit 1 98 146464 3 3 3 3 4211 4142 1 1 1 651.8262 1301.6379 2 1301.6398 -0.0019 0 74.05 2.90E-07 K VQENCIDLVGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5117.5117.2.dta 84 1 IPI00026089.3 Splicing factor 3B subunit 1 98 146464 3 3 3 3 6788 736 1 1 1 578.6028 1732.7865 3 1732.7878 -0.0012 0 23.77 0.0059 R GDTPGHATPGHGGATSSAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1447.1447.3.dta 85 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 98 122513 4 4 4 4 1164 6636 1 1 1 428.2234 854.4323 2 854.4327 -0.0003 0 20.55 0.047 R FDWFLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7751.7751.2.dta 85 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 98 122513 4 4 4 4 1473 5040 1 1 1 456.2345 910.4545 2 910.4549 -0.0004 0 28.23 0.028 R DFNQFIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6075.6075.2.dta 85 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 98 122513 4 4 4 4 2923 3865 1 1 1 564.8218 1127.629 2 1127.6299 -0.0009 0 47.13 0.00045 R LDSIVIQQGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4824.4824.2.dta 85 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 98 122513 4 4 4 4 3576 3353 1 1 1 612.2971 1222.5796 2 1222.583 -0.0034 0 69.55 5.40E-07 R FITDNTVEER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4279.4279.2.dta 85 IPI00216046.2 Isoform 1 of Probable global transcription activator SNF2L1 49 123211 3 3 3 3 1164 6636 1 0 1 428.2234 854.4323 2 854.4327 -0.0003 0 20.55 0.047 R FDWFIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7751.7751.2.dta 85 IPI00216046.2 Isoform 1 of Probable global transcription activator SNF2L1 49 123211 3 3 3 3 1473 5040 1 0 1 456.2345 910.4545 2 910.4549 -0.0004 0 28.23 0.028 R DFNQFIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6075.6075.2.dta 85 IPI00216046.2 Isoform 1 of Probable global transcription activator SNF2L1 49 123211 3 3 3 3 2923 3865 1 0 1 564.8218 1127.629 2 1127.6299 -0.0009 0 47.13 0.00045 R LDSIVIQQGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4824.4824.2.dta 86 1 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 97 232534 3 3 3 3 2821 1277 1 1 1 557.2852 1112.5558 2 1112.5574 -0.0017 0 44.06 0.00029 R NPSSAAPVQSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2020.2020.2.dta 86 1 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 97 232534 3 3 3 3 3559 2518 1 1 1 610.317 1218.6195 2 1218.6244 -0.0049 0 61.1 2.50E-06 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3352.3352.2.dta 86 1 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 97 232534 3 3 3 3 7269 5243 1 1 1 951.0268 1900.039 2 1900.0418 -0.0028 0 27.51 0.0026 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6291.6291.2.dta 86 IPI00647549.3 KIAA0310 protein (Fragment) 73 56651 2 2 2 2 3559 2518 1 0 1 610.317 1218.6195 2 1218.6244 -0.0049 0 61.1 2.50E-06 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3352.3352.2.dta 86 IPI00647549.3 KIAA0310 protein (Fragment) 73 56651 2 2 2 2 7269 5243 1 0 1 951.0268 1900.039 2 1900.0418 -0.0028 0 27.51 0.0026 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6291.6291.2.dta 86 IPI00031242.7 KIAA0310 61 54299 1 1 1 1 3559 2518 1 0 1 610.317 1218.6195 2 1218.6244 -0.0049 0 61.1 2.50E-06 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3352.3352.2.dta 87 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 94 18296 4 4 4 4 614 4411 1 1 0 383.2202 764.4258 2 764.4255 0.0003 0 28.02 0.021 - MQIFVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5405.5405.2.dta 87 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 94 18296 4 4 4 4 2659 3116 1 1 1 541.2789 1080.5432 2 1080.5451 -0.0019 0 41.38 0.0015 R TLSDYNIQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4022.4022.2.dta 87 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 94 18296 4 4 4 4 6962 5205 1 1 1 894.4663 1786.9181 2 1786.92 -0.0019 0 57.23 5.10E-06 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6251.6251.2.dta 87 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 94 18296 4 4 4 4 7488 4694 1 1 1 663.0244 1986.0512 3 1986.0521 -0.0008 1 28.1 0.0023 K TITLEVEPSDTIENVKAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5706.5706.3.dta 87 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 70 25309 2 2 2 2 6962 5205 1 0 1 894.4663 1786.9181 2 1786.92 -0.0019 0 57.23 5.10E-06 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6251.6251.2.dta 87 IPI00418813.2 "CDNA FLJ46113 fis, clone TESTI2036285, highly similar to Rattus norvegicus ubiquitin C" 70 25309 2 2 2 2 7488 4694 1 0 1 663.0244 1986.0512 3 1986.0521 -0.0008 1 28.1 0.0023 K TITLEVEPSDTIENVKAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5706.5706.3.dta 87 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 44 18355 2 2 2 2 614 4411 1 0 0 383.2202 764.4258 2 764.4255 0.0003 0 28.02 0.021 - MQIFVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5405.5405.2.dta 87 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 44 18355 2 2 2 2 2659 3116 1 0 1 541.2789 1080.5432 2 1080.5451 -0.0019 0 41.38 0.0015 R TLSDYNIQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4022.4022.2.dta 88 1 IPI00329672.4 Myosin-Ie 93 127531 2 2 2 2 3474 5200 1 1 1 604.3741 1206.7336 2 1206.7336 0 0 45.69 3.60E-05 K VLQVSIGPGLPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6245.6245.2.dta 88 1 IPI00329672.4 Myosin-Ie 93 127531 2 2 2 2 4168 6721 1 1 1 648.8452 1295.6759 2 1295.6762 -0.0003 0 66.97 4.00E-06 R VFDFLVDSINK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7845.7845.2.dta 89 1 IPI00163496.11 136 kDa protein 91 136607 3 3 3 3 580 1740 2 1 1 379.7314 757.4482 2 757.4446 0.0035 0 28.88 0.041 K LQQTLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2522.2522.2.dta 89 1 IPI00163496.11 136 kDa protein 91 136607 3 3 3 3 2591 3365 1 1 1 537.7802 1073.5458 2 1073.5465 -0.0008 0 67.46 3.70E-06 R VGSGSLDNLGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4292.4292.2.dta 89 1 IPI00163496.11 136 kDa protein 91 136607 3 3 3 3 5334 4693 1 1 1 737.8852 1473.7558 2 1473.7576 -0.0017 0 45.61 0.00031 R GLAAGSAETLPANFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5704.5704.2.dta 90 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 90 534809 4 4 4 4 3619 5929 1 1 1 615.3499 1228.6852 2 1228.6856 -0.0005 0 36.8 0.00035 R IFVFEPPPGVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7020.7020.2.dta 90 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 90 534809 4 4 4 4 4685 7185 1 1 1 687.405 1372.7955 2 1372.7966 -0.0011 0 20.99 0.012 K VNFLPEIITLSK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8322.8322.2.dta 90 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 90 534809 4 4 4 4 4900 5244 1 1 1 702.8926 1403.7707 2 1403.7694 0.0013 0 35.08 0.0015 R VLLTTQGVDMISK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6292.6292.2.dta 90 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 90 534809 4 4 4 4 5505 5137 1 1 1 756.9215 1511.8285 2 1511.8308 -0.0023 0 44.61 6.60E-05 R IQGLTVEQAEAVVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6178.6178.2.dta 91 1 IPI00647217.2 Superkiller viralicidic activity 2-like 2 87 118756 4 4 4 4 1569 3753 1 1 1 464.782 927.5494 2 927.5501 -0.0008 1 31.52 0.012 R RLEELLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4705.4705.2.dta 91 1 IPI00647217.2 Superkiller viralicidic activity 2-like 2 87 118756 4 4 4 4 2747 4209 1 1 1 549.3189 1096.6233 2 1096.624 -0.0008 0 49.82 7.00E-05 K LTEQLAGPLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5188.5188.2.dta 91 1 IPI00647217.2 Superkiller viralicidic activity 2-like 2 87 118756 4 4 4 4 3823 6226 1 1 1 625.8207 1249.6268 2 1249.6278 -0.001 0 19.68 0.026 K YCLPFLQPGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7323.7323.2.dta 91 1 IPI00647217.2 Superkiller viralicidic activity 2-like 2 87 118756 4 4 4 4 3960 5647 1 1 1 634.3209 1266.6273 2 1266.6278 -0.0005 0 48.65 0.00013 K MTDVFEGSIIR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6720.6720.2.dta 92 1 IPI00298363.2 Far upstream element-binding protein 2 87 73063 2 2 2 2 3293 6142 1 1 1 592.8531 1183.6916 2 1183.6924 -0.0008 0 60.91 7.20E-06 R IINDLLQSLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7238.7238.2.dta 92 1 IPI00298363.2 Far upstream element-binding protein 2 87 73063 2 2 2 2 4215 3257 1 1 1 651.8475 1301.6805 2 1301.6827 -0.0022 0 47.75 0.00015 R SVSLTGAPESVQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4177.4177.2.dta 93 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 86 167765 3 3 3 3 4704 3757 1 1 1 688.3615 1374.7085 2 1374.7103 -0.0018 0 47.76 9.40E-05 K ASQAEISSLQSVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4709.4709.2.dta 93 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 86 167765 3 3 3 3 5223 5172 1 1 1 730.3672 1458.7199 2 1458.7202 -0.0002 0 33.86 0.00067 K VLELEDELQESR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6215.6215.2.dta 93 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 86 167765 3 3 3 3 6064 5269 1 1 1 541.9608 1622.8604 3 1622.8627 -0.0023 0 40.02 0.0004 R IQALEAELQAVSHSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6319.6319.3.dta 94 1 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 85 61749 4 4 4 4 286 2559 1 1 1 340.6899 679.3653 2 679.3653 0 0 26.34 0.022 K VSFATR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3396.3396.2.dta 94 1 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 85 61749 4 4 4 4 303 752 1 1 1 344.1696 686.3246 2 686.3249 -0.0002 0 19.57 0.038 K NFGGHR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1464.1464.2.dta 94 1 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 85 61749 4 4 4 4 915 817 1 1 1 413.1777 824.3409 2 824.3413 -0.0004 0 35.01 0.0013 R SGGGYGGDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1533.1533.2.dta 94 1 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 85 61749 4 4 4 4 4979 3637 1 1 1 710.8347 1419.6549 2 1419.6518 0.0031 0 62.28 2.40E-06 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4581.4581.2.dta 94 IPI00221354.1 Isoform Short of RNA-binding protein FUS 68 53551 2 2 2 2 286 2559 1 0 1 340.6899 679.3653 2 679.3653 0 0 26.34 0.022 K VSFATR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3396.3396.2.dta 94 IPI00221354.1 Isoform Short of RNA-binding protein FUS 68 53551 2 2 2 2 4979 3637 1 0 1 710.8347 1419.6549 2 1419.6518 0.0031 0 62.28 2.40E-06 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4581.4581.2.dta 95 1 IPI00465294.2 Cell division cycle 5-like protein 85 92422 3 3 3 3 181 2101 1 1 1 322.2105 642.4065 2 642.4064 0 0 35.13 0.0053 R LAALQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2906.2906.2.dta 95 1 IPI00465294.2 Cell division cycle 5-like protein 85 92422 3 3 3 3 1052 4219 1 1 1 420.7688 839.523 2 839.5229 0.0002 0 23.78 0.015 R TIAPIIGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5199.5199.2.dta 95 1 IPI00465294.2 Cell division cycle 5-like protein 85 92422 3 3 3 3 1578 1796 1 1 1 465.754 929.4935 2 929.493 0.0005 0 71.76 1.50E-06 K VGQASEIAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2581.2581.2.dta 96 1 IPI00007927.3 Isoform 1 of Structural maintenance of chromosomes protein 2 83 136266 2 2 2 2 5509 5035 1 1 1 757.9182 1513.8219 2 1513.8239 -0.002 0 82.66 5.50E-08 K TILEEEITPTIQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6069.6069.2.dta 96 1 IPI00007927.3 Isoform 1 of Structural maintenance of chromosomes protein 2 83 136266 2 2 2 2 5589 5835 1 1 1 767.3895 1532.7644 2 1532.7682 -0.0038 0 20.94 0.031 K DTSATTALELVAGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6925.6925.2.dta 97 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 83 172080 3 3 3 3 1213 3138 1 1 1 433.7585 865.5025 2 865.5022 0.0004 0 43.72 0.00018 K VIDPVAPR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4045.4045.2.dta 97 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 83 172080 3 3 3 3 1674 2520 1 1 1 471.7711 941.5276 2 941.5294 -0.0018 0 54.48 4.50E-05 R VAVQGDVVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3354.3354.2.dta 97 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 83 172080 3 3 3 3 1868 3369 1 1 1 483.7446 965.4746 2 965.4753 -0.0007 0 28.81 0.016 K SCQFVAVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4296.4296.2.dta 98 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 83 37464 3 3 3 3 2163 3917 1 1 1 507.2252 1012.4358 2 1012.4363 -0.0005 0 51.87 3.10E-05 R GGNFGFGDSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4879.4879.2.dta 98 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 83 37464 3 3 3 3 2481 4030 1 1 1 529.2984 1056.5823 2 1056.5815 0.0007 0 29.08 0.018 K TLETVPLER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4998.4998.2.dta 98 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 83 37464 3 3 3 3 4710 3607 1 1 1 689.3187 1376.6228 2 1376.6222 0.0006 0 40.45 0.00017 R GGGGNFGPGPGSNFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4549.4549.2.dta 98 IPI00414696.1 Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 75 36041 2 2 2 2 2163 3917 1 0 1 507.2252 1012.4358 2 1012.4363 -0.0005 0 51.87 3.10E-05 R GGNFGFGDSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4879.4879.2.dta 98 IPI00414696.1 Isoform A2 of Heterogeneous nuclear ribonucleoproteins A2/B1 75 36041 2 2 2 2 4710 3607 1 0 1 689.3187 1376.6228 2 1376.6222 0.0006 0 40.45 0.00017 R GGGGNFGPGPGSNFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4549.4549.2.dta 99 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 82 51230 3 3 3 3 478 1739 1 1 1 365.2173 728.4201 2 728.4181 0.002 0 41.87 0.0014 K NAGAVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2521.2521.2.dta 99 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 82 51230 3 3 3 3 4465 6737 1 1 1 670.9058 1339.797 2 1339.7962 0.0007 0 30.02 0.0037 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7862.7862.2.dta 99 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 82 51230 3 3 3 3 6950 3301 1 1 1 890.9024 1779.7903 2 1779.7911 -0.0009 0 50.16 2.00E-05 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4224.4224.2.dta 99 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 63 47756 2 2 2 2 4465 6737 1 0 1 670.9058 1339.797 2 1339.7962 0.0007 0 30.02 0.0037 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7862.7862.2.dta 99 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 63 47756 2 2 2 2 6950 3301 1 0 1 890.9024 1779.7903 2 1779.7911 -0.0009 0 50.16 2.00E-05 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4224.4224.2.dta 99 IPI00796697.1 42 kDa protein 42 42582 1 1 1 1 478 1739 1 0 1 365.2173 728.4201 2 728.4181 0.002 0 41.87 0.0014 K NAGAVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2521.2521.2.dta 99 IPI00640296.1 Heterogeneous nuclear ribonucleoprotein K 30 34354 1 1 1 1 4465 6737 1 0 1 670.9058 1339.797 2 1339.7962 0.0007 0 30.02 0.0037 K IILDLISESPIK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7862.7862.2.dta 100 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 79 10921 3 3 3 3 324 2439 1 1 1 346.1817 690.3488 2 690.3483 0.0005 0 31.72 0.0039 R QGLSMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3268.3268.2.dta 100 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 79 10921 3 3 3 3 3379 2072 1 1 1 599.2953 1196.5761 2 1196.5785 -0.0024 0 28.12 0.0045 K TENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2875.2875.2.dta 100 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 79 10921 3 3 3 3 3681 3644 1 1 1 617.8243 1233.6341 2 1233.6354 -0.0012 0 55.86 8.80E-06 K VAGQDGSVVQFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4589.4589.2.dta 100 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 69 11687 2 2 2 2 324 2439 1 0 1 346.1817 690.3488 2 690.3483 0.0005 0 31.72 0.0039 R QGLSMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3268.3268.2.dta 100 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 69 11687 2 2 2 2 3681 3644 1 0 1 617.8243 1233.6341 2 1233.6354 -0.0012 0 55.86 8.80E-06 K VAGQDGSVVQFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4589.4589.2.dta 100 IPI00640611.1 9 kDa protein 28 9215 1 1 1 1 3379 2072 1 0 1 599.2953 1196.5761 2 1196.5785 -0.0024 0 28.12 0.0045 K TENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2875.2875.2.dta 101 1 IPI00177817.4 Isoform SERCA2A of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 79 111103 2 2 2 2 4928 5179 1 1 1 704.851 1407.6874 2 1407.6882 -0.0008 0 72.08 1.70E-07 R IGIFGQDEDVTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6223.6223.2.dta 101 1 IPI00177817.4 Isoform SERCA2A of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 79 111103 2 2 2 2 6008 5459 1 1 1 810.9091 1619.8036 2 1619.8076 -0.0041 0 22.28 0.0081 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6518.6518.2.dta 101 IPI00004092.2 Isoform SERCA3B of Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 22 115444 1 1 1 1 6008 5459 1 0 1 810.9091 1619.8036 2 1619.8076 -0.0041 0 22.28 0.0081 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6518.6518.2.dta 102 1 IPI00298961.3 Exportin-1 79 124447 3 3 3 3 1502 4546 1 1 1 459.264 916.5135 2 916.513 0.0005 0 54.29 7.30E-05 K LISGWVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5548.5548.2.dta 102 1 IPI00298961.3 Exportin-1 79 124447 3 3 3 3 3988 6438 1 1 1 636.3384 1270.6622 2 1270.6631 -0.0009 0 39.42 0.0003 R IYLDMLNVYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7541.7541.2.dta 102 1 IPI00298961.3 Exportin-1 79 124447 3 3 3 3 4153 5018 1 1 1 431.9189 1292.7347 3 1292.7354 -0.0006 0 24.48 0.0092 K AVGHPFVIQLGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6051.6051.3.dta 103 1 IPI00783829.3 Importin beta-3 78 125032 1 1 1 1 6100 6096 1 1 1 815.9179 1629.8213 2 1629.8218 -0.0005 0 77.93 2.20E-07 R VAAAESMPLLLECAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7190.7190.2.dta 104 1 IPI00023234.3 SUMO-activating enzyme subunit 2 78 71749 1 1 1 1 1900 2709 1 1 1 486.7588 971.503 2 971.5036 -0.0006 0 77.65 3.30E-07 R ELAEAVAGGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3567.3567.2.dta 105 1 IPI00220991.2 Hypothetical protein DKFZp781K0743 77 106695 3 3 3 3 1668 4273 1 1 1 471.2925 940.5705 2 940.5705 -0.0001 0 36.34 0.0011 R NINLIVQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5256.5256.2.dta 105 1 IPI00220991.2 Hypothetical protein DKFZp781K0743 77 106695 3 3 3 3 4041 3374 1 1 1 639.3452 1276.6758 2 1276.6775 -0.0018 0 42.02 0.00017 K LQNNNVYTIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4302.4302.2.dta 105 1 IPI00220991.2 Hypothetical protein DKFZp781K0743 77 106695 3 3 3 3 4811 6832 1 1 1 695.8821 1389.7497 2 1389.7538 -0.004 0 38.99 0.0025 R CVSTLLDLIQTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7961.7961.2.dta 105 IPI00328257.4 Isoform A of AP-1 complex subunit beta-1 53 105452 2 2 2 2 1668 4273 1 0 1 471.2925 940.5705 2 940.5705 -0.0001 0 36.34 0.0011 R NINLIVQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5256.5256.2.dta 105 IPI00328257.4 Isoform A of AP-1 complex subunit beta-1 53 105452 2 2 2 2 4811 6832 1 0 1 695.8821 1389.7497 2 1389.7538 -0.004 0 38.99 0.0025 R CVSTLLDLIQTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7961.7961.2.dta 105 IPI00788911.1 Protein 39 19502 1 1 1 1 4811 6832 1 0 1 695.8821 1389.7497 2 1389.7538 -0.004 0 38.99 0.0025 R CVSTLLDLIQTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7961.7961.2.dta 106 1 IPI00293464.5 DNA damage-binding protein 1 77 128142 4 4 4 4 1177 2849 1 1 1 430.2473 858.48 2 858.4811 -0.0011 0 42.05 0.0016 R LGDSQLVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3723.3723.2.dta 106 1 IPI00293464.5 DNA damage-binding protein 1 77 128142 4 4 4 4 1365 7842 1 1 1 448.72 895.4255 2 895.426 -0.0006 0 19.36 0.015 R AHGNVQDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.922.922.2.dta 106 1 IPI00293464.5 DNA damage-binding protein 1 77 128142 4 4 4 4 3294 4144 1 1 1 592.8536 1183.6926 2 1183.6925 0.0001 0 51.04 6.30E-05 K VTLGTQPTVLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5119.5119.2.dta 106 1 IPI00293464.5 DNA damage-binding protein 1 77 128142 4 4 4 4 7485 5901 1 1 1 661.6824 1982.0255 3 1982.0255 0 0 25.66 0.013 R IGRPSETGIIGIIDPECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6991.6991.3.dta 107 1 IPI00022371.1 Histidine-rich glycoprotein precursor 76 60510 2 2 2 2 703 4068 1 1 1 393.7397 785.4649 2 785.4647 0.0003 0 43.57 0.00055 K ALDLINK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5038.5038.2.dta 107 1 IPI00022371.1 Histidine-rich glycoprotein precursor 76 60510 2 2 2 2 2903 7256 1 1 1 562.8078 1123.601 2 1123.6026 -0.0015 0 56.52 4.30E-05 R DGYLFQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8400.8400.2.dta 108 1 IPI00220038.1 Isoform B of Arsenite-resistance protein 2 76 100670 3 3 3 3 1603 4251 1 1 1 467.2575 932.5005 2 932.5001 0.0004 0 34.72 0.0019 R AEIISLCK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5233.5233.2.dta 108 1 IPI00220038.1 Isoform B of Arsenite-resistance protein 2 76 100670 3 3 3 3 4496 5663 1 1 1 673.3372 1344.6599 2 1344.6608 -0.0009 0 55.79 5.00E-05 K EICWNLQNIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6737.6737.2.dta 108 1 IPI00220038.1 Isoform B of Arsenite-resistance protein 2 76 100670 3 3 3 3 5512 6983 1 1 1 758.3763 1514.738 2 1514.7405 -0.0025 0 28.49 0.0082 K EVAFFNNFLTDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8114.8114.2.dta 108 IPI00414434.1 Arsenite-resistance protein ARS2 28 26366 1 1 1 1 5512 6983 1 0 1 758.3763 1514.738 2 1514.7405 -0.0025 0 28.49 0.0082 K EVAFFNNFLTDAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8114.8114.2.dta 109 1 IPI00296099.6 Thrombospondin-1 precursor 74 133291 3 3 3 3 4680 3968 1 1 1 686.8322 1371.6499 2 1371.6531 -0.0033 0 22.82 0.015 K GTSQNDPNWVVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4933.4933.2.dta 109 1 IPI00296099.6 Thrombospondin-1 precursor 74 133291 3 3 3 3 4844 6455 1 1 1 697.8687 1393.7228 2 1393.7242 -0.0014 0 47.74 5.50E-05 R FVFGTTPEDILR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7559.7559.2.dta 109 1 IPI00296099.6 Thrombospondin-1 precursor 74 133291 3 3 3 3 7460 1675 1 1 1 657.2862 1968.8368 3 1968.8378 -0.001 1 39 0.00047 R SCDSLNNRCEGSSVQTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2443.2443.3.dta 110 1 IPI00039626.3 Isoform D of UPF0318 protein FAM120A 74 118415 2 2 2 2 3573 5673 1 1 1 611.8237 1221.6328 2 1221.6353 -0.0026 0 44.03 0.00053 R QSVLEGLSFSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6748.6748.2.dta 110 1 IPI00039626.3 Isoform D of UPF0318 protein FAM120A 74 118415 2 2 2 2 4780 4689 1 1 1 693.8583 1385.702 2 1385.7038 -0.0018 1 53.03 6.10E-05 R EAALEAAVLNKEE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5700.5700.2.dta 110 IPI00472054.1 Isoform A of UPF0318 protein FAM120A 44 117711 1 1 1 1 3573 5673 1 0 1 611.8237 1221.6328 2 1221.6353 -0.0026 0 44.03 0.00053 R QSVLEGLSFSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6748.6748.2.dta 111 1 IPI00217182.4 Isoform DPII of Desmoplakin 73 262166 3 3 3 3 2387 3057 1 1 1 522.7877 1043.5609 2 1043.5611 -0.0002 0 49.66 3.60E-05 R VLLQEEGTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3956.3956.2.dta 111 1 IPI00217182.4 Isoform DPII of Desmoplakin 73 262166 3 3 3 3 2588 1817 1 1 1 537.2812 1072.5479 2 1072.5513 -0.0033 0 34.66 0.0011 R GAGSIAGASASPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2603.2603.2.dta 111 1 IPI00217182.4 Isoform DPII of Desmoplakin 73 262166 3 3 3 3 3990 4359 1 1 1 636.355 1270.6954 2 1270.6993 -0.0039 0 22.01 0.0086 R QLQNIIQATSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5348.5348.2.dta 112 1 IPI00413895.2 "Golgi autoantigen, golgin subfamily A member 2" 73 113644 2 2 2 2 2310 1873 1 1 1 516.7873 1031.56 2 1031.5611 -0.0011 0 57.61 2.20E-05 R ALSAVSTQQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2663.2663.2.dta 112 1 IPI00413895.2 "Golgi autoantigen, golgin subfamily A member 2" 73 113644 2 2 2 2 4788 5397 1 1 1 694.3735 1386.7324 2 1386.7354 -0.003 0 35.47 0.00072 R VQELETSLAELR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6453.6453.2.dta 113 1 IPI00291946.7 Ubiquitin carboxyl-terminal hydrolase 10 72 88264 1 1 1 1 4207 6293 1 1 1 651.3567 1300.6988 2 1300.6987 0.0002 0 72.2 6.00E-07 R TVQDALESLVAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7392.7392.2.dta 114 1 IPI00008240.2 "Methionyl-tRNA synthetase, cytoplasmic" 70 102249 3 3 3 3 2541 1086 1 1 1 533.7675 1065.5204 2 1065.5203 0.0001 0 22.21 0.0083 K QPQPSPAEGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1818.1818.2.dta 114 1 IPI00008240.2 "Methionyl-tRNA synthetase, cytoplasmic" 70 102249 3 3 3 3 3526 3735 1 1 1 608.8119 1215.6092 2 1215.6095 -0.0003 0 58.26 3.60E-05 K LENDQIESLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4686.4686.2.dta 114 1 IPI00008240.2 "Methionyl-tRNA synthetase, cytoplasmic" 70 102249 3 3 3 3 4510 6850 1 1 1 673.8874 1345.7602 2 1345.7605 -0.0003 0 31.96 0.0073 K ITQDIFQQLLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7979.7979.2.dta 114 IPI00792878.1 11 kDa protein 58 10837 1 1 1 1 3526 3735 1 0 1 608.8119 1215.6092 2 1215.6095 -0.0003 0 58.26 3.60E-05 K LENDQIESLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4686.4686.2.dta 114 IPI00185398.3 28 kDa protein 22 28332 1 1 1 1 2541 1086 1 0 1 533.7675 1065.5204 2 1065.5203 0.0001 0 22.21 0.0083 K QPQPSPAEGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1818.1818.2.dta 115 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 70 274738 4 4 4 4 2005 7053 1 1 1 495.3096 988.6046 2 988.6069 -0.0024 0 26.75 0.0031 K ISLIQIFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8185.8185.2.dta 115 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 70 274738 4 4 4 4 2242 5426 1 1 1 512.269 1022.5234 2 1022.5219 0.0015 0 32.37 0.0077 K FICISDLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6484.6484.2.dta 115 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 70 274738 4 4 4 4 2577 4914 1 1 1 536.8037 1071.5929 2 1071.5924 0.0005 0 51.11 0.00015 K TAEEVAALIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5940.5940.2.dta 115 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 70 274738 4 4 4 4 2686 847 1 1 1 543.2933 1084.572 2 1084.5737 -0.0017 1 23.79 0.034 K RQEAIAQNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1564.1564.2.dta 115 IPI00445357.1 "CDNA FLJ44181 fis, clone THYMU2038301, highly similar to Homo sapiens PRP8 protein" 32 15173 1 1 1 1 2242 5426 1 0 1 512.269 1022.5234 2 1022.5219 0.0015 0 32.37 0.0077 K FICISDLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6484.6484.2.dta 116 1 IPI00549861.3 "CDNA FLJ13369 fis, clone PLACE1000610, weakly similar to MSN5 PROTEIN" 70 84451 2 2 2 2 5685 5650 1 1 1 777.3716 1552.7287 2 1552.7299 -0.0012 0 31.11 0.0012 R EVMDLITVCCVSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6723.6723.2.dta 116 1 IPI00549861.3 "CDNA FLJ13369 fis, clone PLACE1000610, weakly similar to MSN5 PROTEIN" 70 84451 2 2 2 2 5878 3620 1 1 1 795.3381 1588.6617 2 1588.661 0.0007 0 54.96 1.40E-05 K SCDPGLEDPCGLNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4563.4563.2.dta 116 IPI00640551.1 Exportin 5 31 18125 1 1 1 1 5685 5650 1 0 1 777.3716 1552.7287 2 1552.7299 -0.0012 0 31.11 0.0012 R EVMDLITVCCVSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6723.6723.2.dta 117 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 69 141390 4 4 4 4 1742 4753 1 1 1 476.7584 951.5022 2 951.5025 -0.0003 0 19.01 0.048 R TFSLTEVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5768.5768.2.dta 117 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 69 141390 4 4 4 4 2088 5396 1 1 1 500.811 999.6075 2 999.6077 -0.0002 0 61.79 4.90E-06 K LTLLQVASR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6452.6452.2.dta 117 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 69 141390 4 4 4 4 2801 5543 1 1 1 554.8139 1107.6133 2 1107.6176 -0.0043 0 30.96 0.013 K YLIGELVSSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6609.6609.2.dta 117 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 69 141390 4 4 4 4 4095 6643 1 1 1 644.35 1286.6855 2 1286.687 -0.0015 0 18.42 0.038 R WENIATILEAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7760.7760.2.dta 117 IPI00175193.4 KIF4B (Fragment) 31 136382 1 1 1 1 2801 5543 1 0 1 554.8139 1107.6133 2 1107.6176 -0.0043 0 30.96 0.013 K YLIGELVSSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6609.6609.2.dta 118 1 IPI00329208.3 KIAA0251 protein 68 55746 2 2 2 2 4715 6128 1 1 1 689.363 1376.7115 2 1376.7122 -0.0007 0 51.98 0.00011 R ILSDTTLWLCR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7223.7223.2.dta 118 1 IPI00329208.3 KIAA0251 protein 68 55746 2 2 2 2 5500 5809 1 1 1 755.8815 1509.7485 2 1509.7504 -0.0019 0 38.33 0.0006 R FFQELPGSDPVFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6897.6897.2.dta 119 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 67 64720 2 2 2 2 2870 3270 1 1 1 561.2549 1120.4952 2 1120.4971 -0.0019 0 34.11 0.00063 K LCFSTAQHAS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4191.4191.2.dta 119 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 67 64720 2 2 2 2 3571 5147 1 1 1 611.8002 1221.5858 2 1221.5877 -0.0019 0 52.64 8.20E-05 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6189.6189.2.dta 119 IPI00647473.1 19 kDa protein 53 19045 1 1 1 1 3571 5147 1 0 1 611.8002 1221.5858 2 1221.5877 -0.0019 0 52.64 8.20E-05 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6189.6189.2.dta 120 1 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 66 58538 1 1 1 1 4608 4337 1 1 1 680.3553 1358.6961 2 1358.6976 -0.0015 0 65.7 7.30E-06 R NTGIICTIGPASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5325.5325.2.dta 121 1 IPI00019848.1 Isoform 1 of Host cell factor 65 210707 4 4 4 4 1353 1165 1 1 1 447.7163 893.418 2 893.4178 0.0002 0 16.88 0.031 K NGPPPCPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1902.1902.2.dta 121 1 IPI00019848.1 Isoform 1 of Host cell factor 65 210707 4 4 4 4 1355 5169 1 1 1 447.7453 893.476 2 893.4759 0.0001 0 23.52 0.009 R LYIWSGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6212.6212.2.dta 121 1 IPI00019848.1 Isoform 1 of Host cell factor 65 210707 4 4 4 4 1872 4556 1 1 1 483.8029 965.5913 2 965.591 0.0004 0 20.21 0.011 K GPLPAGTILK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5558.5558.2.dta 121 1 IPI00019848.1 Isoform 1 of Host cell factor 65 210707 4 4 4 4 5911 5789 1 1 1 798.9546 1595.8946 2 1595.8883 0.0064 0 48.86 3.00E-05 K SPISVPGGSALISNLGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6876.6876.2.dta 121 IPI00641238.1 14 kDa protein 24 14298 1 1 1 1 1355 5169 1 0 1 447.7453 893.476 2 893.4759 0.0001 0 23.52 0.009 R LYIWSGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6212.6212.2.dta 122 1 IPI00006038.4 Isoform 1 of Nuclear pore complex protein Nup98-Nup96 precursor 65 188643 2 2 2 2 2095 5238 1 1 1 501.3033 1000.592 2 1000.5917 0.0003 0 67.17 1.70E-06 R SLVGGLLQSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6286.6286.2.dta 122 1 IPI00006038.4 Isoform 1 of Nuclear pore complex protein Nup98-Nup96 precursor 65 188643 2 2 2 2 2519 5097 1 1 1 532.2929 1062.5713 2 1062.5709 0.0003 0 16.15 0.043 R EYIQILER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6135.6135.2.dta 123 1 IPI00328306.8 Zinc finger CCCH domain-containing protein 11A 64 90146 2 2 2 2 2843 6081 1 1 1 558.3186 1114.6227 2 1114.6234 -0.0007 0 52.78 7.00E-05 K TLEEILLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7175.7175.2.dta 123 1 IPI00328306.8 Zinc finger CCCH domain-containing protein 11A 64 90146 2 2 2 2 4389 3199 1 1 1 663.3614 1324.7082 2 1324.7099 -0.0017 0 35.29 0.0043 K LSVQSNPSPQLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4115.4115.2.dta 123 IPI00455725.3 similar to Zinc finger CCCH-type domain-containing protein 11A isoform 1 35 89679 1 1 1 1 4389 3199 1 0 1 663.3614 1324.7082 2 1324.7099 -0.0017 0 35.29 0.0043 K LSVQSNPSPQLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4115.4115.2.dta 124 1 IPI00100151.4 Isoform 1 of 5~-3~ exoribonuclease 2 64 109426 2 2 2 2 3508 1325 1 1 1 607.2996 1212.5847 2 1212.5847 0 0 48.16 3.00E-05 R NSPGSQVASNPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2072.2072.2.dta 124 1 IPI00100151.4 Isoform 1 of 5~-3~ exoribonuclease 2 64 109426 2 2 2 2 4271 5927 1 1 1 654.8558 1307.697 2 1307.6986 -0.0016 0 35.69 0.0039 R GVGAEPLLPWNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7018.7018.2.dta 125 1 IPI00027230.3 Endoplasmin precursor 63 92696 2 2 2 2 1298 3697 1 1 1 438.7325 875.4504 2 875.4501 0.0002 0 36.64 0.0011 K TFEINPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4644.4644.2.dta 125 1 IPI00027230.3 Endoplasmin precursor 63 92696 2 2 2 2 3312 5496 1 1 1 594.3418 1186.669 2 1186.671 -0.002 0 47.58 0.0002 K SILFVPTSAPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6559.6559.2.dta 125 IPI00556482.1 Heat shock protein 94c 37 52205 1 1 1 1 1298 3697 1 0 1 438.7325 875.4504 2 875.4501 0.0002 0 36.64 0.0011 K TFEINPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4644.4644.2.dta 126 1 IPI00012837.1 Kinesin heavy chain 61 110358 3 3 3 3 2514 5007 1 1 1 531.8007 1061.5868 2 1061.5869 -0.0002 0 31.27 0.0084 K LFVQDLATR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6039.6039.2.dta 126 1 IPI00012837.1 Kinesin heavy chain 61 110358 3 3 3 3 3473 5690 1 1 1 604.3315 1206.6484 2 1206.6496 -0.0012 0 40.41 0.00033 K LYLVDLAGSEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6766.6766.2.dta 126 1 IPI00012837.1 Kinesin heavy chain 61 110358 3 3 3 3 5397 3487 1 1 1 743.8919 1485.7693 2 1485.7688 0.0004 0 29.8 0.006 R GGGAFVQNSQPVAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4422.4422.2.dta 126 IPI00028561.1 Kinesin heavy chain isoform 5C 40 109997 1 1 1 1 3473 5690 1 0 1 604.3315 1206.6484 2 1206.6496 -0.0012 0 40.41 0.00033 K LYLVDLAGSEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6766.6766.2.dta 127 1 IPI00292894.4 "TSR1, 20S rRNA accumulation, homolog" 60 81137 1 1 1 1 4956 5678 1 1 1 708.3563 1414.698 2 1414.6994 -0.0014 0 59.8 1.40E-05 R IFQFQNFTNTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6753.6753.2.dta 128 1 IPI00218288.6 "SEC24 related gene family, member D" 59 114547 3 3 3 3 2540 1592 1 1 1 533.7672 1065.5198 2 1065.5203 -0.0006 0 47.24 8.80E-05 R GGQVYATNTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2356.2356.2.dta 128 1 IPI00218288.6 "SEC24 related gene family, member D" 59 114547 3 3 3 3 5511 7072 1 1 1 758.3602 1514.7058 2 1514.7075 -0.0017 0 18.28 0.019 K SCETDALINFFAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8206.8206.2.dta 128 1 IPI00218288.6 "SEC24 related gene family, member D" 59 114547 3 3 3 3 6802 5822 1 1 1 868.9636 1735.9126 2 1735.9145 -0.0019 0 31.84 0.0088 K ILFQPQTNVYDSLAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6911.6911.2.dta 129 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 59 246006 3 3 3 3 3149 6621 1 1 1 582.2955 1162.5764 2 1162.5771 -0.0007 0 42.03 0.00047 R DIDAFWLQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7735.7735.2.dta 129 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 59 246006 3 3 3 3 3321 4092 1 1 1 595.3426 1188.6706 2 1188.6714 -0.0007 0 28.1 0.0037 R IVALSSSLSNAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5063.5063.2.dta 129 1 IPI00420014.2 U5 small nuclear ribonucleoprotein 200 kDa helicase 59 246006 3 3 3 3 4057 6504 1 1 1 641.3281 1280.6417 2 1280.6435 -0.0018 0 25.71 0.0094 R SLVQEMVGSFGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7613.7613.2.dta 129 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 48 71883 2 2 2 2 3149 6621 1 0 1 582.2955 1162.5764 2 1162.5771 -0.0007 0 42.03 0.00047 R DIDAFWLQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7735.7735.2.dta 129 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 48 71883 2 2 2 2 4057 6504 1 0 1 641.3281 1280.6417 2 1280.6435 -0.0018 0 25.71 0.0094 R SLVQEMVGSFGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7613.7613.2.dta 129 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 37 186865 2 2 2 2 3321 4092 1 0 1 595.3426 1188.6706 2 1188.6714 -0.0007 0 28.1 0.0037 R IVALSSSLSNAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5063.5063.2.dta 129 IPI00740142.1 "similar to U5 snRNP-specific protein, 200 kDa" 37 186865 2 2 2 2 4057 6504 1 0 1 641.3281 1280.6417 2 1280.6435 -0.0018 0 25.71 0.0094 R SLVQEMVGSFGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7613.7613.2.dta 130 1 IPI00004671.1 Golgin subfamily B member 1 58 377273 2 2 2 2 514 4442 3 0 1 372.255 742.4954 2 742.4952 0.0002 1 27.32 0.015 R LLKELK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5438.5438.2.dta 130 1 IPI00004671.1 Golgin subfamily B member 1 58 377273 2 2 2 2 5708 5412 1 1 1 780.4016 1558.7887 2 1558.7912 -0.0026 0 49.48 2.30E-05 R IAELEEELVCVQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6469.6469.2.dta 131 1 IPI00219330.2 Isoform 5 of Interleukin enhancer-binding factor 3 58 74959 3 3 3 3 1962 3545 1 1 1 492.7844 983.5542 2 983.5552 -0.0011 0 29.14 0.0039 R LAAFGQLHK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4484.4484.2.dta 131 1 IPI00219330.2 Isoform 5 of Interleukin enhancer-binding factor 3 58 74959 3 3 3 3 2225 5038 1 1 1 510.7895 1019.5645 2 1019.5651 -0.0006 0 31.26 0.01 K AYAALAALEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6072.6072.2.dta 131 1 IPI00219330.2 Isoform 5 of Interleukin enhancer-binding factor 3 58 74959 3 3 3 3 5136 4567 1 1 1 722.3646 1442.7147 2 1442.7188 -0.0041 0 40.15 0.00083 K VLQDMGLPTGAEGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5570.5570.2.dta 131 IPI00556364.1 Interleukin enhancer binding factor 3 isoform c variant (Fragment) 29 50473 1 1 1 1 1962 3545 1 0 1 492.7844 983.5542 2 983.5552 -0.0011 0 29.14 0.0039 R LAAFGQLHK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4484.4484.2.dta 132 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 58 23165 2 2 2 2 183 671 1 0 0 322.2289 642.4432 2 642.4428 0.0003 1 32.86 0.0014 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1380.1380.2.dta 132 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 58 23165 2 2 2 2 1499 3461 1 1 1 459.2526 916.4906 2 916.4978 -0.0072 1 47.47 0.0006 K LLEGKDSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4395.4395.2.dta 133 1 IPI00465439.5 Fructose-bisphosphate aldolase A 57 39851 2 2 2 2 2726 1333 1 1 1 547.2848 1092.555 2 1092.5563 -0.0013 1 39.32 0.0014 K AAQEEYVKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2080.2080.2.dta 133 1 IPI00465439.5 Fructose-bisphosphate aldolase A 57 39851 2 2 2 2 2945 2760 1 1 1 566.7914 1131.5683 2 1131.5706 -0.0023 0 40.3 0.00076 R ALANSLACQGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3622.3622.2.dta 133 IPI00789118.1 Protein 39 23121 1 1 1 1 2726 1333 1 0 1 547.2848 1092.555 2 1092.5563 -0.0013 1 39.32 0.0014 K AAQEEYVKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2080.2080.2.dta 134 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 57 32375 1 1 1 1 4415 5732 1 1 1 665.3322 1328.6499 2 1328.6513 -0.0015 0 57.11 9.90E-06 K GFAFVQYVNER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6811.6811.2.dta 135 1 IPI00304885.1 Centromere protein C 1 57 107488 2 2 2 2 586 568 1 1 1 380.2269 758.4393 2 758.4399 -0.0006 1 37.55 0.0038 K AGSLKQR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1268.1268.2.dta 135 1 IPI00304885.1 Centromere protein C 1 57 107488 2 2 2 2 2987 4710 1 1 1 568.7667 1135.5189 2 1135.5219 -0.003 1 39.96 0.00018 R STKYEMYSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5723.5723.2.dta 136 1 IPI00306749.7 89 kDa protein 57 89700 1 1 1 1 2171 6258 1 1 1 507.3206 1012.6266 2 1012.6281 -0.0014 0 56.95 1.40E-05 R ILDTLGLLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7357.7357.2.dta 137 1 IPI00009471.1 WD repeat protein 3 57 107115 1 1 1 1 3080 6609 1 1 1 574.3268 1146.6391 2 1146.6397 -0.0006 0 56.76 2.80E-05 K DAITQALFLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7720.7720.2.dta 138 1 IPI00025273.1 Isoform Long of Trifunctional purine biosynthetic protein adenosine-3 56 108953 1 1 1 1 2382 4979 1 1 1 522.3032 1042.5918 2 1042.5923 -0.0006 0 56.13 2.40E-05 R AIAFLQQPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6010.6010.2.dta 139 1 IPI00013877.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein H3 56 36960 1 1 1 1 3985 4827 1 1 1 636.317 1270.6194 2 1270.6194 0 0 55.8 6.60E-06 R STGEAFVQFASK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5847.5847.2.dta 140 1 IPI00019380.1 Nuclear cap-binding protein subunit 1 56 92864 1 1 1 1 3824 6383 1 1 1 625.8346 1249.6546 2 1249.6554 -0.0008 0 55.5 2.90E-05 K ATNDEIFSILK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7485.7485.2.dta 141 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 56 77749 1 1 1 1 4072 2667 1 1 1 642.8173 1283.6201 2 1283.6219 -0.0018 0 55.5 6.20E-06 K QGGGGGGGSVPGIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3514.3514.2.dta 142 1 IPI00383645.2 CGI-151 protein 55 45490 1 1 1 1 4151 4716 1 1 1 647.3369 1292.6592 2 1292.6612 -0.0021 0 55.31 3.00E-05 R YAALSDQGLDIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5729.5729.2.dta 143 1 IPI00031982.1 Nck-associated protein 1 55 130018 1 1 1 1 3078 5614 1 1 1 574.3077 1146.6008 2 1146.6033 -0.0025 0 54.91 5.50E-05 K AAEDLFVNIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6685.6685.2.dta 144 1 IPI00247871.1 Transcription elongation regulator 1 55 124110 1 1 1 1 4825 5199 1 1 1 696.8445 1391.6745 2 1391.6755 -0.001 0 54.79 2.30E-05 R YLVLDCVPEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6244.6244.2.dta 145 1 IPI00743683.2 Rheumatoid factor RF-ET11 (Fragment) 53 10316 1 1 1 1 4079 3342 1 1 1 643.3401 1284.6656 2 1284.6674 -0.0018 0 53.2 1.40E-05 - ESGGGLVQPGGSLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4268.4268.2.dta 146 1 IPI00374732.4 similar to peptidylprolyl isomerase A isoform 1 52 24316 1 1 1 1 3794 4010 1 1 1 624.3176 1246.6206 2 1246.6227 -0.0021 1 52.5 8.30E-05 K KITIADCGQLE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4978.4978.2.dta 147 1 IPI00103994.4 "Leucyl-tRNA synthetase, cytoplasmic" 52 135577 2 2 2 2 2282 5358 1 1 1 515.2717 1028.5288 2 1028.5291 -0.0003 0 49.25 0.00027 R FDDPLLGPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6412.6412.2.dta 147 1 IPI00103994.4 "Leucyl-tRNA synthetase, cytoplasmic" 52 135577 2 2 2 2 2928 3787 1 1 1 565.259 1128.5035 2 1128.5022 0.0013 0 22.82 0.0072 K CEFAVGYQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4741.4741.2.dta 147 IPI00383290.1 HSPC192 23 18548 1 1 1 1 2928 3787 1 0 1 565.259 1128.5035 2 1128.5022 0.0013 0 22.82 0.0072 K CEFAVGYQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4741.4741.2.dta 148 1 IPI00552073.1 Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 51 119874 2 2 2 2 1102 1053 1 1 1 423.2187 844.4229 2 844.4225 0.0004 0 39.25 0.0034 K IACTQPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1783.1783.2.dta 148 1 IPI00552073.1 Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 51 119874 2 2 2 2 5161 6848 1 1 1 724.8458 1447.6771 2 1447.6772 -0.0002 0 33.16 0.00078 R FSTFFDDAPVFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7977.7977.2.dta 148 IPI00297178.6 DEAD/H (Asp-Glu-Ala-Asp/His) box polypeptide 16 39 119816 1 1 1 1 1102 1053 1 0 1 423.2187 844.4229 2 844.4225 0.0004 0 39.25 0.0034 K IACTQPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1783.1783.2.dta 148 IPI00644906.1 DEAH 33 64100 1 1 1 1 5161 6848 1 0 1 724.8458 1447.6771 2 1447.6772 -0.0002 0 33.16 0.00078 R FSTFFDDAPVFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7977.7977.2.dta 149 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 51 38581 1 1 1 1 5406 4768 1 1 1 744.882 1487.7495 2 1487.7508 -0.0013 0 50.75 6.20E-05 K IFVGGLSPDTPEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5784.5784.2.dta 150 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 51 71184 2 2 2 2 5227 6772 1 1 1 730.895 1459.7755 2 1459.777 -0.0015 0 51.1 8.60E-05 R NLATTVTEEILEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7900.7900.2.dta 150 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 51 71184 2 2 2 2 5956 7194 1 1 1 805.4026 1608.7907 2 1608.7923 -0.0015 0 17.91 0.021 R DLYEDELVPLFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8331.8331.2.dta 151 1 IPI00788818.1 16 kDa protein 49 15698 1 1 1 1 4433 6228 1 1 1 667.8692 1333.7239 2 1333.7241 -0.0003 0 48.91 0.0002 R AYSDQAIVNLLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7325.7325.2.dta 152 1 IPI00295857.6 Coatomer subunit alpha 48 139783 1 1 1 1 2474 4912 1 1 1 528.7717 1055.5289 2 1055.5288 0.0001 0 48.4 3.30E-05 K GFFEGTIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5938.5938.2.dta 153 1 IPI00017283.2 "Isoleucyl-tRNA synthetase, mitochondrial precursor" 48 114688 1 1 1 1 4877 2783 1 1 1 700.3099 1398.6053 2 1398.6085 -0.0032 0 48.13 9.80E-05 K YTAESSDTLCPR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3648.3648.2.dta 154 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 48 143771 2 2 2 2 937 5120 5 0 1 414.2711 826.5276 2 826.5276 -0.0001 0 20.89 0.034 K LVIDVIR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6160.6160.2.dta 154 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 48 143771 2 2 2 2 3341 5354 1 1 1 596.8315 1191.6484 2 1191.6499 -0.0015 0 43.91 7.60E-05 K TVALDGTLFQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6407.6407.2.dta 155 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 47 117803 2 2 2 2 3338 1728 1 1 1 596.7999 1191.5853 2 1191.5884 -0.0031 0 38.58 0.0026 R LQNSYQPTNK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2509.2509.2.dta 155 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 47 117803 2 2 2 2 7276 4615 1 1 1 635.6418 1903.9037 3 1903.9064 -0.0027 1 28.19 0.0023 R AGNKGYAYTFITEDQAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5621.5621.3.dta 156 1 IPI00010368.4 Kinesin-like protein KIF2A 47 78385 1 1 1 1 3682 6268 1 1 1 617.8246 1233.6347 2 1233.6353 -0.0006 0 46.69 0.00033 K FSLIDLAGNER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7368.7368.2.dta 157 1 IPI00027415.2 Isoform 1 of Probable ATP-dependent RNA helicase DHX36 46 115673 1 1 1 1 2743 6515 1 1 1 548.8104 1095.6063 2 1095.6077 -0.0014 0 46.23 5.60E-05 R LGGIAYFLSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7626.7626.2.dta 158 1 IPI00216271.4 Isoform A of Inositol polyphosphate 5-phosphatase OCRL-1 46 105763 1 1 1 1 3261 2833 1 1 1 589.7984 1177.5823 2 1177.584 -0.0017 0 46.07 9.90E-05 R GTNVNQLNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3706.3706.2.dta 159 1 IPI00013174.2 Isoform 1 of RNA-binding protein 14 46 69620 1 1 1 1 6866 4628 1 1 1 876.4404 1750.8663 2 1750.8672 -0.0009 0 45.51 5.40E-05 K IFVGNVSAACTSQELR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5635.5635.2.dta 160 1 IPI00182469.2 Isoform 1AB of Catenin delta-1 45 107853 1 1 1 1 5174 6363 1 1 1 725.3911 1448.7676 2 1448.7664 0.0012 0 44.94 0.00036 R GYELLFQPEVVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7465.7465.2.dta 161 1 IPI00010204.1 "Splicing factor, arginine/serine-rich 3" 45 19546 1 1 1 1 2376 5088 1 1 1 522.2689 1042.5233 2 1042.5236 -0.0003 0 44.82 0.00023 R AFGYYGPLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6126.6126.2.dta 162 1 IPI00171611.7 Histone H3.2 44 15436 1 1 1 1 959 4249 1 1 1 416.2504 830.4863 2 830.4861 0.0002 0 44.38 0.00067 K STELLIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5231.5231.2.dta 163 1 IPI00329352.3 Nodal modulator 1 precursor 44 135237 2 2 2 2 2842 1679 1 1 1 558.306 1114.5974 2 1114.5983 -0.0009 0 35.54 0.0019 K IQSTVTQPGGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2447.2447.2.dta 163 1 IPI00329352.3 Nodal modulator 1 precursor 44 135237 2 2 2 2 3306 3484 1 1 1 593.8052 1185.5958 2 1185.5989 -0.0031 0 26.17 0.0035 R EQQLAEIEAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4419.4419.2.dta 164 1 IPI00024364.2 Transportin 1 (Importin beta-)2 44 103771 1 1 1 1 4208 5285 1 1 1 651.3744 1300.7342 2 1300.735 -0.0008 0 43.76 0.00025 K TLLENTAITIGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6336.6336.2.dta 165 1 IPI00478521.4 FLJ39378 protein 42 47432 1 1 1 1 3393 5114 1 1 1 600.3244 1198.6343 2 1198.6306 0.0037 1 42.46 0.00098 R TSPQPESGIKR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6154.6154.2.dta 166 1 IPI00072534.2 Isoform 1 of UNC45 homolog A 42 104266 1 1 1 1 6076 6101 1 1 1 813.4588 1624.9031 2 1624.9036 -0.0005 0 42.19 0.00011 R ALIPLALEGTDVGQTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7195.7195.2.dta 167 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 42 38936 2 2 2 2 3557 5945 1 1 1 609.8225 1217.6305 2 1217.6326 -0.0021 0 27.26 0.02 K IEVIEIMTDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7036.7036.2.dta 167 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 42 38936 2 2 2 2 6086 3224 1 1 1 543.5988 1627.7746 3 1627.7743 0.0003 0 37.58 0.0018 R SSGPYGGGGQYFAKPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4142.4142.3.dta 167 IPI00796602.1 5 kDa protein 38 4511 1 1 1 1 6086 3224 1 0 1 543.5988 1627.7746 3 1627.7743 0.0003 0 37.58 0.0018 R SSGPYGGGGQYFAKPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4142.4142.3.dta 167 IPI00176692.7 similar to Heterogeneous nuclear ribonucleoprotein A1 27 32427 1 1 1 1 3557 5945 1 0 1 609.8225 1217.6305 2 1217.6326 -0.0021 0 27.26 0.02 K IEVIEIMTDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7036.7036.2.dta 168 1 IPI00162563.5 Isoform 1 of E3 ubiquitin-protein ligase BRE1B 42 114350 1 1 1 1 5594 5086 1 1 1 767.9134 1533.8122 2 1533.8151 -0.0029 0 41.66 0.00073 R EGPSLGPPPVASALSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6124.6124.2.dta 169 1 IPI00031023.1 Protein flightless-1 homolog 41 146142 2 2 2 2 243 8075 1 1 1 335.685 669.3554 2 669.3558 -0.0004 0 17.52 0.036 R HATVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.968.968.2.dta 169 1 IPI00031023.1 Protein flightless-1 homolog 41 146142 2 2 2 2 2849 6875 1 1 1 558.824 1115.6335 2 1115.6339 -0.0004 0 39.44 0.0002 K ADLTALFLPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8005.8005.2.dta 170 1 IPI00006715.3 Double-strand-break repair protein rad21 homolog 41 71930 1 1 1 1 5163 5834 1 1 1 724.8732 1447.7319 2 1447.7341 -0.0022 0 40.81 0.00017 K TGAESISLLELCR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6924.6924.2.dta 171 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 40 46353 1 1 1 1 2833 5806 1 1 1 557.8446 1113.6747 2 1113.6758 -0.0011 0 40.45 0.00057 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6894.6894.2.dta 172 1 IPI00012885.1 Isoform 1 of Focal adhesion kinase 1 40 119956 1 1 1 1 3116 6294 1 1 1 578.8199 1155.6252 2 1155.6248 0.0004 0 40.42 0.0018 K NLLDVIDQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7393.7393.2.dta 173 1 IPI00178667.4 183 kDa protein 40 184260 1 1 1 1 4441 6766 1 1 1 668.3809 1334.7473 2 1334.7486 -0.0013 0 40.03 0.00018 R FLEEFITPIVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7894.7894.2.dta 174 1 IPI00000015.2 "Splicing factor, arginine/serine-rich 4" 40 56759 1 1 1 1 2298 4058 1 1 1 515.7979 1029.5812 2 1029.5818 -0.0007 0 40 0.0014 R LIVENLSSR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5027.5027.2.dta 175 1 IPI00025815.1 TAR DNA-binding protein 43 40 45053 1 1 1 1 3053 2936 1 1 1 572.779 1143.5434 2 1143.5448 -0.0014 0 39.76 0.00048 R FTEYETQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3819.3819.2.dta 176 1 IPI00550069.3 Ribonuclease inhibitor 40 51766 1 1 1 1 3481 5308 1 1 1 605.3506 1208.6867 2 1208.6877 -0.0009 0 39.75 0.00019 R VNPALAELNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6359.6359.2.dta 177 1 IPI00028005.1 Nuclear pore complex protein Nup107 40 107048 1 1 1 1 3801 5060 1 1 1 624.8324 1247.6502 2 1247.651 -0.0008 0 39.6 0.0015 R SGFGEISSPVIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6096.6096.2.dta 178 1 IPI00215637.5 ATP-dependent RNA helicase DDX3X 40 73597 1 1 1 1 5562 6429 1 1 1 762.8934 1523.7722 2 1523.7732 -0.001 0 39.53 0.0002 R VGNLGLATSFFNER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7532.7532.2.dta 179 1 IPI00375731.1 Hypothetical protein DKFZp686E2459 39 110613 2 2 2 2 3386 4011 1 1 1 599.3331 1196.6516 2 1196.6513 0.0002 0 38.47 0.00025 R LDQQTLPLGGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4979.4979.2.dta 179 1 IPI00375731.1 Hypothetical protein DKFZp686E2459 39 110613 2 2 2 2 4290 4025 1 1 1 656.8642 1311.7138 2 1311.7147 -0.0008 0 15.4 0.043 K QGIVTPIEAQTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4993.4993.2.dta 180 1 IPI00028957.2 Isoform 2 of Ubiquitin conjugation factor E4 A 39 124526 1 1 1 1 4665 5214 1 1 1 685.3579 1368.7013 2 1368.7038 -0.0025 0 38.91 0.00022 R SYSPTLFAQTVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6260.6260.2.dta 181 1 IPI00018350.3 DNA replication licensing factor MCM5 39 83031 2 2 2 2 586 568 3 0 1 380.2269 758.4393 2 758.4399 -0.0006 1 37.52 0.0039 R KSQLQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1268.1268.2.dta 181 1 IPI00018350.3 DNA replication licensing factor MCM5 39 83031 2 2 2 2 4964 6299 1 1 1 708.9081 1415.8016 2 1415.8024 -0.0008 0 21.32 0.01 R LAALPNVYEVISK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7399.7399.2.dta 182 1 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 38 31328 1 1 1 1 5459 2016 1 1 1 750.3453 1498.6761 2 1498.6801 -0.0039 0 38.22 0.00026 K EVYQQQQYGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2815.2815.2.dta 183 1 IPI00167998.2 C1orf55 protein 38 50452 1 1 1 1 948 2445 1 1 1 415.2428 828.471 2 828.4705 0.0005 0 38.1 0.0028 R ALGAQIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3274.3274.2.dta 184 1 IPI00152881.5 Shroom-related protein 38 218321 1 1 1 1 1596 1589 1 1 1 466.7432 931.4719 2 931.4723 -0.0004 1 38.07 0.0042 R SSPATADKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2352.2352.2.dta 185 1 IPI00001639.2 Importin beta-1 subunit 38 98420 1 1 1 1 3591 2224 1 1 1 613.335 1224.6554 2 1224.6575 -0.0021 0 37.79 0.00087 R VLANPGNSQVAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3037.3037.2.dta 186 1 IPI00442073.5 Cysteine and glycine-rich protein 1 37 21409 1 1 1 1 5058 5370 1 1 1 717.3431 1432.6716 2 1432.6736 -0.0019 0 36.98 0.0029 K GFGFGQGAGALVHSE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6424.6424.2.dta 187 1 IPI00022215.1 Activity-dependent neuroprotector 37 124854 1 1 1 1 3075 1629 1 1 1 574.2877 1146.5609 2 1146.5629 -0.002 0 36.88 0.0019 K SPSLSQSQASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2395.2395.2.dta 188 1 IPI00022143.3 Isoform 1 of Protein FAM62A 37 123293 1 1 1 1 3020 4149 1 1 1 570.3425 1138.6705 2 1138.671 -0.0005 0 36.8 0.00035 K LLAETVAPAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5124.5124.2.dta 189 1 IPI00446354.1 "CDNA FLJ41805 fis, clone NOVAR2000962" 36 13792 1 1 1 1 1386 3732 1 1 1 450.2688 898.5231 2 898.5236 -0.0005 0 36.22 0.0031 R QSLVLSPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4683.4683.2.dta 190 1 IPI00303105.3 Small ubiquitin-related modifier 1 precursor 36 11607 1 1 1 1 1367 4790 1 1 1 448.7349 895.4552 2 895.4552 0 0 35.83 0.0053 R FLFEGQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5808.5808.2.dta 191 1 IPI00514381.1 HLA-B associated transcript 1 36 18565 1 1 1 1 2774 5994 1 1 1 552.3317 1102.6489 2 1102.6499 -0.001 0 35.83 0.00044 R ILVATNLFGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7087.7087.2.dta 192 1 IPI00023344.2 Isoform 1 of Symplekin 36 141915 1 1 1 1 2703 1595 1 1 1 545.2767 1088.5388 2 1088.5397 -0.0009 0 35.77 0.006 K AVACSGAAQVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2359.2359.2.dta 193 1 IPI00183526.5 NCL protein 35 51667 2 2 2 2 566 1664 1 1 1 378.7353 755.456 2 755.4541 0.0018 0 26.38 0.0089 K VAVATPAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2431.2431.2.dta 193 1 IPI00183526.5 NCL protein 35 51667 2 2 2 2 789 573 1 1 1 401.2451 800.4757 2 800.4756 0.0001 1 30.7 0.019 K AVTTPGKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1274.1274.2.dta 194 1 IPI00375441.2 Isoform 1 of Far upstream element-binding protein 1 35 67690 1 1 1 1 1600 826 1 1 1 467.2407 932.4669 2 932.4675 -0.0007 0 34.71 0.0074 K SISQQSGAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1543.1543.2.dta 195 1 IPI00011675.1 Isoform Sp100-HMG of Nuclear autoantigen Sp-100 34 101495 1 1 1 1 1497 1373 1 1 1 306.1682 915.4828 3 915.4814 0.0014 1 34.4 0.0038 K FKDPNAPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2122.2122.3.dta 196 1 IPI00299904.3 Isoform 1 of DNA replication licensing factor MCM7 34 81884 2 2 2 2 702 631 1 1 1 393.7395 785.4645 2 785.4647 -0.0002 0 25.45 0.0083 R VSEVKPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1337.1337.2.dta 196 1 IPI00299904.3 Isoform 1 of DNA replication licensing factor MCM7 34 81884 2 2 2 2 779 6036 1 1 1 400.2736 798.5326 2 798.5327 -0.0001 0 26.51 0.0095 R TLLAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7129.7129.2.dta 196 IPI00335085.5 Isoform 1 of E3 ubiquitin-protein ligase RNF123 27 149960 1 1 1 1 779 6036 1 0 1 400.2736 798.5326 2 798.5327 -0.0001 0 26.51 0.0095 R LTIAILR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7129.7129.2.dta 196 IPI00219740.3 Isoform 2 of DNA replication licensing factor MCM7 25 44963 1 1 1 1 702 631 1 0 1 393.7395 785.4645 2 785.4647 -0.0002 0 25.45 0.0083 R VSEVKPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1337.1337.2.dta 197 1 IPI00009790.1 6-phosphofructokinase type C 34 86454 1 1 1 1 3861 5633 1 1 1 629.3627 1256.7109 2 1256.7129 -0.0019 0 33.6 0.001 R NVIFQPVAELK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6705.6705.2.dta 198 1 IPI00038356.3 25 kDa protein 34 25641 1 1 1 1 583 1568 1 0 1 379.7425 757.4704 2 757.4698 0.0006 1 33.59 0.0095 R KAGLLEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2330.2330.2.dta 199 1 IPI00249982.4 Isoform 1 of Death-inducer obliterator 1 34 130526 1 1 1 1 3492 1647 1 1 1 606.3219 1210.6292 2 1210.6306 -0.0013 0 33.57 0.0016 R QAGPAPAAATAASK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2414.2414.2.dta 200 1 IPI00012066.2 poly(rC)-binding protein 2 isoform b 33 38597 1 1 1 1 4597 6114 1 1 1 679.9052 1357.7959 2 1357.7969 -0.001 0 33.35 0.002 R IITLAGPTNAIFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7209.7209.2.dta 201 1 IPI00016861.4 Isoform 1 of General transcription factor 3C polypeptide 2 33 103034 1 1 1 1 3538 5881 1 1 1 609.3309 1216.6472 2 1216.6485 -0.0014 0 33.24 0.0055 R LGLLALACSDGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6971.6971.2.dta 202 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 33 56784 1 1 1 1 1425 1268 1 1 1 453.2166 904.4186 2 904.4185 0.0001 0 33.21 0.0056 K GAQGISCGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2010.2010.2.dta 203 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 32 178843 3 3 3 3 2264 1843 1 1 1 514.2617 1026.5088 2 1026.5094 -0.0007 0 22.55 0.042 R HGVESTLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2631.2631.2.dta 203 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 32 178843 3 3 3 3 7367 3680 1 1 1 640.6561 1918.9464 3 1918.9497 -0.0033 1 24.76 0.011 R FSALQQAVPTESTDNRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4626.4626.3.dta 203 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 32 178843 3 3 3 3 7465 4097 1 1 1 658.0118 1971.0135 3 1971.0174 -0.0039 0 19.72 0.014 K ITKPGSIDSNNQLFAPGGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5069.5069.3.dta 203 IPI00791833.1 24 kDa protein 25 24098 1 1 1 1 7367 3680 1 0 1 640.6561 1918.9464 3 1918.9497 -0.0033 1 24.76 0.011 R FSALQQAVPTESTDNRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4626.4626.3.dta 203 IPI00442069.1 Isoform 2 of Eukaryotic translation initiation factor 4 gamma 1 23 50243 1 1 1 1 2264 1843 1 0 1 514.2617 1026.5088 2 1026.5094 -0.0007 0 22.55 0.042 R HGVESTLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2631.2631.2.dta 204 1 IPI00387100.1 Ig kappa chain V-I region Roy 32 11889 1 1 1 1 1521 4379 1 1 1 461.765 921.5155 2 921.5171 -0.0016 0 32.32 0.0069 K LLIYDASK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5371.5371.2.dta 205 1 IPI00000105.4 Major vault protein 32 99551 1 1 1 1 5201 6319 1 1 1 727.8533 1453.692 2 1453.6912 0.0008 0 32.26 0.001 K LFSVPDFVGDACK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7419.7419.2.dta 206 1 IPI00169383.3 Phosphoglycerate kinase 1 32 44985 1 1 1 1 2746 6692 1 1 1 549.313 1096.6115 2 1096.6128 -0.0013 0 32 0.001 K VLPGVDALSNI - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7815.7815.2.dta 207 1 IPI00001890.8 98 kDa protein 32 99635 2 2 2 2 3227 5154 1 1 1 586.8284 1171.6422 2 1171.6448 -0.0027 0 20.54 0.018 K TLEEAVGNIVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6196.6196.2.dta 207 1 IPI00001890.8 98 kDa protein 32 99635 2 2 2 2 3307 3712 1 1 1 593.8137 1185.6129 2 1185.6142 -0.0013 0 28.18 0.0049 R VFNETPINPR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4661.4661.2.dta 207 IPI00794911.1 12 kDa protein 21 11975 1 1 1 1 3227 5154 1 0 1 586.8284 1171.6422 2 1171.6448 -0.0027 0 20.54 0.018 K TLEEAVGNIVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6196.6196.2.dta 208 1 IPI00016610.2 Poly(rC)-binding protein 1 31 37987 1 1 1 1 2177 2735 1 1 1 507.7695 1013.5245 2 1013.5254 -0.0009 0 31.36 0.0065 R QGANINEIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3595.3595.2.dta 209 1 IPI00296909.3 Poly [ADP-ribose] polymerase 4 31 194633 1 1 1 1 3233 7077 1 1 1 587.3341 1172.6537 2 1172.6554 -0.0017 0 30.86 0.012 K SPVDVLQIFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8210.8210.2.dta 210 1 IPI00216654.1 Isoform Beta of Nucleolar phosphoprotein p130 31 74819 1 1 1 1 3072 647 1 1 1 573.8086 1145.6026 2 1145.604 -0.0014 0 30.8 0.0045 K NSSNKPAVTTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1354.1354.2.dta 211 1 IPI00216662.5 "Isoform 3 of Transmembrane protease, serine 6" 31 89570 1 1 1 1 2004 5551 1 1 1 495.2783 988.542 2 988.5341 0.0079 0 30.56 0.018 R ILQPYAER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6618.6618.2.dta 212 1 IPI00017451.1 Splicing factor 3 subunit 1 30 88888 1 1 1 1 1321 2129 1 1 1 440.7422 879.4699 2 879.4702 -0.0002 0 30.48 0.0014 K LVEQYTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2936.2936.2.dta 213 1 IPI00003421.3 T-brain-1 protein 30 74520 1 1 1 1 4074 7260 1 1 1 642.8602 1283.7058 2 1283.7085 -0.0027 0 30.12 0.0069 K LSPVLDGVSELR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8404.8404.2.dta 214 1 IPI00013891.1 Isoform Long of Transformer-2 protein homolog 30 32726 1 1 1 1 1586 1606 1 1 1 466.2094 930.4043 2 930.3978 0.0066 0 29.98 0.0037 R SHSPMSNR R Oxidation (M) 0.00001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2371.2371.2.dta 215 1 IPI00010810.1 "Electron transfer flavoprotein subunit alpha, mitochondrial precursor" 30 35400 1 1 1 1 264 1004 1 0 1 337.2035 672.3924 2 672.3919 0.0005 0 29.74 0.0033 K VVVSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1732.1732.2.dta 216 1 IPI00024425.4 Putative eukaryotic translation initiation factor 3 subunit 30 148003 1 1 1 1 1619 5399 1 1 1 468.2633 934.512 2 934.5123 -0.0004 0 29.6 0.0043 R YLELLER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6455.6455.2.dta 217 1 IPI00166646.2 Isoform 1 of Junctophilin-3 29 81818 1 1 1 1 359 1946 1 1 1 350.1939 698.3732 2 698.3711 0.0021 0 29.45 0.016 R LGGAEPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2741.2741.2.dta 218 1 IPI00297333.4 TBC1D24 protein 29 64019 1 1 1 1 8258 2914 1 1 1 844.3941 3373.5473 4 3373.549 -0.0016 1 29.23 0.0028 K TESMFMAGGSDCLIVGGGGGQALYIDGDLNRGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3795.3795.4.dta 219 1 IPI00061229.1 "OMA1 homolog, zinc metallopeptidase" 29 60766 1 1 1 1 3404 1546 1 1 1 401.2273 1200.66 3 1200.6536 0.0063 1 29.22 0.025 K QKMDTLPIQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2307.2307.3.dta 220 1 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 29 87804 1 1 1 1 3563 6691 1 1 1 610.855 1219.6955 2 1219.6965 -0.001 0 29.19 0.0046 R GVTFLFPIQAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7814.7814.2.dta 221 1 IPI00419440.2 podocan 29 74324 1 1 1 1 2189 3882 1 1 1 508.285 1014.5555 2 1014.5644 -0.0089 0 29.16 0.034 R GALVGMAQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4842.4842.2.dta 222 1 IPI00373968.5 IMP dehydrogenase/GMP reductase family protein 29 70998 1 1 1 1 2847 2397 1 1 1 558.785 1115.5554 2 1115.5571 -0.0017 0 29.1 0.023 R GSQLEDQALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3222.3222.2.dta 223 1 IPI00006025.1 Isoform 1 of Squamous cell carcinoma antigen recognized by T-cells 3 29 110721 2 2 2 2 3092 6103 1 1 1 575.7814 1149.5483 2 1149.5488 -0.0005 0 18.82 0.03 R ELWDSIMTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7197.7197.2.dta 223 1 IPI00006025.1 Isoform 1 of Squamous cell carcinoma antigen recognized by T-cells 3 29 110721 2 2 2 2 3213 4256 1 1 1 391.2398 1170.6977 3 1170.6972 0.0005 1 25.14 0.0044 R LLRLEGELTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5238.5238.3.dta 223 IPI00719256.1 Isoform 2 of Squamous cell carcinoma antigen recognized by T-cells 3 25 42031 1 1 1 1 3213 4256 1 0 1 391.2398 1170.6977 3 1170.6972 0.0005 1 25.14 0.0044 R LLRLEGELTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5238.5238.3.dta 223 IPI00790281.1 38 kDa protein 19 38857 1 1 1 1 3092 6103 1 0 1 575.7814 1149.5483 2 1149.5488 -0.0005 0 18.82 0.03 R ELWDSIMTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7197.7197.2.dta 224 1 IPI00026338.3 Isoform 3 of Zinc finger FYVE domain-containing protein 9 29 85492 1 1 1 1 2252 2843 1 1 1 513.2277 1024.4408 2 1024.4443 -0.0036 1 28.58 0.0021 R HHCRACGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3717.3717.2.dta 225 1 IPI00465224.2 Ret finger protein-like 1 28 36380 1 1 1 1 6237 4965 1 1 1 824.4005 1646.7864 2 1646.7794 0.0069 1 28.43 0.031 R SGCITQNRQDLAER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5995.5995.2.dta 226 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 28 57356 1 1 1 1 1975 7517 1 1 1 493.8054 985.5962 2 985.596 0.0002 0 27.91 0.0024 R DLPLLLFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8722.8722.2.dta 227 1 IPI00293845.4 275 kDa protein 28 276688 1 1 1 1 3533 2361 1 1 1 609.2981 1216.5816 2 1216.5836 -0.002 0 27.91 0.0024 K GASSPYGAPGTPR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3183.3183.2.dta 228 1 IPI00183169.5 ACF7 protein 28 453051 1 1 1 1 2931 4860 1 1 1 565.2986 1128.5826 2 1128.5775 0.0051 0 27.88 0.039 R VDEIDAAIQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5883.5883.2.dta 229 1 IPI00029175.5 Uncharacterized protein KIAA0196 28 135113 1 1 1 1 2665 1076 1 1 1 541.7591 1081.5036 2 1081.504 -0.0004 0 27.87 0.0043 R STGYSSQPGAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1807.1807.2.dta 230 1 IPI00021187.4 Isoform 1 of RuvB-like 1 28 50538 1 1 1 1 1316 7653 1 1 1 439.7459 877.4773 2 877.477 0.0003 0 27.86 0.026 R IASHSHVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.891.891.2.dta 231 1 IPI00444592.1 Isoform 1 of Trafficking kinesin-binding protein 1 28 106943 1 1 1 1 582 4087 1 1 1 379.7422 757.4699 2 757.4698 0.0002 0 27.77 0.036 R IGQSLLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5058.5058.2.dta 232 1 IPI00004534.3 Phosphoribosylformylglycinamidine synthase 28 146226 1 1 1 1 527 2077 1 1 1 374.2112 746.4078 2 746.4075 0.0003 0 27.59 0.014 K VGGPVYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2880.2880.2.dta 233 1 IPI00013290.5 hepatoma-derived growth factor-related protein 2 isoform 1 27 74943 1 1 1 1 830 1648 1 1 1 405.2111 808.4077 2 808.4079 -0.0002 0 27.48 0.036 K AAEVYTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2415.2415.2.dta 234 1 IPI00022304.4 Orphan sodium- and chloride-dependent neurotransmitter transporter NTT5 27 83172 1 1 1 1 1312 575 1 1 1 439.7106 877.4067 2 877.4116 -0.0049 0 27.36 0.029 R QGGMGVWK I Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1276.1276.2.dta 235 1 IPI00152653.3 Ciliary dynein heavy chain 5 27 532504 1 1 1 1 2368 4022 1 1 1 521.7825 1041.5505 2 1041.5454 0.0051 0 27.06 0.016 R SPQEAEILR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4990.4990.2.dta 236 1 IPI00386765.2 "Isoform 7 of cAMP-specific 3~,5~-cyclic phosphodiesterase 4D" 27 23995 1 1 1 1 1226 5178 1 1 1 434.7663 867.5181 2 867.5178 0.0003 0 26.91 0.004 K LSPVISPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6222.6222.2.dta 237 1 IPI00013196.2 hepatocyte nuclear factor 4 alpha isoform b 27 53492 1 1 1 1 1484 912 1 1 1 305.5151 913.5235 3 913.5233 0.0002 1 26.88 0.018 K GLSDPGKIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1634.1634.3.dta 238 1 IPI00170596.1 Paired amphipathic helix protein Sin3a 27 145883 1 1 1 1 3616 3111 1 1 1 615.3255 1228.6364 2 1228.6411 -0.0047 1 26.65 0.021 R DKSDSPAIQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4016.4016.2.dta 239 1 IPI00465050.2 Isoform C of Lethal(2) giant larvae protein homolog 2 27 114347 1 1 1 1 797 2403 1 1 1 402.2178 802.4211 2 802.4185 0.0026 0 26.55 0.0052 R ALLSDER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3228.3228.2.dta 240 1 IPI00027808.1 DNA-directed RNA polymerase II 140 kDa polypeptide 26 135236 2 2 2 2 2098 3503 1 1 1 501.777 1001.5395 2 1001.5393 0.0001 0 24.93 0.018 R VSGDDVIIGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4439.4439.2.dta 240 1 IPI00027808.1 DNA-directed RNA polymerase II 140 kDa polypeptide 26 135236 2 2 2 2 5913 5872 1 1 1 799.4262 1596.8379 2 1596.8399 -0.002 0 18.42 0.019 R NLTYSAPLYVDITK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6962.6962.2.dta 241 1 IPI00184777.2 "MOB1, Mps One Binder kinase activator-like 2C isoform 1" 26 32047 1 1 1 1 989 1318 1 1 1 418.237 834.4595 2 834.4599 -0.0004 1 26.27 0.044 K QVFAKDK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2064.2064.2.dta 242 1 IPI00745628.1 hypothetical protein 26 38367 1 1 1 1 4300 3583 1 1 1 657.8091 1313.6036 2 1313.5921 0.0115 0 26.18 0.026 K GMEEIYNLSSR K Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4524.4524.2.dta 243 1 IPI00148061.3 L-lactate dehydrogenase A-like 6A 26 36826 1 1 1 1 3798 2708 1 1 1 624.8029 1247.5913 2 1247.5928 -0.0016 0 25.78 0.0038 R VIGSGCNLDSAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3566.3566.2.dta 244 1 IPI00029778.3 Isoform 1 of Tumor suppressor p53-binding protein 1 26 215495 1 1 1 1 4490 5630 1 1 1 672.8522 1343.6899 2 1343.6932 -0.0033 0 25.53 0.004 K AADISLDNLVEGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6702.6702.2.dta 245 1 IPI00295851.4 Coatomer subunit beta 25 108214 2 2 2 2 693 751 1 1 1 393.1896 784.3647 2 784.365 -0.0003 0 24.32 0.035 R ACLEHR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1463.1463.2.dta 245 1 IPI00295851.4 Coatomer subunit beta 25 108214 2 2 2 2 5380 6725 1 1 1 741.405 1480.7955 2 1480.7959 -0.0004 0 19.5 0.02 K EAELLEPLMPAIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7850.7850.2.dta 246 1 IPI00294891.3 Proliferating-cell nucleolar antigen p120 25 94705 1 1 1 1 2261 5723 1 1 1 513.8188 1025.623 2 1025.6233 -0.0003 0 25.19 0.011 R IQDIVGILR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6801.6801.2.dta 247 1 IPI00296340.1 Jumonji domain containing 5 25 47867 1 1 1 1 1080 4084 1 1 1 421.7585 841.5025 2 841.5021 0.0003 1 25.14 0.028 K LEKTVPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5055.5055.2.dta 248 1 IPI00008455.1 Isoform 2 of Myosin-VI 25 147324 3 3 1 1 837 1341 1 1 1 405.7502 809.4859 2 809.4872 -0.0012 1 20.71 0.042 K SKLAVHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2089.2089.2.dta 248 1 IPI00008455.1 Isoform 2 of Myosin-VI 25 147324 3 3 1 1 838 1201 1 1 1 405.7507 809.4868 2 809.4872 -0.0004 1 22.03 0.031 K SKLAVHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1941.1941.2.dta 248 1 IPI00008455.1 Isoform 2 of Myosin-VI 25 147324 3 3 1 1 840 1945 1 1 1 405.751 809.4875 2 809.4872 0.0004 1 20.3 0.046 K SKLAVHR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2740.2740.2.dta 249 1 IPI00219018.7 Glyceraldehyde-3-phosphate dehydrogenase 25 36201 1 1 1 1 4943 4818 1 1 1 706.398 1410.7815 2 1410.7831 -0.0016 0 24.99 0.0052 R GALQNIIPASTGAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5838.5838.2.dta 250 1 IPI00306689.5 Glutamine-dependent NAD 25 80554 1 1 1 1 2551 4704 1 1 1 534.7756 1067.5366 2 1067.5359 0.0007 1 24.73 0.036 R SYRAEISSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5716.5716.2.dta 251 1 IPI00374218.7 hypothetical protein 25 193315 1 1 1 1 1726 927 1 1 1 475.7343 949.454 2 949.448 0.006 0 24.66 0.01 R ISAWCWK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1650.1650.2.dta 252 1 IPI00647031.1 Protein 25 19393 1 1 1 1 4038 801 1 1 1 639.3073 1276.6 2 1276.5904 0.0096 0 24.59 0.048 R AMTSHINICSK L Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1516.1516.2.dta 253 1 IPI00301263.2 CAD protein 24 245167 1 1 1 1 3615 6552 1 1 1 614.8657 1227.7168 2 1227.7187 -0.0019 0 24.4 0.031 K TLGVDLVALATR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7662.7662.2.dta 254 1 IPI00013871.1 Ribonucleoside-diphosphate reductase large subunit 24 90925 1 1 1 1 998 814 1 1 1 419.2142 836.4139 2 836.414 -0.0002 0 24.32 0.025 R VYNNTAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1530.1530.2.dta 255 1 IPI00103784.1 GL013 24 15378 1 1 1 1 656 1746 1 1 1 387.7451 773.4757 2 773.4759 -0.0002 1 24.12 0.027 R ARLSLSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2528.2528.2.dta 256 1 IPI00009104.7 RuvB-like 2 24 51296 1 1 1 1 3113 5156 1 1 1 578.3029 1154.5912 2 1154.5931 -0.002 0 24.09 0.041 R GLGLDDALEPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6198.6198.2.dta 257 1 IPI00031765.1 Isoform 2 of Protocadherin gamma C4 precursor 24 95330 1 1 1 1 5742 3226 1 1 1 785.3665 1568.7185 2 1568.7067 0.0118 0 23.96 0.0057 K AQDADVGSNSISSYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4144.4144.2.dta 258 1 IPI00002483.4 Zinc transporter 1 24 56318 1 1 1 1 4033 5536 1 1 1 639.2979 1276.5813 2 1276.5904 -0.0091 0 23.89 0.037 K SSVVPCELACR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6602.6602.2.dta 259 1 IPI00031662.3 Isoform 2 of Transient receptor potential cation channel subfamily M member 8 24 22011 1 1 1 1 1623 4125 1 1 1 468.2816 934.5486 2 934.5487 -0.0001 0 23.81 0.022 R LIYIAQSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5099.5099.2.dta 260 1 IPI00003515.1 Thyroid receptor-interacting protein 11 23 228184 1 1 1 1 2312 6380 1 1 1 516.8079 1031.6012 2 1031.6015 -0.0003 0 22.81 0.031 K ALAFEQLLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7482.7482.2.dta 261 1 IPI00289926.7 Isoform 1 of Leukocyte immunoglobulin-like receptor subfamily B member 4 precursor 23 49609 1 1 1 1 918 1939 1 1 1 413.2268 824.439 2 824.4392 -0.0002 0 22.67 0.018 R QNPLEPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2733.2733.2.dta 262 1 IPI00457284.2 G patch domain containing 8 23 165010 1 1 1 1 1505 917 1 1 1 460.2092 918.4038 2 918.4043 -0.0004 0 22.66 0.027 K SSAPADSER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1639.1639.2.dta 263 1 IPI00013467.4 123 kDa protein 23 123602 1 1 1 1 1571 1169 1 1 1 310.4935 928.4588 3 928.4515 0.0073 1 22.56 0.028 K KYHNDPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1907.1907.3.dta 264 1 IPI00427501.1 Isoform 1 of GH3 domain-containing protein precursor 22 58058 1 1 1 1 900 2364 1 1 1 411.7464 821.4782 2 821.4759 0.0023 0 22.42 0.029 R NHLPLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3187.3187.2.dta 265 1 IPI00221235.3 nucleoporin 160kDa 22 164355 1 1 1 1 3107 3038 1 1 1 577.7783 1153.5421 2 1153.5438 -0.0017 0 21.94 0.0088 R CYLVTGEGQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3935.3935.2.dta 266 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 22 112355 3 3 1 1 3422 5434 1 1 1 601.8108 1201.607 2 1201.6125 -0.0055 0 15.95 0.039 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6492.6492.2.dta 266 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 22 112355 3 3 1 1 3435 7876 1 1 1 601.8115 1201.6084 2 1201.6125 -0.0041 0 16.06 0.044 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.9282.9282.2.dta 266 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 22 112355 3 3 1 1 3445 5842 1 1 1 601.8116 1201.6087 2 1201.6125 -0.0038 0 21.82 0.031 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6933.6933.2.dta 267 1 IPI00220834.8 ATP-dependent DNA helicase 2 subunit 2 22 83222 1 1 1 1 2852 5821 1 1 1 559.2617 1116.5089 2 1116.5096 -0.0008 0 21.64 0.03 K CFSVLGFCK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6910.6910.2.dta 268 1 IPI00375138.3 similar to Nuclear protein 1 22 20591 1 1 1 1 4615 6705 1 1 1 681.3475 1360.6805 2 1360.6695 0.011 1 21.6 0.035 K DQRATTATSPGTR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7829.7829.2.dta 269 1 IPI00339379.3 Isoform 2 of Rho guanine nucleotide exchange factor 1 21 99277 1 1 1 1 1752 4883 1 1 1 477.295 952.5755 2 952.5818 -0.0063 1 21.02 0.04 R LLLKSHSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5907.5907.2.dta 270 1 IPI00030320.4 Probable ATP-dependent RNA helicase DDX6 21 54781 1 1 1 1 3632 6697 1 1 1 616.3549 1230.6953 2 1230.6972 -0.0019 0 21.01 0.011 K SGAYLIPLLER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7820.7820.2.dta 271 1 IPI00170786.1 WW domain-binding protein 11 21 69954 1 1 1 1 4216 6805 1 1 1 651.8478 1301.681 2 1301.6835 -0.0025 0 20.9 0.011 K ELTPLQAMMLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7933.7933.2.dta 272 1 IPI00017580.1 HsKin17 protein 21 45745 1 1 1 1 676 1206 1 1 1 391.1763 780.3381 2 780.3324 0.0057 0 20.89 0.012 K MIDSGDK L Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1946.1946.2.dta 273 1 IPI00000156.3 "ligase III, DNA, ATP-dependent isoform beta precursor" 21 107319 1 1 1 1 2955 5999 1 1 1 567.319 1132.6234 2 1132.6241 -0.0007 0 20.87 0.011 K TQIIQDFLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7091.7091.2.dta 274 1 IPI00168710.4 Hypothetical short protein 21 5320 1 1 1 1 5222 3333 1 0 1 730.3519 1458.6893 2 1458.695 -0.0057 1 20.72 0.011 K KEDATDSSAVPPSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4258.4258.2.dta 275 1 IPI00217626.5 RNA binding motif protein 12B 21 102984 1 1 1 1 2408 5936 1 1 1 524.3132 1046.6118 2 1046.6124 -0.0006 0 20.7 0.029 R FLGTEVLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7027.7027.2.dta 276 1 IPI00514394.2 Family with sequence similarity 120A opposite strand 21 17159 1 1 1 1 3906 4296 1 1 1 630.803 1259.5914 2 1259.5816 0.0098 0 20.62 0.046 K HTIMSEGTGSPK R Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5281.5281.2.dta 277 1 IPI00045302.1 Isoform 3 of Bile acid receptor 21 55681 1 1 1 1 2292 561 1 1 1 344.1888 1029.5447 3 1029.5502 -0.0055 1 20.58 0.026 K KPRMGASAGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1261.1261.3.dta 278 1 IPI00303063.7 SCC-112 protein 20 152274 1 1 1 1 5580 7008 1 1 1 765.4199 1528.8252 2 1528.8249 0.0003 0 20.37 0.012 K EVQLAQIFEPLSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8138.8138.2.dta 279 1 IPI00001661.3 regulator of chromosome condensation 1 isoform a 20 48685 1 1 1 1 1360 3142 1 1 1 448.2521 894.4897 2 894.4811 0.0086 0 20.25 0.049 R SPPADAIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4050.4050.2.dta 280 1 IPI00000846.1 Isoform 1 of Chromodomain helicase-DNA-binding protein 4 20 219393 1 1 1 1 5684 1401 1 1 1 518.574 1552.7001 3 1552.7018 -0.0017 0 19.87 0.014 R HHYEQQQEDLAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2152.2152.3.dta 281 1 IPI00024975.2 Kinesin-like protein KIF15 20 161030 1 1 1 1 5130 6583 1 1 1 721.8948 1441.775 2 1441.7776 -0.0026 0 19.63 0.014 K ANLNLENLLEATK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7693.7693.2.dta 282 1 IPI00293331.3 Ribonucleases P/MRP protein subunit POP1 19 116346 1 1 1 1 3609 4257 1 1 1 614.8195 1227.6245 2 1227.6248 -0.0003 0 19.35 0.015 K YITASTFAQAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5239.5239.2.dta 283 1 IPI00032491.1 Inner nuclear membrane protein Man1 19 100790 1 1 1 1 2954 6613 1 1 1 567.3081 1132.6017 2 1132.6029 -0.0013 0 19.25 0.026 R IGGADFLVWR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7727.7727.2.dta 284 1 IPI00643920.2 Transketolase 19 68519 1 1 1 1 1935 1955 1 1 1 489.7901 977.5656 2 977.5658 -0.0002 0 18.96 0.017 K HQPTAIIAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2750.2750.2.dta 285 1 IPI00006176.3 Hepatocyte growth factor-regulated tyrosine kinase substrate 19 86708 1 1 1 1 5272 3378 1 1 1 734.3198 1466.6251 2 1466.6282 -0.0031 0 18.76 0.035 R VCEPCYEQLNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4306.4306.2.dta 286 1 IPI00306290.4 110 kDa protein 19 111246 1 1 1 1 2667 5406 1 1 1 541.7981 1081.5816 2 1081.5808 0.0009 0 18.74 0.017 R ALAYFEQLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6463.6463.2.dta 287 1 IPI00747357.1 8 kDa protein 19 7968 1 1 1 1 4474 5098 1 1 1 671.8884 1341.7622 2 1341.7504 0.0118 0 18.54 0.023 K SSTPTSSLKPPLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6136.6136.2.dta 288 1 IPI00029184.1 Hyaluronan and proteoglycan link protein 2 precursor 18 38378 1 1 1 1 2263 3561 1 1 1 514.2529 1026.4912 2 1026.4917 -0.0005 0 18.38 0.023 R CGGLPDPGVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4500.4500.2.dta 289 1 IPI00011569.2 Acetyl-CoA carboxylase 1 18 267095 1 1 1 1 5895 7081 1 1 1 796.4249 1590.8352 2 1590.8406 -0.0054 0 18.2 0.02 R IGSFGPQEDLLFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8214.8214.2.dta 290 1 IPI00020258.3 Mitogen-activated protein kinase kinase kinase kinase 1 18 92265 1 1 1 1 6864 5176 1 1 1 876.418 1750.8215 2 1750.8117 0.0098 1 18.1 0.02 K MVKMEPDDDVSTLQK E Oxidation (M) 0.000100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6220.6220.2.dta 291 1 IPI00026969.4 Isoform 1 of SEC23-interacting protein 18 111691 1 1 1 1 1301 77 1 1 1 438.7609 875.5073 2 875.5076 -0.0003 1 18.09 0.024 K KAVAATSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1010.1010.2.dta 292 1 IPI00470710.1 Seven transmembrane helix receptor 18 25285 1 1 1 1 2213 2368 1 1 1 510.2596 1018.5046 2 1018.5117 -0.0071 0 18.07 0.04 R NSEMINAIK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3191.3191.2.dta 293 1 IPI00300078.6 Periodic tryptophan protein 2 homolog 18 103357 2 2 2 2 3584 4661 1 1 1 612.85 1223.6855 2 1223.6874 -0.0018 0 17.3 0.046 K LVQEALEAVPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5670.5670.2.dta 293 1 IPI00300078.6 Periodic tryptophan protein 2 homolog 18 103357 2 2 2 2 6976 7331 1 1 1 896.957 1791.8995 2 1791.9043 -0.0048 0 15.62 0.036 R VLFDPFELDTSVTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8487.8487.2.dta 294 1 IPI00000874.1 Peroxiredoxin-1 18 22324 1 1 1 1 3495 4582 1 1 1 606.3397 1210.6648 2 1210.667 -0.0022 0 17.71 0.022 R QITVNDLPVGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5586.5586.2.dta 295 1 IPI00376229.1 Isoform 1 of Phosphofurin acidic cluster sorting protein 1 18 105233 1 1 1 1 3852 633 1 1 1 628.7892 1255.5638 2 1255.5654 -0.0016 0 17.71 0.022 R GGAGGGPGGAGGGSGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1339.1339.2.dta 296 1 IPI00163644.2 Oxysterol-binding protein 18 101862 1 1 1 1 4070 6944 1 1 1 642.3898 1282.765 2 1282.7649 0.0001 0 17.56 0.023 K VVLPTFILEPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8075.8075.2.dta 297 1 IPI00022184.1 Isoform 3 of Pumilio homolog 2 18 114503 1 1 1 1 2622 2235 1 1 1 539.2817 1076.5488 2 1076.5502 -0.0014 0 17.54 0.05 R YISAAPGAEAK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3049.3049.2.dta 298 1 IPI00027280.2 Isoform Beta-2 of DNA topoisomerase 2-beta 17 184122 1 1 1 1 4592 6790 1 1 1 679.3884 1356.7623 2 1356.7653 -0.003 0 17.39 0.023 R LLFPAVDDNLLK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7919.7919.2.dta 299 1 IPI00182491.8 Metalloproteinase 17 20497 1 1 1 1 4406 6547 1 1 1 664.8553 1327.6961 2 1327.703 -0.0069 1 17.19 0.038 M DPGTVATMRKPR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7657.7657.2.dta 300 1 IPI00156374.6 Isoform 1 of Importin-4 17 120179 1 1 1 1 4250 7092 1 1 1 653.3774 1304.7402 2 1304.7414 -0.0012 0 17.01 0.025 R EVMPLLLAYLK S Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.8225.8225.2.dta 301 1 IPI00168081.4 57 kDa protein 17 57794 1 1 1 1 8211 2696 1 1 1 793.1263 3168.4763 4 3168.479 -0.0028 1 16.99 0.03 K MREAALNNQPMQVMAEPSNEPSPALFHK K 2 Oxidation (M) 0.1000000000000100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3550.3550.4.dta 302 1 IPI00011694.1 Trypsin-1 precursor 17 27111 1 1 1 1 7692 5246 1 1 1 742.3737 2224.0993 3 2224.1124 -0.013 0 16.95 0.026 R LGEHNIEVLEGNEQFINAAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.6294.6294.3.dta 303 1 IPI00001722.1 Endonuclease III-like protein 1 16 34767 1 1 1 1 2608 1397 1 1 1 538.7596 1075.5046 2 1075.508 -0.0034 0 16.41 0.03 K DQVTAGAMQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.2148.2148.2.dta 304 1 IPI00021417.3 U4/U6.U5 tri-snRNP-associated protein 1 16 90371 1 1 1 1 3109 3860 1 1 1 577.8326 1153.6506 2 1153.6567 -0.0061 0 15.95 0.032 R QLQQLQQLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4819.4819.2.dta 305 1 IPI00062264.4 Isoform 4 of N-terminal kinase-like protein 16 86885 1 1 1 1 5687 6595 1 1 1 777.4333 1552.8521 2 1552.8535 -0.0013 0 15.89 0.032 K ILPVLCGLTVDPEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7706.7706.2.dta 306 1 IPI00740715.1 similar to breast cancer anti-estrogen resistance 1 16 43949 1 1 1 1 865 1017 1 1 1 408.2243 814.4341 2 814.4409 -0.0068 1 15.87 0.039 M AEAAAARR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.1746.1746.2.dta 307 1 IPI00294221.2 Fc gamma receptor I 15 22293 1 1 1 1 4330 6014 1 1 1 659.3393 1316.664 2 1316.6612 0.0028 0 15.19 0.038 R YTSAGISQYTVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.7105.7105.2.dta 308 1 IPI00044761.4 Pseudouridylate synthase 7 homolog 15 75330 1 1 1 1 4863 4194 1 1 1 698.8629 1395.7113 2 1395.7147 -0.0034 0 15 0.039 R FGTTAVPTYQVGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.5172.5172.2.dta 309 1 IPI00735811.2 "similar to melanoma antigen family B, 6" 14 47185 1 1 1 1 6220 2845 1 1 1 548.9481 1643.8225 3 1643.8366 -0.0141 0 14.49 0.044 K LGLSSEGSLSGDNALPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.3719.3719.3.dta 310 1 IPI00033019.2 Potassium voltage-gated channel subfamily B member 1 14 96672 1 1 1 1 6427 3617 1 1 1 836.8879 1671.7612 2 1671.7709 -0.0097 1 14.09 0.048 R NGSIVSMNMKDAFAR S 2 Oxidation (M) 0.000000101000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-2.4560.4560.2.dta