Header -------------------------------------------------------- Search title orb_160916_AE-MF-2_#3-5.raw Timestamp 2016-09-21T07:42:19Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/2016/20160921/F073862.dat Peak list data path D:\data\oda\160916_AE-MF-2\orb_160916_AE-MF-2_#3-5.raw Peak list format Mascot generic Search type MIS Mascot version 2.5.1 Database ipi_HUM_NEW Fasta file ipi_HUM_NEW_3.26.fasta Total sequences 67667 Total residues 28462731 Sequences after taxonomy filter 67667 Number of queries 8727 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter All entries Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 121 6868 1 1 1 335.6668 669.319 2 669.3194 -0.0004 0 27.92 0.019 R HGDSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.775.775.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 330 1507 1 1 1 379.7307 757.4468 2 757.4446 0.0022 1 37.81 0.0052 R RVDQLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1543.1543.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 1261 3018 1 1 1 500.226 998.4375 2 998.4379 -0.0004 0 38.7 0.00085 K DVDGAYMTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3212.3212.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 1422 3286 1 1 1 517.2617 1032.5089 2 1032.5087 0.0002 0 31.96 0.001 R TLLEGEESR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3527.3527.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 1679 1392 1 1 1 546.754 1091.4935 2 1091.4956 -0.0021 0 86.5 2.70E-08 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1420.1420.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 1882 4204 1 1 1 571.2634 1140.5123 2 1140.5121 0.0002 0 48.8 6.10E-05 R DYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4539.4539.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2012 1418 1 1 1 588.3038 1174.593 2 1174.5942 -0.0012 1 35.1 0.0035 R VDQLKSDQSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1448.1448.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2461 2922 1 1 1 426.5491 1276.6256 3 1276.6259 -0.0003 1 31.7 0.018 K SDQSRLDSELK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3085.3085.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2462 6193 1 1 1 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDLEIATYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2569 3682 1 1 1 651.8528 1301.691 2 1301.6939 -0.0029 1 59.77 2.40E-05 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3978.3978.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2570 3680 1 1 1 434.9049 1301.693 3 1301.6939 -0.0009 1 45.83 0.00048 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3976.3976.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2571 7464 1 1 1 651.862 1301.7094 2 1301.7078 0.0016 0 26.55 0.008 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8481.8481.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2572 7017 1 1 1 651.8624 1301.7103 2 1301.7078 0.0025 0 81.08 1.40E-07 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7932.7932.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2721 2459 1 1 1 670.8379 1339.6612 2 1339.6619 -0.0007 1 75.74 4.40E-07 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2574.2574.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2722 2461 1 1 1 447.5612 1339.6617 3 1339.6619 -0.0002 1 34.17 0.00069 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2576.2576.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2941 5876 1 1 1 692.3489 1382.6832 2 1382.683 0.0002 0 60.71 1.70E-05 K SLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6503.6503.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 2991 3654 1 1 1 697.3677 1392.7208 2 1392.7249 -0.0041 1 72.61 1.00E-06 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3948.3948.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 3338 5825 1 1 1 738.3785 1474.7425 2 1474.7416 0.0009 0 61.73 6.00E-06 K WELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6437.6437.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 3339 4057 1 1 0 738.3966 1474.7787 2 1474.778 0.0007 0 73.15 1.00E-06 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4382.4382.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 3501 4724 1 1 1 762.3963 1522.7781 2 1522.7813 -0.0033 1 62.57 3.20E-06 R LLRDYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5113.5113.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 3502 4714 1 1 1 508.6013 1522.7821 3 1522.7813 0.0008 1 34.2 0.00062 R LLRDYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5103.5103.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 4558 4259 1 1 1 883.3685 1764.7225 2 1764.7275 -0.005 0 154.55 8.80E-16 R FSSCGGGGGSFGAGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4598.4598.2.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 5086 6575 1 1 1 648.0008 1940.9806 3 1940.9803 0.0003 1 29.44 0.0032 K LNDLEDALQQAKEDLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7391.7391.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 5184 7086 1 1 1 665.3309 1992.971 3 1992.9693 0.0016 0 55.1 9.80E-06 R THNLEPYFESFINNLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8015.8015.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 5478 6728 1 1 1 717.3641 2149.0706 3 2149.0704 0.0001 1 30.48 0.0014 R THNLEPYFESFINNLRR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7576.7576.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 5480 6731 1 1 1 538.2753 2149.0722 4 2149.0704 0.0018 1 30.41 0.0014 R THNLEPYFESFINNLRR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7579.7579.4.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 5826 4951 1 1 1 762.7129 2285.1168 3 2285.1175 -0.0006 1 34.03 0.00072 K AEAESLYQSKYEELQITAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5374.5374.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 6249 2432 1 1 1 795.322 2382.9441 3 2382.9447 -0.0006 0 75.96 2.50E-08 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2545.2545.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 6771 3793 1 1 1 855.7258 2564.1555 3 2564.1595 -0.0041 0 41.89 0.00012 R MSGECAPNVSVSVSTSHTTISGGGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4098.4098.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 6772 3790 1 1 1 855.7258 2564.1555 3 2564.1595 -0.0041 0 57.77 3.80E-06 R MSGECAPNVSVSVSTSHTTISGGGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4094.4094.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 6839 3627 1 1 1 861.0607 2580.1602 3 2580.1545 0.0057 0 53.7 2.00E-05 R MSGECAPNVSVSVSTSHTTISGGGSR G Oxidation (M) 0.10000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3918.3918.3.dta 1 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 1073 66149 32 32 25 25 7914 6187 1 1 1 978.1755 2931.5046 3 2931.509 -0.0044 1 34.82 0.00094 R FLEQQNQVLQTKWELLQQVDTSTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6887.6887.3.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1193 1147 1 0 1 495.2302 988.4459 2 988.4462 -0.0003 0 33.82 0.00067 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1159.1159.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1357 3952 1 0 0 508.7724 1015.5303 2 1015.5298 0.0005 0 68.54 2.50E-06 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4270.4270.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1440 3299 1 0 1 346.5304 1036.5693 3 1036.5665 0.0027 1 24.78 0.021 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3542.3542.3.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1700 1922 1 0 1 366.209 1095.6053 3 1095.6036 0.0017 1 40.75 0.0012 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1994.1994.3.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1721 2888 1 0 0 554.2752 1106.5359 2 1106.5356 0.0003 0 57.6 1.90E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3049.3049.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1761 8150 1 0 1 559.2779 1116.5412 2 1116.5411 0.0001 1 22.83 0.018 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.929.929.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 1967 3757 1 0 1 583.2941 1164.5736 2 1164.5775 -0.0039 0 79.29 2.50E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4059.4059.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 2003 3366 1 0 0 586.8218 1171.6291 2 1171.6309 -0.0018 1 21.15 0.038 R RQLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3616.3616.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 2780 3799 1 0 0 675.8642 1349.7138 2 1349.7191 -0.0052 1 81.32 1.50E-07 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4104.4104.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 3103 3534 1 0 1 712.8188 1423.6231 2 1423.6263 -0.0032 0 85.55 1.80E-08 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3816.3816.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 3217 4059 1 0 1 724.3914 1446.7682 2 1446.7678 0.0003 0 91.96 3.20E-09 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4384.4384.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 3250 3308 1 0 1 728.3441 1454.6737 2 1454.679 -0.0053 1 27.54 0.012 R SRAEAESWYQTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3552.3552.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 3444 5222 1 0 1 503.2776 1506.8111 3 1506.8116 -0.0004 1 41.39 0.00013 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5683.5683.3.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 3755 4252 1 0 1 799.8827 1597.7508 2 1597.7519 -0.001 0 98.99 1.90E-09 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4591.4591.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 4193 2982 1 0 1 556.5922 1666.7547 3 1666.7594 -0.0048 1 68.42 5.90E-07 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3163.3163.3.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 4335 4415 1 0 0 847.923 1693.8314 2 1693.8345 -0.0031 1 51.59 0.00013 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4771.4771.2.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 4546 5233 1 0 0 587.3247 1758.9523 3 1758.9516 0.0007 1 44.48 0.00027 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5698.5698.3.dta 1 2 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 920 60273 27 27 26 26 6370 8257 1 0 0 806.7556 2417.245 3 2417.2438 0.0013 1 70.55 2.40E-07 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9413.9413.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 93 7975 1 0 1 323.6983 645.3821 2 645.381 0.0011 1 36.56 0.007 K KIETR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.909.909.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 553 8246 1 0 0 410.2108 818.4071 2 818.4068 0.0003 1 33.07 0.018 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.940.940.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 904 1627 1 0 1 456.2148 910.4151 2 910.4145 0.0006 0 29.56 0.0089 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1670.1670.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 984 2452 1 0 0 466.7373 931.46 2 931.461 -0.001 0 47.83 0.00031 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2566.2566.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 1415 5121 1 0 1 515.788 1029.5614 2 1029.5607 0.0007 0 37.67 0.0037 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5566.5566.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 1639 1989 1 0 1 541.285 1080.5554 2 1080.5564 -0.001 1 40.31 0.00025 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2066.2066.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 1640 1974 1 0 1 361.1932 1080.5579 3 1080.5564 0.0015 1 41.57 0.00039 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2050.2050.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 1815 2449 1 0 1 565.313 1128.6114 2 1128.6138 -0.0024 1 60.17 2.40E-05 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2563.2563.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 1816 5025 1 0 1 565.3141 1128.6137 2 1128.6138 -0.0001 0 86.41 5.50E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5454.5454.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 2006 3854 1 0 1 587.3219 1172.6292 2 1172.6289 0.0004 0 67.99 4.50E-06 K LVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4164.4164.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 2116 2437 1 0 1 601.3289 1200.6433 2 1200.6462 -0.0029 1 55 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2550.2550.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 2177 2251 1 0 1 403.5359 1207.5859 3 1207.5867 -0.0007 1 28.6 0.0021 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2352.2352.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 2178 2265 1 0 1 604.8007 1207.5868 2 1207.5867 0.0001 1 52.59 1.20E-05 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2367.2367.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 2462 6193 1 0 0 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 2730 3517 1 0 1 671.3772 1340.7398 2 1340.7412 -0.0013 1 65.66 3.80E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3798.3798.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 2738 5374 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 78.95 5.40E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5863.5863.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 3066 3321 1 0 1 471.5656 1411.6748 3 1411.6765 -0.0017 1 28.64 0.0024 R SRAEAESMYQIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3566.3566.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 3086 6622 1 0 1 710.3783 1418.742 2 1418.7405 0.0015 0 72.57 4.90E-07 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7447.7447.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 3317 3964 1 0 1 491.9317 1472.7734 3 1472.7722 0.0011 1 51.27 0.00013 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4282.4282.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 3318 3962 1 0 1 737.3942 1472.7739 2 1472.7722 0.0017 1 63.98 7.30E-06 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4280.4280.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 3333 3408 1 0 1 492.5701 1474.6884 3 1474.6908 -0.0024 0 22.67 0.027 R LESGMQNMSIHTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3664.3664.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 3350 5044 1 0 1 740.8877 1479.7608 2 1479.7643 -0.0034 1 47.82 0.00025 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5474.5474.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 3573 4670 1 0 1 517.6049 1549.7929 3 1549.7922 0.0007 1 29.39 0.0044 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5055.5055.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 4627 4503 1 0 1 899.4183 1796.8221 2 1796.825 -0.0029 1 35.34 0.00049 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4869.4869.2.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 5830 5537 1 0 1 763.374 2287.1002 3 2287.1041 -0.0039 1 24.56 0.005 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6065.6065.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 6241 7808 1 0 1 794.3939 2380.1599 3 2380.158 0.0019 1 57.8 3.80E-06 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8885.8885.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 6270 4984 1 0 1 797.053 2388.1371 3 2388.1413 -0.0042 1 25.92 0.032 K LLEGEESRLESGMQNMSIHTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5409.5409.3.dta 1 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 873 53671 32 32 29 29 8257 7230 1 0 1 1057.1816 3168.5231 3 3168.5244 -0.0014 1 80.46 2.90E-08 R QLYEEEIRELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8183.8183.3.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 8 2081 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 29.03 0.018 K LLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2170.2170.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 553 8246 1 0 0 410.2108 818.4071 2 818.4068 0.0003 1 33.07 0.018 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.940.940.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 984 2452 1 0 0 466.7373 931.46 2 931.461 -0.001 0 47.83 0.00031 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2566.2566.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 1262 3158 1 0 1 500.2261 998.4377 2 998.4379 -0.0002 0 50.57 5.50E-05 K DVDAAYMSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3369.3369.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 1470 5181 1 0 1 523.2874 1044.5602 2 1044.5604 -0.0002 0 38.12 0.00069 K WTLLQEQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5633.5633.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 2444 6744 1 0 1 636.8563 1271.6981 2 1271.6973 0.0008 0 97.66 3.00E-09 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7593.7593.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 2462 6193 1 0 0 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 2764 4225 1 0 0 674.8759 1347.7372 2 1347.7398 -0.0026 1 40.69 0.00052 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4562.4562.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 2765 4195 1 0 0 450.2537 1347.7393 3 1347.7398 -0.0004 1 47.86 0.00022 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4530.4530.3.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 2842 2397 1 0 1 682.3216 1362.6286 2 1362.631 -0.0023 1 26.46 0.0095 R NTRNEISEMNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2507.2507.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 2943 3741 1 0 1 693.3727 1384.7309 2 1384.731 -0.0001 1 91.47 3.30E-09 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4041.4041.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 2944 3733 1 0 1 462.5843 1384.7309 3 1384.731 0 1 23.19 0.03 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4032.4032.3.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 3082 6279 1 0 1 709.8679 1417.7213 2 1417.7201 0.0012 0 67.43 6.80E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6992.6992.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 3199 3173 1 0 1 721.3904 1440.7662 2 1440.7684 -0.0022 1 55.95 2.70E-05 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3386.3386.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 3203 6864 1 0 1 721.9038 1441.7931 2 1441.7929 0.0002 0 81.35 5.40E-08 R LPDIFEAQIAGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7743.7743.2.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 3379 4138 1 0 1 497.6118 1489.8135 3 1489.814 -0.0005 1 24.99 0.0051 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4468.4468.3.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 4579 6406 1 0 1 591.6599 1771.9579 3 1771.9581 -0.0001 1 65.48 3.80E-06 K SSRLPDIFEAQIAGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7171.7171.3.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 5397 6381 1 0 1 696.7042 2087.0907 3 2087.0898 0.0008 1 45.3 7.30E-05 K VELEAKVDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7136.7136.3.dta 1 4 IPI00306959.10 "Keratin, type II cytoskeletal 7" 644 51443 22 22 20 20 5581 8033 1 0 1 741.7128 2222.1167 3 2222.114 0.0027 1 29.81 0.0023 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9157.9157.3.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 553 8246 1 0 0 410.2108 818.4071 2 818.4068 0.0003 1 33.07 0.018 K AKQDMAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.940.940.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 1132 1840 1 0 1 486.2432 970.4718 2 970.472 -0.0002 0 17.65 0.022 K FVSTTSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1908.1908.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 1347 1886 1 0 1 508.2347 1014.4549 2 1014.4552 -0.0004 0 29.26 0.0018 K HEISEMNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1957.1957.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 1357 3952 1 0 0 508.7724 1015.5303 2 1015.5298 0.0005 0 68.54 2.50E-06 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4270.4270.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 2003 3366 1 0 0 586.8218 1171.6291 2 1171.6309 -0.0018 1 21.15 0.038 R RQLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3616.3616.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 2080 2660 1 0 1 597.7913 1193.5681 2 1193.5676 0.0004 0 57.76 1.40E-05 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2793.2793.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 3059 4031 1 0 1 705.8419 1409.6693 2 1409.6722 -0.0029 0 90.2 4.00E-09 R VSLAGACGVGGYGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4354.4354.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 3060 4198 1 0 1 705.8636 1409.7127 2 1409.7151 -0.0023 0 46.22 6.40E-05 R SFSTASAITPSVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4533.4533.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 3061 4436 1 0 1 470.9149 1409.7229 3 1409.7224 0.0005 1 42.65 0.00038 R TTAENEFVMLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4793.4793.3.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 3190 4269 1 0 1 720.3594 1438.7042 2 1438.7053 -0.0011 0 33.32 0.00075 R GLGVGFGSGGGSSSSVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4609.4609.2.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 3541 4826 1 0 1 513.2732 1536.7978 3 1536.797 0.0008 1 31.07 0.0041 R LLREYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5230.5230.3.dta 1 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 545 62637 20 20 19 19 4546 5233 1 0 0 587.3247 1758.9523 3 1758.9516 0.0007 1 44.48 0.00027 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5698.5698.3.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 389 1979 1 0 1 390.1935 778.3725 2 778.3722 0.0003 0 30.71 0.0034 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2055.2055.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 1220 2358 1 0 1 332.1944 993.5615 3 993.5607 0.0007 0 22.2 0.029 R LQGEIAHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2466.2466.3.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 1397 1808 1 0 1 342.8575 1025.5508 3 1025.5505 0.0003 1 29.45 0.0085 R HGDSLKEIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1875.1875.3.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 1721 2888 1 0 0 554.2752 1106.5359 2 1106.5356 0.0003 0 57.6 1.90E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3049.3049.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 2099 2029 1 0 1 599.2781 1196.5416 2 1196.5422 -0.0006 0 65.79 6.80E-07 K GGSISGGGYGSGGGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2108.2108.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 3268 6885 1 0 1 730.9036 1459.7926 2 1459.7922 0.0004 0 76.62 3.30E-07 K VDLLNQEIEFLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7772.7772.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 3339 4057 1 0 0 738.3966 1474.7787 2 1474.778 0.0007 0 73.15 1.00E-06 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4382.4382.2.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 3483 5116 1 0 0 507.9413 1520.8019 3 1520.8021 -0.0001 1 20.91 0.026 R LLRDYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5560.5560.3.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 5650 5405 1 0 1 752.6851 2255.0335 3 2255.0376 -0.004 1 17.14 0.025 R TSQNSELNNMQDLVEDYKK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5898.5898.3.dta 1 6 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 531 66110 18 18 17 17 6370 8257 1 0 0 806.7556 2417.245 3 2417.2438 0.0013 1 70.55 2.40E-07 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9413.9413.3.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 195 2298 1 0 1 351.2008 700.3871 2 700.3868 0.0003 0 55.91 6.50E-05 R SSVPGVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2402.2402.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 984 2452 1 0 0 466.7373 931.46 2 931.461 -0.001 0 47.83 0.00031 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2566.2566.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 1386 2072 1 0 1 512.2593 1022.504 2 1022.5032 0.0008 0 53.88 6.40E-05 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2159.2159.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 1403 1362 1 0 1 514.7591 1027.5036 2 1027.5047 -0.001 1 33.36 0.0076 R SVSSSSYRR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1388.1388.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 1668 2476 1 0 1 544.7697 1087.5249 2 1087.5258 -0.0009 0 76.39 3.60E-07 R QDVDNASLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2592.2592.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 2492 2028 1 0 1 644.3359 1286.6572 2 1286.6579 -0.0007 1 18.38 0.046 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2107.2107.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 2493 2006 1 0 1 429.8933 1286.658 3 1286.6579 0.0001 1 37.46 0.0011 R QVDQLTNDKAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2084.2084.3.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 2603 4914 1 0 1 655.3057 1308.5969 2 1308.5986 -0.0017 0 46.61 4.30E-05 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5330.5330.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 3117 3997 1 0 1 714.8589 1427.7033 2 1427.7045 -0.0011 0 73.54 1.30E-07 R SLYASSPGGVYATR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4318.4318.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 3506 4443 1 0 1 508.9158 1523.7256 3 1523.7256 0 1 15.16 0.04 K NLQEAEEWYKSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4801.4801.3.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 3515 4409 1 0 1 509.9479 1526.822 3 1526.8205 0.0015 1 47.77 0.00023 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4765.4765.3.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 3525 5854 1 0 1 511.9557 1532.8452 3 1532.845 0.0003 1 55.17 4.00E-05 R KVESLQEEIAFLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6473.6473.3.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 3555 5525 1 0 1 513.9755 1538.9046 3 1538.9032 0.0014 1 37.17 0.00072 K ILLAELEQLKGQGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6046.6046.3.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 3633 7253 1 0 1 785.9516 1569.8886 2 1569.8878 0.0008 0 24.65 0.0049 R ISLPLPNFSSLNLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8218.8218.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 4290 5077 1 0 1 844.9154 1687.8163 2 1687.8199 -0.0036 1 27.32 0.0031 R VEVERDNLAEDIMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5511.5511.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 4592 3968 1 0 1 592.9591 1775.8555 3 1775.855 0.0005 1 36.74 0.00089 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4287.4287.3.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 5457 7380 1 0 1 1063.536 2125.0575 2 2125.0579 -0.0004 0 79.92 3.20E-08 R LLQDSVDFSLADAINTEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8381.8381.2.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 5458 7368 1 0 1 709.361 2125.0611 3 2125.0579 0.0031 0 40.18 0.00017 R LLQDSVDFSLADAINTEFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8369.8369.3.dta 1 7 IPI00418471.6 Vimentin 473 53676 19 19 17 17 6225 5182 1 0 1 793.0597 2376.1572 3 2376.1591 -0.0018 1 14.89 0.04 R QVQSLTCEVDALKGTNESLER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5634.5634.3.dta 1 8 IPI00290857.2 "Keratin, type II cytoskeletal 3" 218 64636 9 9 8 8 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 8 IPI00290857.2 "Keratin, type II cytoskeletal 3" 218 64636 9 9 8 8 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 8 IPI00290857.2 "Keratin, type II cytoskeletal 3" 218 64636 9 9 8 8 1686 2512 1 0 1 547.2673 1092.5201 2 1092.52 0.0002 0 32.56 0.011 R AQYEDIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2630.2630.2.dta 1 8 IPI00290857.2 "Keratin, type II cytoskeletal 3" 218 64636 9 9 8 8 1687 2522 1 0 1 547.2696 1092.5246 2 1092.52 0.0047 0 25.16 0.01 R AQYEDIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2641.2641.2.dta 1 8 IPI00290857.2 "Keratin, type II cytoskeletal 3" 218 64636 9 9 8 8 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 8 IPI00290857.2 "Keratin, type II cytoskeletal 3" 218 64636 9 9 8 8 2780 3799 1 0 0 675.8642 1349.7138 2 1349.7191 -0.0052 1 81.32 1.50E-07 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4104.4104.2.dta 1 8 IPI00290857.2 "Keratin, type II cytoskeletal 3" 218 64636 9 9 8 8 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 8 IPI00290857.2 "Keratin, type II cytoskeletal 3" 218 64636 9 9 8 8 3342 3615 1 0 0 738.9055 1475.7965 2 1475.7984 -0.0019 1 16.08 0.036 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3905.3905.2.dta 1 8 IPI00290857.2 "Keratin, type II cytoskeletal 3" 218 64636 9 9 8 8 3483 5116 1 0 0 507.9413 1520.8019 3 1520.8021 -0.0001 1 20.91 0.026 R LLRDYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5560.5560.3.dta 1 9 IPI00103481.3 Keratin-72 155 56470 6 6 5 5 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 9 IPI00103481.3 Keratin-72 155 56470 6 6 5 5 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 9 IPI00103481.3 Keratin-72 155 56470 6 6 5 5 2764 4225 1 0 0 674.8759 1347.7372 2 1347.7398 -0.0026 1 40.69 0.00052 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4562.4562.2.dta 1 9 IPI00103481.3 Keratin-72 155 56470 6 6 5 5 2765 4195 1 0 0 450.2537 1347.7393 3 1347.7398 -0.0004 1 47.86 0.00022 R TAAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4530.4530.3.dta 1 9 IPI00103481.3 Keratin-72 155 56470 6 6 5 5 3341 3590 1 0 1 492.9293 1475.766 3 1475.762 0.0041 0 51.95 0.00014 R FLEQQNQVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3878.3878.3.dta 1 9 IPI00103481.3 Keratin-72 155 56470 6 6 5 5 4335 4415 1 0 0 847.923 1693.8314 2 1693.8345 -0.0031 1 51.59 0.00013 K DVDAAYMNKVELQAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4771.4771.2.dta 1 10 IPI00166205.2 Keratin-78 62 57728 3 3 3 3 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 R LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 10 IPI00166205.2 Keratin-78 62 57728 3 3 3 3 3014 5013 1 0 1 466.5721 1396.6943 3 1396.6987 -0.0043 0 31.26 0.0012 R TLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5441.5441.3.dta 1 10 IPI00166205.2 Keratin-78 62 57728 3 3 3 3 3342 3615 1 0 0 738.9055 1475.7965 2 1475.7984 -0.0019 1 16.08 0.036 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3905.3905.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1193 1147 1 0 1 495.2302 988.4459 2 988.4462 -0.0003 0 33.82 0.00067 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1159.1159.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1357 3952 1 0 0 508.7724 1015.5303 2 1015.5298 0.0005 0 68.54 2.50E-06 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4270.4270.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1440 3299 1 0 1 346.5304 1036.5693 3 1036.5665 0.0027 1 24.78 0.021 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3542.3542.3.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1700 1922 1 0 1 366.209 1095.6053 3 1095.6036 0.0017 1 40.75 0.0012 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1994.1994.3.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1721 2888 1 0 0 554.2752 1106.5359 2 1106.5356 0.0003 0 57.6 1.90E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3049.3049.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1761 8150 1 0 1 559.2779 1116.5412 2 1116.5411 0.0001 1 22.83 0.018 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.929.929.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 1967 3757 1 0 1 583.2941 1164.5736 2 1164.5775 -0.0039 0 79.29 2.50E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4059.4059.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 2003 3366 1 0 0 586.8218 1171.6291 2 1171.6309 -0.0018 1 21.15 0.038 R RQLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3616.3616.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 2780 3799 1 0 0 675.8642 1349.7138 2 1349.7191 -0.0052 1 81.32 1.50E-07 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4104.4104.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 3103 3534 1 0 1 712.8188 1423.6231 2 1423.6263 -0.0032 0 85.55 1.80E-08 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3816.3816.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 3217 4059 1 0 1 724.3914 1446.7682 2 1446.7678 0.0003 0 91.96 3.20E-09 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4384.4384.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 3250 3308 1 0 1 728.3441 1454.6737 2 1454.679 -0.0053 1 27.54 0.012 R SRAEAESWYQTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3552.3552.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 3444 5222 1 0 1 503.2776 1506.8111 3 1506.8116 -0.0004 1 41.39 0.00013 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5683.5683.3.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 3755 4252 1 0 1 799.8827 1597.7508 2 1597.7519 -0.001 0 98.99 1.90E-09 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4591.4591.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 4193 2982 1 0 1 556.5922 1666.7547 3 1666.7594 -0.0048 1 68.42 5.90E-07 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3163.3163.3.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 4335 4415 1 0 0 847.923 1693.8314 2 1693.8345 -0.0031 1 51.59 0.00013 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4771.4771.2.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 4546 5233 1 0 0 587.3247 1758.9523 3 1758.9516 0.0007 1 44.48 0.00027 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5698.5698.3.dta 1 IPI00816709.1 Keratin 6C 902 60245 26 26 25 25 6370 8257 1 0 0 806.7556 2417.245 3 2417.2438 0.0013 1 70.55 2.40E-07 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9413.9413.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1193 1147 1 0 1 495.2302 988.4459 2 988.4462 -0.0003 0 33.82 0.00067 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1159.1159.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1357 3952 1 0 0 508.7724 1015.5303 2 1015.5298 0.0005 0 68.54 2.50E-06 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4270.4270.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1440 3299 1 0 1 346.5304 1036.5693 3 1036.5665 0.0027 1 24.78 0.021 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3542.3542.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1700 1922 1 0 1 366.209 1095.6053 3 1095.6036 0.0017 1 40.75 0.0012 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1994.1994.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1721 2888 1 0 0 554.2752 1106.5359 2 1106.5356 0.0003 0 57.6 1.90E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3049.3049.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1761 8150 1 0 1 559.2779 1116.5412 2 1116.5411 0.0001 1 22.83 0.018 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.929.929.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 1967 3757 1 0 1 583.2941 1164.5736 2 1164.5775 -0.0039 0 79.29 2.50E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4059.4059.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 2003 3366 1 0 0 586.8218 1171.6291 2 1171.6309 -0.0018 1 21.15 0.038 R RQLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3616.3616.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 2780 3799 1 0 0 675.8642 1349.7138 2 1349.7191 -0.0052 1 81.32 1.50E-07 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4104.4104.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 3103 3534 1 0 1 712.8188 1423.6231 2 1423.6263 -0.0032 0 85.55 1.80E-08 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3816.3816.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 3217 4059 1 0 1 724.3914 1446.7682 2 1446.7678 0.0003 0 91.96 3.20E-09 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4384.4384.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 3250 3308 1 0 1 728.3441 1454.6737 2 1454.679 -0.0053 1 27.54 0.012 R SRAEAESWYQTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3552.3552.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 3342 3615 1 0 0 738.9055 1475.7965 2 1475.7984 -0.0019 1 16.08 0.036 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3905.3905.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 3444 5222 1 0 1 503.2776 1506.8111 3 1506.8116 -0.0004 1 41.39 0.00013 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5683.5683.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 3755 4252 1 0 1 799.8827 1597.7508 2 1597.7519 -0.001 0 98.99 1.90E-09 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4591.4591.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 4193 2982 1 0 1 556.5922 1666.7547 3 1666.7594 -0.0048 1 68.42 5.90E-07 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3163.3163.3.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 4335 4415 1 0 0 847.923 1693.8314 2 1693.8345 -0.0031 1 51.59 0.00013 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4771.4771.2.dta 1 IPI00300725.7 "Keratin, type II cytoskeletal 6A" 898 60293 27 27 26 26 6370 8257 1 0 0 806.7556 2417.245 3 2417.2438 0.0013 1 70.55 2.40E-07 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9413.9413.3.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1193 1147 1 0 1 495.2302 988.4459 2 988.4462 -0.0003 0 33.82 0.00067 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1159.1159.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1357 3952 1 0 0 508.7724 1015.5303 2 1015.5298 0.0005 0 68.54 2.50E-06 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4270.4270.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1440 3299 1 0 1 346.5304 1036.5693 3 1036.5665 0.0027 1 24.78 0.021 R SLYGLGGSKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3542.3542.3.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1700 1922 1 0 1 366.209 1095.6053 3 1095.6036 0.0017 1 40.75 0.0012 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1994.1994.3.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1721 2888 1 0 0 554.2752 1106.5359 2 1106.5356 0.0003 0 57.6 1.90E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3049.3049.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1761 8150 1 0 1 559.2779 1116.5412 2 1116.5411 0.0001 1 22.83 0.018 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.929.929.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 1967 3757 1 0 1 583.2941 1164.5736 2 1164.5775 -0.0039 0 79.29 2.50E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4059.4059.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 2003 3366 1 0 0 586.8218 1171.6291 2 1171.6309 -0.0018 1 21.15 0.038 R RQLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3616.3616.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 2780 3799 1 0 0 675.8642 1349.7138 2 1349.7191 -0.0052 1 81.32 1.50E-07 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4104.4104.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 3103 3534 1 0 1 712.8188 1423.6231 2 1423.6263 -0.0032 0 85.55 1.80E-08 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3816.3816.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 3250 3308 1 0 1 728.3441 1454.6737 2 1454.679 -0.0053 1 27.54 0.012 R SRAEAESWYQTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3552.3552.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 3444 5222 1 0 1 503.2776 1506.8111 3 1506.8116 -0.0004 1 41.39 0.00013 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5683.5683.3.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 3755 4252 1 0 1 799.8827 1597.7508 2 1597.7519 -0.001 0 98.99 1.90E-09 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4591.4591.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 4193 2982 1 0 1 556.5922 1666.7547 3 1666.7594 -0.0048 1 68.42 5.90E-07 R SRGSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3163.3163.3.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 4335 4415 1 0 0 847.923 1693.8314 2 1693.8345 -0.0031 1 51.59 0.00013 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4771.4771.2.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 4546 5233 1 0 0 587.3247 1758.9523 3 1758.9516 0.0007 1 44.48 0.00027 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5698.5698.3.dta 1 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 848 60247 26 26 25 25 6370 8257 1 0 0 806.7556 2417.245 3 2417.2438 0.0013 1 70.55 2.40E-07 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9413.9413.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1193 1147 1 0 1 495.2302 988.4459 2 988.4462 -0.0003 0 33.82 0.00067 K YTTTSSSSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1159.1159.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1357 3952 1 0 0 508.7724 1015.5303 2 1015.5298 0.0005 0 68.54 2.50E-06 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4270.4270.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1700 1922 1 0 1 366.209 1095.6053 3 1095.6036 0.0017 1 40.75 0.0012 R LRSEIDHVK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1994.1994.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1721 2888 1 0 0 554.2752 1106.5359 2 1106.5356 0.0003 0 57.6 1.90E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3049.3049.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1761 8150 1 0 1 559.2779 1116.5412 2 1116.5411 0.0001 1 22.83 0.018 K YTTTSSSSRK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.929.929.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 K EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 1967 3757 1 0 1 583.2941 1164.5736 2 1164.5775 -0.0039 0 79.29 2.50E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4059.4059.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 2003 3366 1 0 0 586.8218 1171.6291 2 1171.6309 -0.0018 1 21.15 0.038 R RQLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3616.3616.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 2780 3799 1 0 0 675.8642 1349.7138 2 1349.7191 -0.0052 1 81.32 1.50E-07 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4104.4104.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 3217 4059 1 0 1 724.3914 1446.7682 2 1446.7678 0.0003 0 91.96 3.20E-09 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4384.4384.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 3250 3308 1 0 1 728.3441 1454.6737 2 1454.679 -0.0053 1 27.54 0.012 R SRAEAESWYQTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3552.3552.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 3444 5222 1 0 1 503.2776 1506.8111 3 1506.8116 -0.0004 1 41.39 0.00013 R LLKEYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5683.5683.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 4335 4415 1 0 0 847.923 1693.8314 2 1693.8345 -0.0031 1 51.59 0.00013 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4771.4771.2.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 4546 5233 1 0 0 587.3247 1758.9523 3 1758.9516 0.0007 1 44.48 0.00027 K VLDTKWTLLQEQGTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5698.5698.3.dta 1 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 669 42557 20 20 19 19 6370 8257 1 0 0 806.7556 2417.245 3 2417.2438 0.0013 1 70.55 2.40E-07 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9413.9413.3.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 553 8246 1 0 0 410.2108 818.4071 2 818.4068 0.0003 1 33.07 0.018 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.940.940.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 984 2452 1 0 0 466.7373 931.46 2 931.461 -0.001 0 47.83 0.00031 K LLEGEESR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2566.2566.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 1815 2449 1 0 1 565.313 1128.6114 2 1128.6138 -0.0024 1 60.17 2.40E-05 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2563.2563.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 1816 5025 1 0 1 565.3141 1128.6137 2 1128.6138 -0.0001 0 86.41 5.50E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5454.5454.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 2177 2251 1 0 1 403.5359 1207.5859 3 1207.5867 -0.0007 1 28.6 0.0021 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2352.2352.3.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 2178 2265 1 0 1 604.8007 1207.5868 2 1207.5867 0.0001 1 52.59 1.20E-05 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2367.2367.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 2462 6193 1 0 0 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 2730 3517 1 0 1 671.3772 1340.7398 2 1340.7412 -0.0013 1 65.66 3.80E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3798.3798.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 2738 5374 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 78.95 5.40E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5863.5863.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 3066 3321 1 0 1 471.5656 1411.6748 3 1411.6765 -0.0017 1 28.64 0.0024 R SRAEAESMYQIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3566.3566.3.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 3086 6622 1 0 1 710.3783 1418.742 2 1418.7405 0.0015 0 72.57 4.90E-07 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7447.7447.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 3573 4670 1 0 1 517.6049 1549.7929 3 1549.7922 0.0007 1 29.39 0.0044 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5055.5055.3.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 4627 4503 1 0 1 899.4183 1796.8221 2 1796.825 -0.0029 1 35.34 0.00049 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4869.4869.2.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 5830 5537 1 0 1 763.374 2287.1002 3 2287.1041 -0.0039 1 24.56 0.005 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6065.6065.3.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 6241 7808 1 0 1 794.3939 2380.1599 3 2380.158 0.0019 1 57.8 3.80E-06 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8885.8885.3.dta 1 IPI00793917.1 27 kDa protein 575 26765 17 17 16 16 8257 7230 1 0 1 1057.1816 3168.5231 3 3168.5244 -0.0014 1 80.46 2.90E-08 R QLYEEEIRELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8183.8183.3.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 1815 2449 1 0 1 565.313 1128.6114 2 1128.6138 -0.0024 1 60.17 2.40E-05 R GELAIKDANAK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2563.2563.2.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 2177 2251 1 0 1 403.5359 1207.5859 3 1207.5867 -0.0007 1 28.6 0.0021 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2352.2352.3.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 2178 2265 1 0 1 604.8007 1207.5868 2 1207.5867 0.0001 1 52.59 1.20E-05 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2367.2367.2.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 2730 3517 1 0 1 671.3772 1340.7398 2 1340.7412 -0.0013 1 65.66 3.80E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3798.3798.2.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 2738 5374 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 78.95 5.40E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5863.5863.2.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 3066 3321 1 0 1 471.5656 1411.6748 3 1411.6765 -0.0017 1 28.64 0.0024 R SRAEAESMYQIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3566.3566.3.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 3086 6622 1 0 1 710.3783 1418.742 2 1418.7405 0.0015 0 72.57 4.90E-07 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7447.7447.2.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 5830 5537 1 0 1 763.374 2287.1002 3 2287.1041 -0.0039 1 24.56 0.005 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6065.6065.3.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 6241 7808 1 0 1 794.3939 2380.1599 3 2380.158 0.0019 1 57.8 3.80E-06 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8885.8885.3.dta 1 IPI00795725.1 17 kDa protein 384 16798 10 10 9 9 8257 7230 1 0 1 1057.1816 3168.5231 3 3168.5244 -0.0014 1 80.46 2.90E-08 R QLYEEEIRELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8183.8183.3.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 553 8246 1 0 0 410.2108 818.4071 2 818.4068 0.0003 1 33.07 0.018 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.940.940.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 1415 5121 1 0 1 515.788 1029.5614 2 1029.5607 0.0007 0 37.67 0.0037 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5566.5566.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 1815 2449 1 0 1 565.313 1128.6114 2 1128.6138 -0.0024 1 60.17 2.40E-05 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2563.2563.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 1816 5025 1 0 1 565.3141 1128.6137 2 1128.6138 -0.0001 0 86.41 5.50E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5454.5454.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 2116 2437 1 0 1 601.3289 1200.6433 2 1200.6462 -0.0029 1 55 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2550.2550.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 2462 6193 1 0 0 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 2738 5374 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 78.95 5.40E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5863.5863.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 3086 6622 1 0 1 710.3783 1418.742 2 1418.7405 0.0015 0 72.57 4.90E-07 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7447.7447.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 3573 4670 1 0 1 517.6049 1549.7929 3 1549.7922 0.0007 1 29.39 0.0044 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5055.5055.3.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 4627 4503 1 0 1 899.4183 1796.8221 2 1796.825 -0.0029 1 35.34 0.00049 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4869.4869.2.dta 1 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 384 47891 12 12 12 12 5830 5537 1 0 1 763.374 2287.1002 3 2287.1041 -0.0039 1 24.56 0.005 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6065.6065.3.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 553 8246 1 0 0 410.2108 818.4071 2 818.4068 0.0003 1 33.07 0.018 K AKQDMAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.940.940.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 1967 3757 1 0 1 583.2941 1164.5736 2 1164.5775 -0.0039 0 79.29 2.50E-07 K YEELQVTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4059.4059.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 3250 3308 1 0 1 728.3441 1454.6737 2 1454.679 -0.0053 1 27.54 0.012 R SRAEAESWYQTK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3552.3552.2.dta 1 IPI00005859.2 Keratin-75 333 59809 12 12 11 11 3342 3615 1 0 0 738.9055 1475.7965 2 1475.7984 -0.0019 1 16.08 0.036 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3905.3905.2.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 1415 5121 1 0 1 515.788 1029.5614 2 1029.5607 0.0007 0 37.67 0.0037 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5566.5566.2.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 2116 2437 1 0 1 601.3289 1200.6433 2 1200.6462 -0.0029 1 55 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2550.2550.2.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 3066 3321 1 0 1 471.5656 1411.6748 3 1411.6765 -0.0017 1 28.64 0.0024 R SRAEAESMYQIK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3566.3566.3.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 3086 6622 1 0 1 710.3783 1418.742 2 1418.7405 0.0015 0 72.57 4.90E-07 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7447.7447.2.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 3350 5044 1 0 1 740.8877 1479.7608 2 1479.7643 -0.0034 1 47.82 0.00025 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5474.5474.2.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 4627 4503 1 0 1 899.4183 1796.8221 2 1796.825 -0.0029 1 35.34 0.00049 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4869.4869.2.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 6241 7808 1 0 1 794.3939 2380.1599 3 2380.158 0.0019 1 57.8 3.80E-06 R SLDMDSIIAEVKAQYEDIANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8885.8885.3.dta 1 IPI00792642.1 25 kDa protein 332 24809 11 11 11 11 8257 7230 1 0 1 1057.1816 3168.5231 3 3168.5244 -0.0014 1 80.46 2.90E-08 R QLYEEEIRELQSQISDTSVVLSMDNSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8183.8183.3.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 323 30826 9 9 9 9 553 8246 1 0 0 410.2108 818.4071 2 818.4068 0.0003 1 33.07 0.018 R AKQDMAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.940.940.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 323 30826 9 9 9 9 1815 2449 1 0 1 565.313 1128.6114 2 1128.6138 -0.0024 1 60.17 2.40E-05 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2563.2563.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 323 30826 9 9 9 9 1816 5025 1 0 1 565.3141 1128.6137 2 1128.6138 -0.0001 0 86.41 5.50E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5454.5454.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 323 30826 9 9 9 9 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 323 30826 9 9 9 9 2462 6193 1 0 0 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 323 30826 9 9 9 9 2738 5374 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 78.95 5.40E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5863.5863.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 323 30826 9 9 9 9 3086 6622 1 0 1 710.3783 1418.742 2 1418.7405 0.0015 0 72.57 4.90E-07 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7447.7447.2.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 323 30826 9 9 9 9 3573 4670 1 0 1 517.6049 1549.7929 3 1549.7922 0.0007 1 29.39 0.0044 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5055.5055.3.dta 1 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 323 30826 9 9 9 9 5830 5537 1 0 1 763.374 2287.1002 3 2287.1041 -0.0039 1 24.56 0.005 R AEAESMYQIKYEELQSLAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6065.6065.3.dta 1 IPI00796330.1 18 kDa protein 288 18135 8 8 8 8 1357 3952 1 0 0 508.7724 1015.5303 2 1015.5298 0.0005 0 68.54 2.50E-06 R QLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4270.4270.2.dta 1 IPI00796330.1 18 kDa protein 288 18135 8 8 8 8 1721 2888 1 0 0 554.2752 1106.5359 2 1106.5356 0.0003 0 57.6 1.90E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3049.3049.2.dta 1 IPI00796330.1 18 kDa protein 288 18135 8 8 8 8 2003 3366 1 0 0 586.8218 1171.6291 2 1171.6309 -0.0018 1 21.15 0.038 R RQLDSIVGER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3616.3616.2.dta 1 IPI00796330.1 18 kDa protein 288 18135 8 8 8 8 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00796330.1 18 kDa protein 288 18135 8 8 8 8 2780 3799 1 0 0 675.8642 1349.7138 2 1349.7191 -0.0052 1 81.32 1.50E-07 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4104.4104.2.dta 1 IPI00796330.1 18 kDa protein 288 18135 8 8 8 8 3250 3308 1 0 1 728.3441 1454.6737 2 1454.679 -0.0053 1 27.54 0.012 R SRAEAESWYQTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3552.3552.2.dta 1 IPI00796330.1 18 kDa protein 288 18135 8 8 8 8 4335 4415 1 0 0 847.923 1693.8314 2 1693.8345 -0.0031 1 51.59 0.00013 K DVDAAYMNKVELQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4771.4771.2.dta 1 IPI00796330.1 18 kDa protein 288 18135 8 8 8 8 6370 8257 1 0 0 806.7556 2417.245 3 2417.2438 0.0013 1 70.55 2.40E-07 R NLDLDSIIAEVKAQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9413.9413.3.dta 1 IPI00795197.1 24 kDa protein 275 24107 9 9 8 8 553 8246 1 0 0 410.2108 818.4071 2 818.4068 0.0003 1 33.07 0.018 K AKQDMAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.940.940.2.dta 1 IPI00795197.1 24 kDa protein 275 24107 9 9 8 8 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 IPI00795197.1 24 kDa protein 275 24107 9 9 8 8 1347 1886 1 0 1 508.2347 1014.4549 2 1014.4552 -0.0004 0 29.26 0.0018 K HEISEMNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1957.1957.2.dta 1 IPI00795197.1 24 kDa protein 275 24107 9 9 8 8 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 IPI00795197.1 24 kDa protein 275 24107 9 9 8 8 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 IPI00795197.1 24 kDa protein 275 24107 9 9 8 8 2080 2660 1 0 1 597.7913 1193.5681 2 1193.5676 0.0004 0 57.76 1.40E-05 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2793.2793.2.dta 1 IPI00795197.1 24 kDa protein 275 24107 9 9 8 8 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00795197.1 24 kDa protein 275 24107 9 9 8 8 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00795197.1 24 kDa protein 275 24107 9 9 8 8 3541 4826 1 0 1 513.2732 1536.7978 3 1536.797 0.0008 1 31.07 0.0041 R LLREYQELMNTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5230.5230.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 3342 3615 1 0 0 738.9055 1475.7965 2 1475.7984 -0.0019 1 16.08 0.036 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3905.3905.2.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 3483 5116 1 0 0 507.9413 1520.8019 3 1520.8021 -0.0001 1 20.91 0.026 R LLRDYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5560.5560.3.dta 1 IPI00008359.1 "Keratin, type II cytoskeletal 2 oral" 245 66400 10 10 9 9 4335 4415 2 0 1 847.923 1693.8314 2 1693.8345 -0.0031 1 42.6 0.001 K DVDAAFMNKVELQAK V Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4771.4771.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 237 55459 8 8 7 7 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 237 55459 8 8 7 7 984 2452 1 0 0 466.7373 931.46 2 931.461 -0.001 0 47.83 0.00031 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2566.2566.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 237 55459 8 8 7 7 1415 5121 1 0 1 515.788 1029.5614 2 1029.5607 0.0007 0 37.67 0.0037 K WSLLQQQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5566.5566.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 237 55459 8 8 7 7 1816 5025 1 0 1 565.3141 1128.6137 2 1128.6138 -0.0001 0 86.41 5.50E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5454.5454.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 237 55459 8 8 7 7 2116 2437 1 0 1 601.3289 1200.6433 2 1200.6462 -0.0029 1 55 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2550.2550.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 237 55459 8 8 7 7 2177 2251 1 0 1 403.5359 1207.5859 3 1207.5867 -0.0007 1 28.6 0.0021 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2352.2352.3.dta 1 IPI00017870.1 Keratin-8-like protein 1 237 55459 8 8 7 7 2178 2265 1 0 1 604.8007 1207.5868 2 1207.5867 0.0001 1 52.59 1.20E-05 R TKTEISEMNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2367.2367.2.dta 1 IPI00017870.1 Keratin-8-like protein 1 237 55459 8 8 7 7 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00791912.1 22 kDa protein 197 22195 9 9 8 8 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00791912.1 22 kDa protein 197 22195 9 9 8 8 904 1627 1 0 1 456.2148 910.4151 2 910.4145 0.0006 0 29.56 0.0089 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1670.1670.2.dta 1 IPI00791912.1 22 kDa protein 197 22195 9 9 8 8 1415 5121 1 0 1 515.788 1029.5614 2 1029.5607 0.0007 0 37.67 0.0037 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5566.5566.2.dta 1 IPI00791912.1 22 kDa protein 197 22195 9 9 8 8 1639 1989 1 0 1 541.285 1080.5554 2 1080.5564 -0.001 1 40.31 0.00025 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2066.2066.2.dta 1 IPI00791912.1 22 kDa protein 197 22195 9 9 8 8 1640 1974 1 0 1 361.1932 1080.5579 3 1080.5564 0.0015 1 41.57 0.00039 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2050.2050.3.dta 1 IPI00791912.1 22 kDa protein 197 22195 9 9 8 8 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00791912.1 22 kDa protein 197 22195 9 9 8 8 2116 2437 1 0 1 601.3289 1200.6433 2 1200.6462 -0.0029 1 55 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2550.2550.2.dta 1 IPI00791912.1 22 kDa protein 197 22195 9 9 8 8 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00791912.1 22 kDa protein 197 22195 9 9 8 8 3350 5044 1 0 1 740.8877 1479.7608 2 1479.7643 -0.0034 1 47.82 0.00025 R TEMENEFVLIKK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5474.5474.2.dta 1 IPI00241841.8 keratin 6L 191 58085 7 7 7 7 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00241841.8 keratin 6L 191 58085 7 7 7 7 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00241841.8 keratin 6L 191 58085 7 7 7 7 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00241841.8 keratin 6L 191 58085 7 7 7 7 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00241841.8 keratin 6L 191 58085 7 7 7 7 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00241841.8 keratin 6L 191 58085 7 7 7 7 3342 3615 1 0 0 738.9055 1475.7965 2 1475.7984 -0.0019 1 16.08 0.036 R FLEQQNKVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3905.3905.2.dta 1 IPI00241841.8 keratin 6L 191 58085 7 7 7 7 3483 5116 1 0 0 507.9413 1520.8019 3 1520.8021 -0.0001 1 20.91 0.026 R LLRDYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5560.5560.3.dta 1 IPI00552689.1 Vimentin 184 20138 6 6 6 6 1386 2072 1 0 1 512.2593 1022.504 2 1022.5032 0.0008 0 53.88 6.40E-05 R QQYESVAAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2159.2159.2.dta 1 IPI00552689.1 Vimentin 184 20138 6 6 6 6 1668 2476 1 0 1 544.7697 1087.5249 2 1087.5258 -0.0009 0 76.39 3.60E-07 R QDVDNASLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2592.2592.2.dta 1 IPI00552689.1 Vimentin 184 20138 6 6 6 6 2603 4914 1 0 1 655.3057 1308.5969 2 1308.5986 -0.0017 0 46.61 4.30E-05 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5330.5330.2.dta 1 IPI00552689.1 Vimentin 184 20138 6 6 6 6 3506 4443 1 0 1 508.9158 1523.7256 3 1523.7256 0 1 15.16 0.04 K NLQEAEEWYKSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4801.4801.3.dta 1 IPI00552689.1 Vimentin 184 20138 6 6 6 6 3525 5854 1 0 1 511.9557 1532.8452 3 1532.845 0.0003 1 55.17 4.00E-05 R KVESLQEEIAFLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6473.6473.3.dta 1 IPI00552689.1 Vimentin 184 20138 6 6 6 6 4592 3968 1 0 1 592.9591 1775.8555 3 1775.855 0.0005 1 36.74 0.00089 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4287.4287.3.dta 1 IPI00792167.1 9 kDa protein 184 8852 4 4 4 4 2444 6744 1 0 1 636.8563 1271.6981 2 1271.6973 0.0008 0 97.66 3.00E-09 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7593.7593.2.dta 1 IPI00792167.1 9 kDa protein 184 8852 4 4 4 4 3082 6279 1 0 1 709.8679 1417.7213 2 1417.7201 0.0012 0 67.43 6.80E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6992.6992.2.dta 1 IPI00792167.1 9 kDa protein 184 8852 4 4 4 4 5397 6381 1 0 1 696.7042 2087.0907 3 2087.0898 0.0008 1 45.3 7.30E-05 K VELEAKVDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7136.7136.3.dta 1 IPI00792167.1 9 kDa protein 184 8852 4 4 4 4 5581 8033 1 0 1 741.7128 2222.1167 3 2222.114 0.0027 1 29.81 0.0023 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9157.9157.3.dta 1 IPI00791341.1 20 kDa protein 173 19686 8 8 7 7 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00791341.1 20 kDa protein 173 19686 8 8 7 7 904 1627 1 0 1 456.2148 910.4151 2 910.4145 0.0006 0 29.56 0.0089 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1670.1670.2.dta 1 IPI00791341.1 20 kDa protein 173 19686 8 8 7 7 1415 5121 1 0 1 515.788 1029.5614 2 1029.5607 0.0007 0 37.67 0.0037 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5566.5566.2.dta 1 IPI00791341.1 20 kDa protein 173 19686 8 8 7 7 1639 1989 1 0 1 541.285 1080.5554 2 1080.5564 -0.001 1 40.31 0.00025 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2066.2066.2.dta 1 IPI00791341.1 20 kDa protein 173 19686 8 8 7 7 1640 1974 1 0 1 361.1932 1080.5579 3 1080.5564 0.0015 1 41.57 0.00039 K SYKVSTSGPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2050.2050.3.dta 1 IPI00791341.1 20 kDa protein 173 19686 8 8 7 7 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00791341.1 20 kDa protein 173 19686 8 8 7 7 2116 2437 1 0 1 601.3289 1200.6433 2 1200.6462 -0.0029 1 55 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2550.2550.2.dta 1 IPI00791341.1 20 kDa protein 173 19686 8 8 7 7 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00791554.1 17 kDa protein 167 17100 4 4 3 3 984 2452 1 0 0 466.7373 931.46 2 931.461 -0.001 0 47.83 0.00031 K LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2566.2566.2.dta 1 IPI00791554.1 17 kDa protein 167 17100 4 4 3 3 2462 6193 1 0 0 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 IPI00791554.1 17 kDa protein 167 17100 4 4 3 3 2943 3741 1 0 1 693.3727 1384.7309 2 1384.731 -0.0001 1 91.47 3.30E-09 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4041.4041.2.dta 1 IPI00791554.1 17 kDa protein 167 17100 4 4 3 3 2944 3733 1 0 1 462.5843 1384.7309 3 1384.731 0 1 23.19 0.03 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4032.4032.3.dta 1 IPI00174775.2 Keratin 6 irs3 162 59457 6 6 5 5 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00174775.2 Keratin 6 irs3 162 59457 6 6 5 5 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 IPI00174775.2 Keratin 6 irs3 162 59457 6 6 5 5 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00174775.2 Keratin 6 irs3 162 59457 6 6 5 5 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 IPI00174775.2 Keratin 6 irs3 162 59457 6 6 5 5 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 IPI00174775.2 Keratin 6 irs3 162 59457 6 6 5 5 3341 3590 1 0 1 492.9293 1475.766 3 1475.762 0.0041 0 51.95 0.00014 R FLEQQNQVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3878.3878.3.dta 1 IPI00793202.1 14 kDa protein 158 14435 5 5 5 5 1415 5121 1 0 1 515.788 1029.5614 2 1029.5607 0.0007 0 37.67 0.0037 K WSLLQQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5566.5566.2.dta 1 IPI00793202.1 14 kDa protein 158 14435 5 5 5 5 2116 2437 1 0 1 601.3289 1200.6433 2 1200.6462 -0.0029 1 55 6.70E-05 R RQLETLGQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2550.2550.2.dta 1 IPI00793202.1 14 kDa protein 158 14435 5 5 5 5 3086 6622 1 0 1 710.3783 1418.742 2 1418.7405 0.0015 0 72.57 4.90E-07 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7447.7447.2.dta 1 IPI00793202.1 14 kDa protein 158 14435 5 5 5 5 3350 5044 1 0 1 740.8877 1479.7608 2 1479.7643 -0.0034 1 47.82 0.00025 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5474.5474.2.dta 1 IPI00793202.1 14 kDa protein 158 14435 5 5 5 5 4627 4503 1 0 1 899.4183 1796.8221 2 1796.825 -0.0029 1 35.34 0.00049 K DVDEAYMNKVELESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4869.4869.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 148 12922 4 4 4 4 2444 6744 1 0 1 636.8563 1271.6981 2 1271.6973 0.0008 0 97.66 3.00E-09 R SLDLDGIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7593.7593.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 148 12922 4 4 4 4 2842 2397 1 0 1 682.3216 1362.6286 2 1362.631 -0.0023 1 26.46 0.0095 R NTRNEISEMNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2507.2507.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 148 12922 4 4 4 4 3199 3173 1 0 1 721.3904 1440.7662 2 1440.7684 -0.0022 1 55.95 2.70E-05 R LQAEIDNIKNQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3386.3386.2.dta 1 IPI00655639.1 Hypothetical protein (Fragment) 148 12922 4 4 4 4 5581 8033 1 0 1 741.7128 2222.1167 3 2222.114 0.0027 1 29.81 0.0023 R SLDLDGIIAEVKAQYEEMAK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9157.9157.3.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 132 65938 7 7 7 7 8 2081 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 29.03 0.018 K LLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2170.2170.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 132 65938 7 7 7 7 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 132 65938 7 7 7 7 984 2452 1 0 0 466.7373 931.46 2 931.461 -0.001 0 47.83 0.00031 R LLEGEESR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2566.2566.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 132 65938 7 7 7 7 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 132 65938 7 7 7 7 2408 5851 2 0 1 632.3511 1262.6876 2 1262.687 0.0006 0 38.24 0.0023 K LGLDIEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 132 65938 7 7 7 7 3017 5019 1 0 0 699.3744 1396.7343 2 1396.735 -0.0007 1 44.13 0.0003 K TLNNKFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5447.5447.2.dta 1 IPI00300052.1 Keratin type II cuticular Hb4 132 65938 7 7 7 7 3379 4138 1 0 1 497.6118 1489.8135 3 1489.814 -0.0005 1 24.99 0.0051 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4468.4468.3.dta 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 122 23165 3 3 3 3 1815 2449 1 0 1 565.313 1128.6114 2 1128.6138 -0.0024 1 60.17 2.40E-05 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2563.2563.2.dta 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 122 23165 3 3 3 3 1816 5025 1 0 1 565.3141 1128.6137 2 1128.6138 -0.0001 0 86.41 5.50E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5454.5454.2.dta 1 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 122 23165 3 3 3 3 3333 3408 1 0 1 492.5701 1474.6884 3 1474.6908 -0.0024 0 22.67 0.027 R LESGMQNMSIHTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3664.3664.3.dta 1 IPI00793849.1 Protein 122 22010 3 3 3 3 2080 2660 1 0 1 597.7913 1193.5681 2 1193.5676 0.0004 0 57.76 1.40E-05 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2793.2793.2.dta 1 IPI00793849.1 Protein 122 22010 3 3 3 3 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00793849.1 Protein 122 22010 3 3 3 3 3061 4436 1 0 1 470.9149 1409.7229 3 1409.7224 0.0005 1 42.65 0.00038 R TTAENEFVMLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4793.4793.3.dta 1 IPI00290078.5 keratin 4 121 64442 3 3 3 3 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00290078.5 keratin 4 121 64442 3 3 3 3 1721 2888 1 0 0 554.2752 1106.5359 2 1106.5356 0.0003 0 57.6 1.90E-05 R AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3049.3049.2.dta 1 IPI00290078.5 keratin 4 121 64442 3 3 3 3 2462 6193 1 0 0 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 IPI00794362.1 Protein 113 13787 3 3 3 3 1347 1886 1 0 1 508.2347 1014.4549 2 1014.4552 -0.0004 0 29.26 0.0018 K HEISEMNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1957.1957.2.dta 1 IPI00794362.1 Protein 113 13787 3 3 3 3 2080 2660 1 0 1 597.7913 1193.5681 2 1193.5676 0.0004 0 57.76 1.40E-05 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2793.2793.2.dta 1 IPI00794362.1 Protein 113 13787 3 3 3 3 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00376379.3 Keratin 77 106 62050 3 3 3 3 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00376379.3 Keratin 77 106 62050 3 3 3 3 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00376379.3 Keratin 77 106 62050 3 3 3 3 3339 4057 1 0 0 738.3966 1474.7787 2 1474.778 0.0007 0 73.15 1.00E-06 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4382.4382.2.dta 1 IPI00797452.1 33 kDa protein 105 33577 2 2 2 2 1721 2888 1 0 0 554.2752 1106.5359 2 1106.5356 0.0003 0 57.6 1.90E-05 R AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3049.3049.2.dta 1 IPI00797452.1 33 kDa protein 105 33577 2 2 2 2 2462 6193 1 0 0 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 IPI00021751.5 Neurofilament triplet H protein 100 112640 3 3 2 2 1289 2608 1 0 0 503.2368 1004.459 2 1004.4597 -0.0007 0 45.66 0.00012 K LLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2734.2734.2.dta 1 IPI00021751.5 Neurofilament triplet H protein 100 112640 3 3 2 2 1839 2314 1 0 0 567.2833 1132.552 2 1132.5546 -0.0027 1 50.76 7.40E-05 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2419.2419.2.dta 1 IPI00021751.5 Neurofilament triplet H protein 100 112640 3 3 2 2 1840 2319 1 0 0 378.5258 1132.5554 3 1132.5546 0.0008 1 43.95 0.00022 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2424.2424.3.dta 1 IPI00217437.4 Tau-tubulin kinase 99 185741 4 4 4 4 93 7975 1 0 1 323.6983 645.3821 2 645.381 0.0011 1 36.56 0.007 K KIETR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.909.909.2.dta 1 IPI00217437.4 Tau-tubulin kinase 99 185741 4 4 4 4 1815 2449 1 0 1 565.313 1128.6114 2 1128.6138 -0.0024 1 60.17 2.40E-05 R GELAIKDANAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2563.2563.2.dta 1 IPI00217437.4 Tau-tubulin kinase 99 185741 4 4 4 4 1932 4348 1 0 0 577.282 1152.5494 2 1152.5485 0.0009 0 37.93 0.00031 R EYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4693.4693.2.dta 1 IPI00217437.4 Tau-tubulin kinase 99 185741 4 4 4 4 3573 4670 1 0 1 517.6049 1549.7929 3 1549.7922 0.0007 1 29.39 0.0044 R QLREYQELMNVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5055.5055.3.dta 1 IPI00793572.1 6 kDa protein 96 6322 2 2 2 2 3082 6279 1 0 1 709.8679 1417.7213 2 1417.7201 0.0012 0 67.43 6.80E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6992.6992.2.dta 1 IPI00793572.1 6 kDa protein 96 6322 2 2 2 2 5397 6381 1 0 1 696.7042 2087.0907 3 2087.0898 0.0008 1 45.3 7.30E-05 K VELEAKVDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7136.7136.3.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 93 57306 5 5 4 4 8 2081 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 29.03 0.018 K LLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2170.2170.2.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 93 57306 5 5 4 4 2408 5851 2 0 1 632.3511 1262.6876 2 1262.687 0.0006 0 38.24 0.0023 K LGLDIEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 93 57306 5 5 4 4 2764 4225 1 0 1 674.8759 1347.7372 2 1347.7398 -0.0026 1 40.69 0.00052 R ATAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4562.4562.2.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 93 57306 5 5 4 4 2765 4195 2 0 1 450.2537 1347.7393 3 1347.7398 -0.0004 1 45.37 0.00039 R ATAENEFVVLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4530.4530.3.dta 1 IPI00032541.1 Keratin type II cuticular Hb5 93 57306 5 5 4 4 3379 4138 1 0 1 497.6118 1489.8135 3 1489.814 -0.0005 1 24.99 0.0051 R FLEQQNKLLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4468.4468.3.dta 1 IPI00736200.1 "similar to Keratin, type II cytoskeletal 2 oral" 89 36906 1 1 1 1 2408 5851 1 0 0 632.3511 1262.6876 2 1262.687 0.0006 0 88.56 2.10E-08 K LALDVEIATYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00061200.3 Keratin-71 85 57769 3 3 3 3 584 4687 1 0 0 414.2198 826.425 2 826.4225 0.0025 0 41.01 0.0015 K FASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5073.5073.2.dta 1 IPI00061200.3 Keratin-71 85 57769 3 3 3 3 1646 4611 1 0 0 541.8036 1081.5926 2 1081.592 0.0006 1 43 0.00084 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4990.4990.2.dta 1 IPI00061200.3 Keratin-71 85 57769 3 3 3 3 3341 3590 1 0 1 492.9293 1475.766 3 1475.762 0.0041 0 51.95 0.00014 R FLEQQNQVLETK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3878.3878.3.dta 1 IPI00013164.4 Isoform 1 of Peripherin 74 53732 3 3 3 3 984 2452 1 0 0 466.7373 931.46 2 931.461 -0.001 0 47.83 0.00031 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2566.2566.2.dta 1 IPI00013164.4 Isoform 1 of Peripherin 74 53732 3 3 3 3 2603 4914 1 0 1 655.3057 1308.5969 2 1308.5986 -0.0017 0 46.61 4.30E-05 K NLQEAEEWYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5330.5330.2.dta 1 IPI00013164.4 Isoform 1 of Peripherin 74 53732 3 3 3 3 3506 4443 1 0 1 508.9158 1523.7256 3 1523.7256 0 1 15.16 0.04 K NLQEAEEWYKSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4801.4801.3.dta 1 IPI00465084.6 Desmin 71 53560 2 2 2 2 984 2452 1 0 0 466.7373 931.46 2 931.461 -0.001 0 47.83 0.00031 K LLEGEESR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2566.2566.2.dta 1 IPI00465084.6 Desmin 71 53560 2 2 2 2 3515 4409 1 0 1 509.9479 1526.822 3 1526.8205 0.0015 1 47.77 0.00023 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4765.4765.3.dta 1 IPI00025363.1 "Isoform 1 of Glial fibrillary acidic protein, astrocyte" 71 49907 1 1 1 1 2462 6193 1 0 0 639.3596 1276.7047 2 1276.7027 0.002 0 70.62 1.20E-06 K LALDIEIATYR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6893.6893.2.dta 1 IPI00793778.1 Keratin 64 10027 1 1 1 1 2690 7003 1 0 0 665.3696 1328.7247 2 1328.7187 0.006 0 64.1 2.90E-06 R NLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7915.7915.2.dta 1 IPI00182654.5 "Keratin, hair, basic, 1" 50 57059 3 3 3 3 8 2081 1 0 0 302.1898 602.365 2 602.3639 0.0011 0 29.03 0.018 K LLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2170.2170.2.dta 1 IPI00182654.5 "Keratin, hair, basic, 1" 50 57059 3 3 3 3 2408 5851 2 0 1 632.3511 1262.6876 2 1262.687 0.0006 0 38.24 0.0023 K LGLDIEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6470.6470.2.dta 1 IPI00182654.5 "Keratin, hair, basic, 1" 50 57059 3 3 3 3 3379 4138 1 0 1 497.6118 1489.8135 3 1489.814 -0.0005 1 24.99 0.0051 R FLEQQNKLLETK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4468.4468.3.dta 1 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 48 11491 1 1 1 1 3350 5044 1 0 1 740.8877 1479.7608 2 1479.7643 -0.0034 1 47.82 0.00025 R TEMENEFVLIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5474.5474.2.dta 1 IPI00001453.2 Alpha-internexin 48 55528 1 1 1 1 3515 4409 1 0 1 509.9479 1526.822 3 1526.8205 0.0015 1 47.77 0.00023 R HLREYQDLLNVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4765.4765.3.dta 1 IPI00791653.1 8 kDa protein 31 7516 1 1 1 1 389 1979 1 0 1 390.1935 778.3725 2 778.3722 0.0003 0 30.71 0.0034 K AAFGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2055.2055.2.dta 1 IPI00794122.1 13 kDa protein 26 13581 1 1 1 1 2842 2397 1 0 1 682.3216 1362.6286 2 1362.631 -0.0023 1 26.46 0.0095 R NTRNEISEMNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2507.2507.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 487 3560 1 1 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 1225 3387 1 1 1 498.2628 994.5111 2 994.5123 -0.0013 1 25.85 0.049 K IKEWYEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3642.3642.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 1416 4969 1 1 1 516.3032 1030.5919 2 1030.591 0.0009 0 57.82 5.90E-06 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5393.5393.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 1549 3726 1 1 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 1719 1825 1 1 0 553.766 1105.5174 2 1105.5186 -0.0012 0 77.68 3.40E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1892.1892.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 1727 5209 1 1 1 555.2481 1108.4817 2 1108.4825 -0.0008 0 45.64 0.00029 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5664.5664.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 1968 3486 1 1 1 583.2964 1164.5782 2 1164.5775 0.0008 0 49.38 0.00026 R LENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3760.3760.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 2293 3604 1 1 1 412.2314 1233.6724 3 1233.6717 0.0007 1 37.03 0.0029 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3893.3893.3.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 2401 3210 1 1 1 631.8007 1261.5868 2 1261.5899 -0.0031 0 65.29 4.80E-06 R SLLEGEGSSGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3429.3429.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 2933 3749 1 1 1 691.3263 1380.638 2 1380.6408 -0.0028 0 85.76 9.10E-09 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4051.4051.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 2974 4622 1 1 1 695.8434 1389.6723 2 1389.6736 -0.0012 0 105.15 5.50E-10 K QSLEASLAETEGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5001.5001.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 3143 4134 1 1 1 717.887 1433.7594 2 1433.7626 -0.0033 1 48.17 7.30E-05 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4464.4464.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 3144 4119 1 1 1 478.9277 1433.7614 3 1433.7626 -0.0013 1 26.86 0.035 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4448.4448.3.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 3385 2509 1 1 1 747.3706 1492.7267 2 1492.727 -0.0003 1 61.81 8.40E-06 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2627.2627.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 3571 2529 1 1 1 775.3409 1548.6672 2 1548.67 -0.0028 0 21.54 0.0095 R SGGGGGGGGCGGGGGVSSLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2648.2648.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 4381 5212 1 1 1 854.3882 1706.7619 2 1706.7649 -0.003 0 120.53 5.00E-12 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5667.5667.2.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 4623 6851 1 1 1 599.6761 1796.0064 3 1796.0043 0.0021 0 67.49 8.00E-07 R NVQALEIELQSQLALK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7728.7728.3.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 7425 8271 1 1 1 916.145 2745.413 3 2745.4119 0.0011 0 37.97 0.00027 R YCVQLSQIQAQISALEEQLQQIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9431.9431.3.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 7794 7509 1 1 1 958.1357 2871.3852 3 2871.3855 -0.0003 0 59.76 2.50E-06 R NVSTGDVNVEMNAAPGVDLTQLLNNMR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8533.8533.3.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 8101 7876 1 1 1 1018.2137 3051.6192 3 3051.62 -0.0008 1 60.85 2.80E-06 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8965.8965.3.dta 2 1 IPI00009865.1 "Keratin, type I cytoskeletal 10" 762 59711 21 21 19 19 8102 7877 1 1 1 763.9128 3051.6223 4 3051.62 0.0023 1 47.77 5.60E-05 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8967.8967.4.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 240 3263 1 0 1 359.6999 717.3853 2 717.3843 0.001 0 33.25 0.016 K IMADIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3494.3494.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 281 2548 1 0 1 367.6984 733.3822 2 733.3792 0.0029 0 29.95 0.029 K IMADIR A Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2669.2669.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 1169 5136 1 0 1 491.725 981.4355 2 981.4345 0.001 0 33.94 0.0053 R DWSHYFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5582.5582.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 1322 3872 1 0 1 506.7419 1011.4692 2 1011.4695 -0.0003 0 33.67 0.0007 K YETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4183.4183.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 1453 4485 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.86 1.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4849.4849.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 1454 4551 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.89 1.00E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4922.4922.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 1474 2978 1 0 1 523.7781 1045.5416 2 1045.5404 0.0012 0 25.62 0.021 K VIDDTNITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3156.3156.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 2009 2649 1 0 1 587.8269 1173.6393 2 1173.6353 0.0039 1 47.13 0.00029 R KVIDDTNITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2778.2778.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 2308 3693 1 0 1 620.3228 1238.6311 2 1238.6329 -0.0018 1 36.26 0.0012 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3990.3990.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 2309 3692 1 0 1 413.8855 1238.6347 3 1238.6329 0.0018 1 29.36 0.024 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3989.3989.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 2369 2894 1 0 1 628.3199 1254.6253 2 1254.6278 -0.0024 1 42.9 0.00022 R VKYETELAMR Q Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3055.3055.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 2534 4267 1 0 1 431.5785 1291.7137 3 1291.7136 0.0002 1 35.94 0.0019 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4607.4607.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 2645 4131 1 0 1 660.3391 1318.6637 2 1318.6629 0.0007 0 70.55 2.10E-06 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4461.4461.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 3007 2806 1 0 1 698.3695 1394.7245 2 1394.7266 -0.0021 1 50.64 1.80E-05 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2959.2959.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 3087 5706 1 0 1 710.379 1418.7435 2 1418.7405 0.003 0 68.15 3.20E-06 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6294.6294.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 3315 4597 1 0 1 737.3844 1472.7542 2 1472.7583 -0.004 1 35.61 0.0055 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4974.4974.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 3316 4591 1 0 1 491.9274 1472.7603 3 1472.7583 0.002 1 26.29 0.012 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4966.4966.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 3424 2324 1 0 1 502.266 1503.7762 3 1503.7781 -0.0018 1 40.19 0.00018 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2430.2430.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 3433 6070 1 0 1 502.9207 1505.7401 3 1505.7395 0.0006 0 28.88 0.002 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6744.6744.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 3434 6068 1 0 1 753.8777 1505.7408 2 1505.7395 0.0013 0 80.35 2.90E-08 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6741.6741.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 3492 5250 1 0 1 761.8738 1521.733 2 1521.7345 -0.0015 0 66.57 5.70E-07 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5718.5718.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 5342 5764 1 0 1 1030.0497 2058.0848 2 2058.0858 -0.001 1 25.2 0.0043 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6368.6368.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 5343 5757 1 0 1 687.037 2058.0893 3 2058.0858 0.0035 1 64.95 1.50E-06 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6357.6357.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 5520 7970 1 0 1 1089.0916 2176.1686 2 2176.17 -0.0015 1 15.68 0.034 R LQLETEIEALKEELLFMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9080.9080.2.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 5521 7954 1 0 1 726.3979 2176.1718 3 2176.17 0.0018 1 36.57 0.0005 R LQLETEIEALKEELLFMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9061.9061.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 5541 7595 1 0 1 731.7297 2192.1674 3 2192.165 0.0024 1 18.75 0.03 R LQLETEIEALKEELLFMK K Oxidation (M) 0.000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8633.8633.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 7187 8366 1 0 1 890.803 2669.3873 3 2669.3846 0.0027 0 75.41 8.50E-08 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9541.9541.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 7215 7766 1 0 1 896.1341 2685.3805 3 2685.3795 0.0009 0 61.27 6.00E-06 R YALQMEQLNGILLHLESELAQTR A Oxidation (M) 0.00001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8840.8840.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 7402 6327 1 0 1 914.0924 2739.2554 3 2739.2545 0.0009 0 49.22 2.40E-05 R LLEDGEDFNLGDALDSSNSMQTIQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7051.7051.3.dta 2 2 IPI00784347.2 "Keratin, type I cytoskeletal 18" 762 48029 31 31 20 20 7433 5208 1 0 1 688.1058 2748.394 4 2748.393 0.001 1 49.41 5.80E-05 K NHEEEVKGLQAQIASSGLTVEVDAPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5662.5662.4.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 1187 2354 1 0 0 494.7743 987.5341 2 987.5349 -0.0008 1 32.93 0.015 K TIEDLRNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2462.2462.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 1274 2301 1 0 0 501.7305 1001.4465 2 1001.4488 -0.0023 0 36.4 0.0016 R QFTSSSSMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2405.2405.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 1699 6067 1 0 1 548.7693 1095.5241 2 1095.5237 0.0005 0 47.47 0.00023 R DAETWFLSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6739.6739.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 1719 1825 1 0 0 553.766 1105.5174 2 1105.5186 -0.0012 0 77.68 3.40E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1892.1892.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 1720 3311 1 0 0 553.7842 1105.5539 2 1105.555 -0.0011 0 55.23 5.00E-05 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3556.3556.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 2394 2902 1 0 1 420.563 1258.6673 3 1258.6669 0.0004 1 31.51 0.012 R TKYEHELALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3064.3064.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 2396 2355 1 0 1 630.7884 1259.5622 2 1259.563 -0.0007 0 72.63 1.50E-07 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2463.2463.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 2713 3547 1 0 1 669.8347 1337.6548 2 1337.6575 -0.0028 0 84.53 6.20E-08 R APSTYGGGLSVSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3831.3831.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 3137 3414 1 0 0 478.5789 1432.715 3 1432.7157 -0.0007 1 35.53 0.0013 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3672.3672.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 3138 3416 1 0 0 717.3652 1432.7158 2 1432.7157 0 1 85.47 9.70E-09 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3674.3674.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 5356 5970 1 0 1 1032.5746 2063.1346 2 2063.1375 -0.0028 0 95.89 1.60E-09 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6616.6616.2.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 5357 5961 1 0 1 688.7202 2063.1386 3 2063.1375 0.0012 0 80.6 2.80E-08 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6604.6604.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 5527 2939 1 0 1 728.0284 2181.0635 3 2181.0662 -0.0027 1 17.79 0.049 R QTRPILKEQSSSSFSQGQSS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3104.3104.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 5887 5802 1 0 1 769.4323 2305.2749 3 2305.2753 -0.0004 1 79.74 3.30E-08 R NKIIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6412.6412.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 5888 5789 1 0 1 769.4326 2305.2758 3 2305.2753 0.0005 1 86.64 7.50E-09 R NKIIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6397.6397.3.dta 2 3 IPI00217963.3 "Keratin, type I cytoskeletal 16" 756 51578 21 21 18 18 6066 3398 1 0 1 784.0353 2349.084 3 2349.0833 0.0007 0 25.56 0.004 R LLEGEDAHLSSQQASGQSYSSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3654.3654.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 194 4593 1 0 0 350.7339 699.4532 2 699.4531 0.0001 0 35.39 0.00095 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4968.4968.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 934 1412 1 0 1 461.2233 920.432 2 920.4312 0.0008 0 49.8 0.00021 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1441.1441.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 1213 3609 1 0 1 497.7165 993.4184 2 993.4192 -0.0008 0 30.1 0.0019 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3898.3898.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 1257 7757 1 0 1 499.7546 997.4947 2 997.4941 0.0006 0 45.36 0.00016 R EQVHQTTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.883.883.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 1538 2460 1 0 1 531.7531 1061.4916 2 1061.4924 -0.0008 0 67.24 3.40E-06 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2575.2575.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 1612 1544 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 47.82 0.00023 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1582.1582.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 2233 2929 1 0 0 611.8239 1221.6333 2 1221.6353 -0.0021 1 38.93 0.00049 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3093.3093.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 2234 2918 1 0 0 408.219 1221.6352 3 1221.6353 -0.0001 1 45.88 0.00062 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3081.3081.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 2318 2681 1 0 0 621.7798 1241.5451 2 1241.5458 -0.0007 0 60.29 2.20E-06 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2816.2816.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 2743 3996 1 0 1 673.3455 1344.6765 2 1344.6772 -0.0007 0 83.77 2.60E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4317.4317.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 2827 2833 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.53 1.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2988.2988.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 3035 3769 1 0 1 702.342 1402.6695 2 1402.6688 0.0007 0 81.09 2.50E-08 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4072.4072.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 4134 4229 1 0 1 830.4495 1658.8844 2 1658.8839 0.0005 1 69.51 3.00E-07 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4566.4566.2.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 4931 2936 1 0 1 629.6428 1885.9065 3 1885.913 -0.0065 1 52.01 1.60E-05 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3101.3101.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 5361 6548 1 0 1 690.0519 2067.134 3 2067.1324 0.0016 0 14.89 0.04 K ILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7356.7356.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 5428 3797 1 0 0 702.0208 2103.0406 3 2103.0444 -0.0037 1 72.15 1.70E-07 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4102.4102.3.dta 2 4 IPI00450768.7 "Keratin, type I cytoskeletal 17" 720 48361 22 22 20 20 5481 7317 1 0 1 717.3727 2149.0962 3 2149.0976 -0.0014 1 21.8 0.009 R ADLEMQIENLKEELAYLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8299.8299.3.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 194 4593 1 0 0 350.7339 699.4532 2 699.4531 0.0001 0 35.39 0.00095 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4968.4968.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 1187 2354 1 0 0 494.7743 987.5341 2 987.5349 -0.0008 1 32.93 0.015 K TIEDLRNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2462.2462.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 1274 2301 1 0 0 501.7305 1001.4465 2 1001.4488 -0.0023 0 36.4 0.0016 R QFTSSSSMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2405.2405.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 1719 1825 1 0 0 553.766 1105.5174 2 1105.5186 -0.0012 0 77.68 3.40E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1892.1892.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 1720 3311 1 0 0 553.7842 1105.5539 2 1105.555 -0.0011 0 55.23 5.00E-05 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3556.3556.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 2318 2681 1 0 0 621.7798 1241.5451 2 1241.5458 -0.0007 0 60.29 2.20E-06 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2816.2816.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 2419 3729 1 0 1 422.894 1265.6601 3 1265.6615 -0.0014 1 42.29 0.001 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4028.4028.3.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 2827 2833 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.53 1.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2988.2988.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 3109 3484 1 0 1 713.3516 1424.6887 2 1424.6896 -0.0009 0 60.51 2.10E-06 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3758.3758.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 3137 3414 1 0 0 478.5789 1432.715 3 1432.7157 -0.0007 1 35.53 0.0013 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3672.3672.3.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 3138 3416 1 0 0 717.3652 1432.7158 2 1432.7157 0 1 85.47 9.70E-09 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3674.3674.2.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 4492 4144 1 0 1 581.3015 1740.8825 3 1740.8835 -0.001 1 31.06 0.0012 R QRPAEIKDYSPYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4475.4475.3.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 5323 6277 1 0 1 685.379 2053.1153 3 2053.1167 -0.0015 0 31.94 0.0016 K ILTATVDNANVLLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6990.6990.3.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 5428 3797 1 0 0 702.0208 2103.0406 3 2103.0444 -0.0037 1 72.15 1.70E-07 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4102.4102.3.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 5899 3921 1 0 1 770.3594 2308.0563 3 2308.0567 -0.0004 0 50.24 1.90E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4237.4237.3.dta 2 5 IPI00384444.5 "Keratin, type I cytoskeletal 14" 647 51875 21 21 20 20 7396 407 1 0 1 913.4481 2737.3225 3 2737.3237 -0.0012 0 22.2 0.0098 R YCMQLAQIQEMIGSVEEQLAQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.10552.10552.3.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 1147 2296 2 0 1 488.2636 974.5127 2 974.5145 -0.0018 1 45.92 0.00097 R SEVTDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2400.2400.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 1223 1367 1 0 1 498.2557 994.4969 2 994.4944 0.0024 0 55.64 1.00E-05 R APSIHGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1393.1393.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 1308 3197 1 0 1 336.8467 1007.5182 3 1007.5188 -0.0006 1 25.54 0.034 K IRDWYQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3414.3414.3.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 1453 4485 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.86 1.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4849.4849.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 1454 4551 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.89 1.00E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4922.4922.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 2233 2929 1 0 0 611.8239 1221.6333 2 1221.6353 -0.0021 1 38.93 0.00049 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3093.3093.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 2234 2918 1 0 0 408.219 1221.6352 3 1221.6353 -0.0001 1 45.88 0.00062 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3081.3081.3.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 2247 2831 1 0 1 614.3 1226.5854 2 1226.5891 -0.0037 0 49.83 9.00E-05 K NHEEEISTLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2986.2986.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 2853 4118 1 0 1 683.3567 1364.6989 2 1364.7048 -0.0058 1 63.01 1.00E-05 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4447.4447.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 2854 4120 2 0 1 455.9084 1364.7035 3 1364.7048 -0.0013 1 27.44 0.037 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4449.4449.3.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 3580 4240 1 0 1 777.8785 1553.7425 2 1553.7434 -0.0009 0 110.78 4.20E-11 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4578.4578.2.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 4674 7045 1 0 1 606.6608 1816.9607 3 1816.9604 0.0002 0 48.57 2.80E-05 R TLQGLEIELQSQLSMK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7967.7967.3.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 5037 4817 1 0 1 639.9698 1916.8875 3 1916.8904 -0.0029 1 18.19 0.041 R DYSHYYTTIQDLRDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5220.5220.3.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 5593 3667 1 0 1 557.7723 2227.0603 4 2227.0651 -0.0049 1 38.03 0.00027 R TEELNREVAGHTEQLQMSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3962.3962.4.dta 2 6 IPI00479145.2 "Keratin, type I cytoskeletal 19" 514 44065 18 18 14 14 5594 3669 1 0 1 743.3614 2227.0623 3 2227.0651 -0.0028 1 52.37 3.50E-05 R TEELNREVAGHTEQLQMSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3964.3964.3.dta 2 7 IPI00297641.1 "Keratin, type I cuticular Ha8" 37 52054 2 2 2 2 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 K LAADDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 7 IPI00297641.1 "Keratin, type I cuticular Ha8" 37 52054 2 2 2 2 2854 4120 1 0 1 455.9084 1364.7035 3 1364.7048 -0.0013 1 29.7 0.022 K TRLENEIATYR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4449.4449.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 240 3263 1 0 1 359.6999 717.3853 2 717.3843 0.001 0 33.25 0.016 K IMADIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3494.3494.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 281 2548 1 0 1 367.6984 733.3822 2 733.3792 0.0029 0 29.95 0.029 K IMADIR A Oxidation (M) 0.010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2669.2669.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 1169 5136 1 0 1 491.725 981.4355 2 981.4345 0.001 0 33.94 0.0053 R DWSHYFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5582.5582.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 1322 3872 1 0 1 506.7419 1011.4692 2 1011.4695 -0.0003 0 33.67 0.0007 K YETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4183.4183.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 1453 4485 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.86 1.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4849.4849.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 1454 4551 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.89 1.00E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4922.4922.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 1474 2978 1 0 1 523.7781 1045.5416 2 1045.5404 0.0012 0 25.62 0.021 K VIDDTNITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3156.3156.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 2009 2649 1 0 1 587.8269 1173.6393 2 1173.6353 0.0039 1 47.13 0.00029 R KVIDDTNITR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2778.2778.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 2308 3693 1 0 1 620.3228 1238.6311 2 1238.6329 -0.0018 1 36.26 0.0012 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3990.3990.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 2309 3692 1 0 1 413.8855 1238.6347 3 1238.6329 0.0018 1 29.36 0.024 R VKYETELAMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3989.3989.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 2369 2894 1 0 1 628.3199 1254.6253 2 1254.6278 -0.0024 1 42.9 0.00022 R VKYETELAMR Q Oxidation (M) 0.0000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3055.3055.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 2534 4267 1 0 1 431.5785 1291.7137 3 1291.7136 0.0002 1 35.94 0.0019 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4607.4607.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 2645 4131 1 0 1 660.3391 1318.6637 2 1318.6629 0.0007 0 70.55 2.10E-06 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4461.4461.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 3007 2806 1 0 1 698.3695 1394.7245 2 1394.7266 -0.0021 1 50.64 1.80E-05 R QSVENDIHGLRK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2959.2959.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 3087 5706 1 0 1 710.379 1418.7435 2 1418.7405 0.003 0 68.15 3.20E-06 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6294.6294.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 3315 4597 1 0 1 737.3844 1472.7542 2 1472.7583 -0.004 1 35.61 0.0055 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4974.4974.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 3316 4591 1 0 1 491.9274 1472.7603 3 1472.7583 0.002 1 26.29 0.012 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4966.4966.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 3424 2324 1 0 1 502.266 1503.7762 3 1503.7781 -0.0018 1 40.19 0.00018 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2430.2430.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 3433 6070 1 0 1 502.9207 1505.7401 3 1505.7395 0.0006 0 28.88 0.002 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6744.6744.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 3434 6068 1 0 1 753.8777 1505.7408 2 1505.7395 0.0013 0 80.35 2.90E-08 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6741.6741.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 3492 5250 1 0 1 761.8738 1521.733 2 1521.7345 -0.0015 0 66.57 5.70E-07 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5718.5718.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 5342 5764 1 0 1 1030.0497 2058.0848 2 2058.0858 -0.001 1 25.2 0.0043 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6368.6368.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 5343 5757 1 0 1 687.037 2058.0893 3 2058.0858 0.0035 1 64.95 1.50E-06 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6357.6357.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 5520 7970 1 0 1 1089.0916 2176.1686 2 2176.17 -0.0015 1 15.68 0.034 R LQLETEIEALKEELLFMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9080.9080.2.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 5521 7954 1 0 1 726.3979 2176.1718 3 2176.17 0.0018 1 36.57 0.0005 R LQLETEIEALKEELLFMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9061.9061.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 5541 7595 1 0 1 731.7297 2192.1674 3 2192.165 0.0024 1 18.75 0.03 R LQLETEIEALKEELLFMK K Oxidation (M) 0.000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8633.8633.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 7187 8366 1 0 1 890.803 2669.3873 3 2669.3846 0.0027 0 75.41 8.50E-08 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9541.9541.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 7215 7766 1 0 1 896.1341 2685.3805 3 2685.3795 0.0009 0 61.27 6.00E-06 R YALQMEQLNGILLHLESELAQTR A Oxidation (M) 0.00001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8840.8840.3.dta 2 IPI00554788.4 49 kDa protein 732 48793 30 30 19 19 7402 6327 1 0 1 914.0924 2739.2554 3 2739.2545 0.0009 0 49.22 2.40E-05 R LLEDGEDFNLGDALDSSNSMQTIQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7051.7051.3.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 1225 3387 1 0 1 498.2628 994.5111 2 994.5123 -0.0013 1 25.85 0.049 K IKEWYEK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3642.3642.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 1416 4969 1 0 1 516.3032 1030.5919 2 1030.591 0.0009 0 57.82 5.90E-06 R VLDELTLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5393.5393.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 1719 1825 1 0 0 553.766 1105.5174 2 1105.5186 -0.0012 0 77.68 3.40E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1892.1892.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 1727 5209 1 0 1 555.2481 1108.4817 2 1108.4825 -0.0008 0 45.64 0.00029 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5664.5664.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 1968 3486 1 0 1 583.2964 1164.5782 2 1164.5775 0.0008 0 49.38 0.00026 R LENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3760.3760.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 2293 3604 1 0 1 412.2314 1233.6724 3 1233.6717 0.0007 1 37.03 0.0029 R LKYENEVALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3893.3893.3.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 2933 3749 1 0 1 691.3263 1380.638 2 1380.6408 -0.0028 0 85.76 9.10E-09 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4051.4051.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 2974 4622 1 0 1 695.8434 1389.6723 2 1389.6736 -0.0012 0 105.15 5.50E-10 K QSLEASLAETEGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5001.5001.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 3143 4134 1 0 1 717.887 1433.7594 2 1433.7626 -0.0033 1 48.17 7.30E-05 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4464.4464.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 3144 4119 1 0 1 478.9277 1433.7614 3 1433.7626 -0.0013 1 26.86 0.035 K IRLENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4448.4448.3.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 3385 2509 1 0 1 747.3706 1492.7267 2 1492.727 -0.0003 1 61.81 8.40E-06 R SQYEQLAEQNRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2627.2627.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 4381 5212 1 0 1 854.3882 1706.7619 2 1706.7649 -0.003 0 120.53 5.00E-12 K GSLGGGFSSGGFSGGSFSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5667.5667.2.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 4623 6851 1 0 1 599.6761 1796.0064 3 1796.0043 0.0021 0 67.49 8.00E-07 R NVQALEIELQSQLALK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7728.7728.3.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 7425 8271 1 0 1 916.145 2745.413 3 2745.4119 0.0011 0 37.97 0.00027 R YCVQLSQIQAQISALEEQLQQIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9431.9431.3.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 7794 7509 1 0 1 958.1357 2871.3852 3 2871.3855 -0.0003 0 59.76 2.50E-06 R NVSTGDVNVEMNAAPGVDLTQLLNNMR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8533.8533.3.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 8101 7876 1 0 1 1018.2137 3051.6192 3 3051.62 -0.0008 1 60.85 2.80E-06 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8965.8965.3.dta 2 IPI00383111.2 57 kDa protein 714 56699 19 19 17 17 8102 7877 1 0 1 763.9128 3051.6223 4 3051.62 0.0023 1 47.77 5.60E-05 K TIDDLKNQILNLTTDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8967.8967.4.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 194 4593 1 0 0 350.7339 699.4532 2 699.4531 0.0001 0 35.39 0.00095 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4968.4968.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 1213 3609 1 0 1 497.7165 993.4184 2 993.4192 -0.0008 0 30.1 0.0019 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3898.3898.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 1257 7757 1 0 1 499.7546 997.4947 2 997.4941 0.0006 0 45.36 0.00016 R EQVHQTTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.883.883.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 2233 2929 1 0 0 611.8239 1221.6333 2 1221.6353 -0.0021 1 38.93 0.00049 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3093.3093.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 2234 2918 1 0 0 408.219 1221.6352 3 1221.6353 -0.0001 1 45.88 0.00062 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3081.3081.3.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 2318 2681 1 0 0 621.7798 1241.5451 2 1241.5458 -0.0007 0 60.29 2.20E-06 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2816.2816.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 2827 2833 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.53 1.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2988.2988.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 3035 3769 1 0 1 702.342 1402.6695 2 1402.6688 0.0007 0 81.09 2.50E-08 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4072.4072.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 4134 4229 1 0 1 830.4495 1658.8844 2 1658.8839 0.0005 1 69.51 3.00E-07 R TIVEEVQDGKVISSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4566.4566.2.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 5361 6548 1 0 1 690.0519 2067.134 3 2067.1324 0.0016 0 14.89 0.04 K ILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7356.7356.3.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 5428 3797 1 0 0 702.0208 2103.0406 3 2103.0444 -0.0037 1 72.15 1.70E-07 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4102.4102.3.dta 2 IPI00747707.1 KRT17 protein 504 41332 16 16 15 15 5481 7317 1 0 1 717.3727 2149.0962 3 2149.0976 -0.0014 1 21.8 0.009 R ADLEMQIENLKEELAYLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8299.8299.3.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 934 1412 1 0 1 461.2233 920.432 2 920.4312 0.0008 0 49.8 0.00021 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1441.1441.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 1213 3609 1 0 1 497.7165 993.4184 2 993.4192 -0.0008 0 30.1 0.0019 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3898.3898.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 1538 2460 1 0 1 531.7531 1061.4916 2 1061.4924 -0.0008 0 67.24 3.40E-06 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2575.2575.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 1612 1544 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 47.82 0.00023 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1582.1582.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 2233 2929 1 0 0 611.8239 1221.6333 2 1221.6353 -0.0021 1 38.93 0.00049 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3093.3093.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 2234 2918 1 0 0 408.219 1221.6352 3 1221.6353 -0.0001 1 45.88 0.00062 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3081.3081.3.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 2318 2681 1 0 0 621.7798 1241.5451 2 1241.5458 -0.0007 0 60.29 2.20E-06 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2816.2816.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 2743 3996 1 0 1 673.3455 1344.6765 2 1344.6772 -0.0007 0 83.77 2.60E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4317.4317.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 2827 2833 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.53 1.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2988.2988.2.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 4931 2936 1 0 1 629.6428 1885.9065 3 1885.913 -0.0065 1 52.01 1.60E-05 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3101.3101.3.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 5361 6548 1 0 1 690.0519 2067.134 3 2067.1324 0.0016 0 14.89 0.04 K ILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7356.7356.3.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 5428 3797 1 0 0 702.0208 2103.0406 3 2103.0444 -0.0037 1 72.15 1.70E-07 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4102.4102.3.dta 2 IPI00791852.1 42 kDa protein 493 41729 16 16 14 14 5481 7317 1 0 1 717.3727 2149.0962 3 2149.0976 -0.0014 1 21.8 0.009 R ADLEMQIENLKEELAYLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8299.8299.3.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 194 4593 1 0 0 350.7339 699.4532 2 699.4531 0.0001 0 35.39 0.00095 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4968.4968.2.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 2318 2681 1 0 0 621.7798 1241.5451 2 1241.5458 -0.0007 0 60.29 2.20E-06 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2816.2816.2.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 2827 2833 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.53 1.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2988.2988.2.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 3137 3414 1 0 0 478.5789 1432.715 3 1432.7157 -0.0007 1 35.53 0.0013 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3672.3672.3.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 3138 3416 1 0 0 717.3652 1432.7158 2 1432.7157 0 1 85.47 9.70E-09 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3674.3674.2.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 5428 3797 1 0 0 702.0208 2103.0406 3 2103.0444 -0.0037 1 72.15 1.70E-07 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4102.4102.3.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 5899 3921 1 0 1 770.3594 2308.0563 3 2308.0567 -0.0004 0 50.24 1.90E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4237.4237.3.dta 2 IPI00792454.1 30 kDa protein 396 30075 10 10 9 9 7396 407 1 0 1 913.4481 2737.3225 3 2737.3237 -0.0012 0 22.2 0.0098 R YCMQLAQIQEMIGSVEEQLAQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.10552.10552.3.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 934 1412 1 0 1 461.2233 920.432 2 920.4312 0.0008 0 49.8 0.00021 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1441.1441.2.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 1213 3609 1 0 1 497.7165 993.4184 2 993.4192 -0.0008 0 30.1 0.0019 R DYSQYYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3898.3898.2.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 1538 2460 1 0 1 531.7531 1061.4916 2 1061.4924 -0.0008 0 67.24 3.40E-06 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2575.2575.2.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 1612 1544 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 47.82 0.00023 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1582.1582.2.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 2827 2833 1 0 0 681.3482 1360.6819 2 1360.6834 -0.0016 0 85.53 1.00E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2988.2988.2.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 3035 3769 1 0 1 702.342 1402.6695 2 1402.6688 0.0007 0 81.09 2.50E-08 K ASLEGNLAETENR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4072.4072.2.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 4931 2936 1 0 1 629.6428 1885.9065 3 1885.913 -0.0065 1 52.01 1.60E-05 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3101.3101.3.dta 2 IPI00180956.6 49 kDa protein 388 49001 10 10 9 9 5428 3797 1 0 0 702.0208 2103.0406 3 2103.0444 -0.0037 1 72.15 1.70E-07 K TEELNREVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4102.4102.3.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 934 1412 1 0 1 461.2233 920.432 2 920.4312 0.0008 0 49.8 0.00021 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1441.1441.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 1213 3609 1 0 1 497.7165 993.4184 2 993.4192 -0.0008 0 30.1 0.0019 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3898.3898.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 1538 2460 1 0 1 531.7531 1061.4916 2 1061.4924 -0.0008 0 67.24 3.40E-06 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2575.2575.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 1612 1544 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 47.82 0.00023 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1582.1582.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 2233 2929 1 0 0 611.8239 1221.6333 2 1221.6353 -0.0021 1 38.93 0.00049 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3093.3093.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 2234 2918 1 0 0 408.219 1221.6352 3 1221.6353 -0.0001 1 45.88 0.00062 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3081.3081.3.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 2318 2681 1 0 0 621.7798 1241.5451 2 1241.5458 -0.0007 0 60.29 2.20E-06 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2816.2816.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 2743 3996 1 0 1 673.3455 1344.6765 2 1344.6772 -0.0007 0 83.77 2.60E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4317.4317.2.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 4931 2936 1 0 1 629.6428 1885.9065 3 1885.913 -0.0065 1 52.01 1.60E-05 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3101.3101.3.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 5361 6548 1 0 1 690.0519 2067.134 3 2067.1324 0.0016 0 14.89 0.04 K ILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7356.7356.3.dta 2 IPI00791156.1 31 kDa protein 371 30866 14 14 12 12 5481 7317 1 0 1 717.3727 2149.0962 3 2149.0976 -0.0014 1 21.8 0.009 R ADLEMQIENLKEELAYLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8299.8299.3.dta 2 IPI00794644.1 21 kDa protein 328 20831 9 9 7 7 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00794644.1 21 kDa protein 328 20831 9 9 7 7 1223 1367 1 0 1 498.2557 994.4969 2 994.4944 0.0024 0 55.64 1.00E-05 R APSIHGGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1393.1393.2.dta 2 IPI00794644.1 21 kDa protein 328 20831 9 9 7 7 1453 4485 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.86 1.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4849.4849.2.dta 2 IPI00794644.1 21 kDa protein 328 20831 9 9 7 7 1454 4551 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.89 1.00E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4922.4922.2.dta 2 IPI00794644.1 21 kDa protein 328 20831 9 9 7 7 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00794644.1 21 kDa protein 328 20831 9 9 7 7 2233 2929 1 0 0 611.8239 1221.6333 2 1221.6353 -0.0021 1 38.93 0.00049 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3093.3093.2.dta 2 IPI00794644.1 21 kDa protein 328 20831 9 9 7 7 2234 2918 1 0 0 408.219 1221.6352 3 1221.6353 -0.0001 1 45.88 0.00062 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3081.3081.3.dta 2 IPI00794644.1 21 kDa protein 328 20831 9 9 7 7 2247 2831 1 0 1 614.3 1226.5854 2 1226.5891 -0.0037 0 49.83 9.00E-05 K NHEEEISTLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2986.2986.2.dta 2 IPI00794644.1 21 kDa protein 328 20831 9 9 7 7 3580 4240 1 0 1 777.8785 1553.7425 2 1553.7434 -0.0009 0 110.78 4.20E-11 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4578.4578.2.dta 2 IPI00794807.1 15 kDa protein 301 15435 7 7 4 4 2534 4267 1 0 1 431.5785 1291.7137 3 1291.7136 0.0002 1 35.94 0.0019 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4607.4607.3.dta 2 IPI00794807.1 15 kDa protein 301 15435 7 7 4 4 3087 5706 1 0 1 710.379 1418.7435 2 1418.7405 0.003 0 68.15 3.20E-06 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6294.6294.2.dta 2 IPI00794807.1 15 kDa protein 301 15435 7 7 4 4 3433 6070 1 0 1 502.9207 1505.7401 3 1505.7395 0.0006 0 28.88 0.002 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6744.6744.3.dta 2 IPI00794807.1 15 kDa protein 301 15435 7 7 4 4 3434 6068 1 0 1 753.8777 1505.7408 2 1505.7395 0.0013 0 80.35 2.90E-08 R TVQSLEIDLDSMR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6741.6741.2.dta 2 IPI00794807.1 15 kDa protein 301 15435 7 7 4 4 3492 5250 1 0 1 761.8738 1521.733 2 1521.7345 -0.0015 0 66.57 5.70E-07 R TVQSLEIDLDSMR N Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5718.5718.2.dta 2 IPI00794807.1 15 kDa protein 301 15435 7 7 4 4 7187 8366 1 0 1 890.803 2669.3873 3 2669.3846 0.0027 0 75.41 8.50E-08 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9541.9541.3.dta 2 IPI00794807.1 15 kDa protein 301 15435 7 7 4 4 7215 7766 1 0 1 896.1341 2685.3805 3 2685.3795 0.0009 0 61.27 6.00E-06 R YALQMEQLNGILLHLESELAQTR A Oxidation (M) 0.00001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8840.8840.3.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 934 1412 1 0 1 461.2233 920.432 2 920.4312 0.0008 0 49.8 0.00021 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1441.1441.2.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 1213 3609 1 0 1 497.7165 993.4184 2 993.4192 -0.0008 0 30.1 0.0019 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3898.3898.2.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 1538 2460 1 0 1 531.7531 1061.4916 2 1061.4924 -0.0008 0 67.24 3.40E-06 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2575.2575.2.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 1612 1544 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 47.82 0.00023 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1582.1582.2.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 2743 3996 1 0 1 673.3455 1344.6765 2 1344.6772 -0.0007 0 83.77 2.60E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4317.4317.2.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 4931 2936 1 0 1 629.6428 1885.9065 3 1885.913 -0.0065 1 52.01 1.60E-05 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3101.3101.3.dta 2 IPI00794047.1 18 kDa protein 278 18209 10 10 9 9 5361 6548 1 0 1 690.0519 2067.134 3 2067.1324 0.0016 0 14.89 0.04 K ILTATVDNANILLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7356.7356.3.dta 2 IPI00794731.1 15 kDa protein 238 15182 7 7 6 6 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00794731.1 15 kDa protein 238 15182 7 7 6 6 2396 2355 1 0 1 630.7884 1259.5622 2 1259.563 -0.0007 0 72.63 1.50E-07 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2463.2463.2.dta 2 IPI00794731.1 15 kDa protein 238 15182 7 7 6 6 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 IPI00794731.1 15 kDa protein 238 15182 7 7 6 6 3137 3414 1 0 0 478.5789 1432.715 3 1432.7157 -0.0007 1 35.53 0.0013 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3672.3672.3.dta 2 IPI00794731.1 15 kDa protein 238 15182 7 7 6 6 3138 3416 1 0 0 717.3652 1432.7158 2 1432.7157 0 1 85.47 9.70E-09 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3674.3674.2.dta 2 IPI00794731.1 15 kDa protein 238 15182 7 7 6 6 5527 2939 1 0 1 728.0284 2181.0635 3 2181.0662 -0.0027 1 17.79 0.049 R QTRPILKEQSSSSFSQGQSS - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3104.3104.3.dta 2 IPI00794731.1 15 kDa protein 238 15182 7 7 6 6 6066 3398 1 0 1 784.0353 2349.084 3 2349.0833 0.0007 0 25.56 0.004 R LLEGEDAHLSSQQASGQSYSSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3654.3654.3.dta 2 IPI00789750.1 27 kDa protein 236 26775 7 7 7 7 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00789750.1 27 kDa protein 236 26775 7 7 7 7 1274 2301 1 0 0 501.7305 1001.4465 2 1001.4488 -0.0023 0 36.4 0.0016 R QFTSSSSMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2405.2405.2.dta 2 IPI00789750.1 27 kDa protein 236 26775 7 7 7 7 1719 1825 1 0 0 553.766 1105.5174 2 1105.5186 -0.0012 0 77.68 3.40E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1892.1892.2.dta 2 IPI00789750.1 27 kDa protein 236 26775 7 7 7 7 1720 3311 1 0 0 553.7842 1105.5539 2 1105.555 -0.0011 0 55.23 5.00E-05 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3556.3556.2.dta 2 IPI00789750.1 27 kDa protein 236 26775 7 7 7 7 2318 2681 1 0 0 621.7798 1241.5451 2 1241.5458 -0.0007 0 60.29 2.20E-06 K NHEEEMNALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2816.2816.2.dta 2 IPI00789750.1 27 kDa protein 236 26775 7 7 7 7 2419 3729 1 0 1 422.894 1265.6601 3 1265.6615 -0.0014 1 42.29 0.001 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4028.4028.3.dta 2 IPI00789750.1 27 kDa protein 236 26775 7 7 7 7 3109 3484 1 0 1 713.3516 1424.6887 2 1424.6896 -0.0009 0 60.51 2.10E-06 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3758.3758.2.dta 2 IPI00790191.1 25 kDa protein 232 25322 8 8 6 6 1147 2296 2 0 1 488.2636 974.5127 2 974.5145 -0.0018 1 45.92 0.00097 R SEVTDLRR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2400.2400.2.dta 2 IPI00790191.1 25 kDa protein 232 25322 8 8 6 6 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00790191.1 25 kDa protein 232 25322 8 8 6 6 2247 2831 1 0 1 614.3 1226.5854 2 1226.5891 -0.0037 0 49.83 9.00E-05 K NHEEEISTLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2986.2986.2.dta 2 IPI00790191.1 25 kDa protein 232 25322 8 8 6 6 2853 4118 1 0 1 683.3567 1364.6989 2 1364.7048 -0.0058 1 63.01 1.00E-05 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4447.4447.2.dta 2 IPI00790191.1 25 kDa protein 232 25322 8 8 6 6 2854 4120 2 0 1 455.9084 1364.7035 3 1364.7048 -0.0013 1 27.44 0.037 K SRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4449.4449.3.dta 2 IPI00790191.1 25 kDa protein 232 25322 8 8 6 6 4674 7045 1 0 1 606.6608 1816.9607 3 1816.9604 0.0002 0 48.57 2.80E-05 R TLQGLEIELQSQLSMK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7967.7967.3.dta 2 IPI00790191.1 25 kDa protein 232 25322 8 8 6 6 5593 3667 1 0 1 557.7723 2227.0603 4 2227.0651 -0.0049 1 38.03 0.00027 R TEELNREVAGHTEQLQMSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3962.3962.4.dta 2 IPI00790191.1 25 kDa protein 232 25322 8 8 6 6 5594 3669 1 0 1 743.3614 2227.0623 3 2227.0651 -0.0028 1 52.37 3.50E-05 R TEELNREVAGHTEQLQMSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3964.3964.3.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 229 17892 7 7 6 6 194 4593 1 0 0 350.7339 699.4532 2 699.4531 0.0001 0 35.39 0.00095 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4968.4968.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 229 17892 7 7 6 6 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 229 17892 7 7 6 6 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 229 17892 7 7 6 6 3137 3414 1 0 0 478.5789 1432.715 3 1432.7157 -0.0007 1 35.53 0.0013 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3672.3672.3.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 229 17892 7 7 6 6 3138 3416 1 0 0 717.3652 1432.7158 2 1432.7157 0 1 85.47 9.70E-09 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3674.3674.2.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 229 17892 7 7 6 6 5899 3921 1 0 1 770.3594 2308.0563 3 2308.0567 -0.0004 0 50.24 1.90E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4237.4237.3.dta 2 IPI00654614.1 Epidermal type I keratin (Fragment) 229 17892 7 7 6 6 7396 407 1 0 1 913.4481 2737.3225 3 2737.3237 -0.0012 0 22.2 0.0098 R YCMQLAQIQEMIGSVEEQLAQLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.10552.10552.3.dta 2 IPI00794267.1 18 kDa protein 217 18099 7 7 5 5 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00794267.1 18 kDa protein 217 18099 7 7 5 5 1169 5136 1 0 1 491.725 981.4355 2 981.4345 0.001 0 33.94 0.0053 R DWSHYFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5582.5582.2.dta 2 IPI00794267.1 18 kDa protein 217 18099 7 7 5 5 1453 4485 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.86 1.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4849.4849.2.dta 2 IPI00794267.1 18 kDa protein 217 18099 7 7 5 5 1454 4551 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.89 1.00E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4922.4922.2.dta 2 IPI00794267.1 18 kDa protein 217 18099 7 7 5 5 2645 4131 1 0 1 660.3391 1318.6637 2 1318.6629 0.0007 0 70.55 2.10E-06 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4461.4461.2.dta 2 IPI00794267.1 18 kDa protein 217 18099 7 7 5 5 5342 5764 1 0 1 1030.0497 2058.0848 2 2058.0858 -0.001 1 25.2 0.0043 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6368.6368.2.dta 2 IPI00794267.1 18 kDa protein 217 18099 7 7 5 5 5343 5757 1 0 1 687.037 2058.0893 3 2058.0858 0.0035 1 64.95 1.50E-06 K IIEDLRAQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6357.6357.3.dta 2 IPI00789536.1 MGC102966 protein 210 15752 5 5 4 4 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00789536.1 MGC102966 protein 210 15752 5 5 4 4 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 IPI00789536.1 MGC102966 protein 210 15752 5 5 4 4 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00789536.1 MGC102966 protein 210 15752 5 5 4 4 5356 5970 1 0 1 1032.5746 2063.1346 2 2063.1375 -0.0028 0 95.89 1.60E-09 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6616.6616.2.dta 2 IPI00789536.1 MGC102966 protein 210 15752 5 5 4 4 5357 5961 1 0 1 688.7202 2063.1386 3 2063.1375 0.0012 0 80.6 2.80E-08 K IIAATIENAQPILQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6604.6604.3.dta 2 IPI00184195.2 19 kDa protein 204 18696 9 9 7 7 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00184195.2 19 kDa protein 204 18696 9 9 7 7 1308 3197 1 0 1 336.8467 1007.5182 3 1007.5188 -0.0006 1 25.54 0.034 K IRDWYQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3414.3414.3.dta 2 IPI00184195.2 19 kDa protein 204 18696 9 9 7 7 1453 4485 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.86 1.20E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4849.4849.2.dta 2 IPI00184195.2 19 kDa protein 204 18696 9 9 7 7 1454 4551 1 0 0 521.3062 1040.5979 2 1040.5978 0 0 57.89 1.00E-05 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4922.4922.2.dta 2 IPI00184195.2 19 kDa protein 204 18696 9 9 7 7 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00184195.2 19 kDa protein 204 18696 9 9 7 7 2233 2929 1 0 0 611.8239 1221.6333 2 1221.6353 -0.0021 1 38.93 0.00049 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3093.3093.2.dta 2 IPI00184195.2 19 kDa protein 204 18696 9 9 7 7 2234 2918 1 0 0 408.219 1221.6352 3 1221.6353 -0.0001 1 45.88 0.00062 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3081.3081.3.dta 2 IPI00184195.2 19 kDa protein 204 18696 9 9 7 7 2247 2831 1 0 1 614.3 1226.5854 2 1226.5891 -0.0037 0 49.83 9.00E-05 K NHEEEISTLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2986.2986.2.dta 2 IPI00184195.2 19 kDa protein 204 18696 9 9 7 7 5037 4817 1 0 1 639.9698 1916.8875 3 1916.8904 -0.0029 1 18.19 0.041 R DYSHYYTTIQDLRDK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5220.5220.3.dta 2 IPI00792629.1 18 kDa protein 203 18074 7 7 6 6 934 1412 1 0 1 461.2233 920.432 2 920.4312 0.0008 0 49.8 0.00021 K GSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1441.1441.2.dta 2 IPI00792629.1 18 kDa protein 203 18074 7 7 6 6 1213 3609 1 0 1 497.7165 993.4184 2 993.4192 -0.0008 0 30.1 0.0019 R DYSQYYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3898.3898.2.dta 2 IPI00792629.1 18 kDa protein 203 18074 7 7 6 6 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 IPI00792629.1 18 kDa protein 203 18074 7 7 6 6 1538 2460 1 0 1 531.7531 1061.4916 2 1061.4924 -0.0008 0 67.24 3.40E-06 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2575.2575.2.dta 2 IPI00792629.1 18 kDa protein 203 18074 7 7 6 6 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00792629.1 18 kDa protein 203 18074 7 7 6 6 1612 1544 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 47.82 0.00023 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1582.1582.2.dta 2 IPI00792629.1 18 kDa protein 203 18074 7 7 6 6 4931 2936 1 0 1 629.6428 1885.9065 3 1885.913 -0.0065 1 52.01 1.60E-05 R QFTSSSSIKGSSGLGGGSSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3101.3101.3.dta 2 IPI00783306.1 Similar to keratin 14 159 9604 4 4 3 3 194 4593 1 0 0 350.7339 699.4532 2 699.4531 0.0001 0 35.39 0.00095 K ILLDVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4968.4968.2.dta 2 IPI00783306.1 Similar to keratin 14 159 9604 4 4 3 3 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00783306.1 Similar to keratin 14 159 9604 4 4 3 3 3137 3414 1 0 0 478.5789 1432.715 3 1432.7157 -0.0007 1 35.53 0.0013 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3672.3672.3.dta 2 IPI00783306.1 Similar to keratin 14 159 9604 4 4 3 3 3138 3416 1 0 0 717.3652 1432.7158 2 1432.7157 0 1 85.47 9.70E-09 K ASLENSLEETKGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3674.3674.2.dta 2 IPI00793186.1 9 kDa protein 138 9417 4 4 4 4 194 4593 1 0 0 350.7339 699.4532 2 699.4531 0.0001 0 35.39 0.00095 K ILLDVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4968.4968.2.dta 2 IPI00793186.1 9 kDa protein 138 9417 4 4 4 4 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00793186.1 9 kDa protein 138 9417 4 4 4 4 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 IPI00793186.1 9 kDa protein 138 9417 4 4 4 4 5899 3921 1 0 1 770.3594 2308.0563 3 2308.0567 -0.0004 0 50.24 1.90E-05 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4237.4237.3.dta 2 IPI00795353.1 11 kDa protein 135 10894 4 4 4 4 2534 4267 1 0 1 431.5785 1291.7137 3 1291.7136 0.0002 1 35.94 0.0019 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4607.4607.3.dta 2 IPI00795353.1 11 kDa protein 135 10894 4 4 4 4 3087 5706 1 0 1 710.379 1418.7435 2 1418.7405 0.003 0 68.15 3.20E-06 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6294.6294.2.dta 2 IPI00795353.1 11 kDa protein 135 10894 4 4 4 4 3424 2324 1 0 1 502.266 1503.7762 3 1503.7781 -0.0018 1 40.19 0.00018 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2430.2430.3.dta 2 IPI00795353.1 11 kDa protein 135 10894 4 4 4 4 7402 6327 1 0 1 914.0924 2739.2554 3 2739.2545 0.0009 0 49.22 2.40E-05 R LLEDGEDFNLGDALDSSNSMQTIQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7051.7051.3.dta 2 IPI00793702.1 7 kDa protein 135 6580 4 4 2 2 3315 4597 1 0 1 737.3844 1472.7542 2 1472.7583 -0.004 1 35.61 0.0055 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4974.4974.2.dta 2 IPI00793702.1 7 kDa protein 135 6580 4 4 2 2 3316 4591 1 0 1 491.9274 1472.7603 3 1472.7583 0.002 1 26.29 0.012 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4966.4966.3.dta 2 IPI00793702.1 7 kDa protein 135 6580 4 4 2 2 7187 8366 1 0 1 890.803 2669.3873 3 2669.3846 0.0027 0 75.41 8.50E-08 R YALQMEQLNGILLHLESELAQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9541.9541.3.dta 2 IPI00793702.1 7 kDa protein 135 6580 4 4 2 2 7215 7766 1 0 1 896.1341 2685.3805 3 2685.3795 0.0009 0 61.27 6.00E-06 R YALQMEQLNGILLHLESELAQTR A Oxidation (M) 0.00001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8840.8840.3.dta 2 IPI00171196.2 keratin 13 isoform b 130 46181 4 4 4 4 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00171196.2 keratin 13 isoform b 130 46181 4 4 4 4 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00171196.2 keratin 13 isoform b 130 46181 4 4 4 4 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 IPI00171196.2 keratin 13 isoform b 130 46181 4 4 4 4 4674 7045 1 0 1 606.6608 1816.9607 3 1816.9604 0.0002 0 48.57 2.80E-05 R TLQGLEIELQSQLSMK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7967.7967.3.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 124 49365 4 4 4 4 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 124 49365 4 4 4 4 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 124 49365 4 4 4 4 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00290077.1 "Keratin, type I cytoskeletal 15" 124 49365 4 4 4 4 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 IPI00790298.1 20 kDa protein 120 19591 4 4 4 4 1213 3609 1 0 1 497.7165 993.4184 2 993.4192 -0.0008 0 30.1 0.0019 R DYSQYYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3898.3898.2.dta 2 IPI00790298.1 20 kDa protein 120 19591 4 4 4 4 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 IPI00790298.1 20 kDa protein 120 19591 4 4 4 4 2743 3996 1 0 1 673.3455 1344.6765 2 1344.6772 -0.0007 0 83.77 2.60E-08 R ALEEANTELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4317.4317.2.dta 2 IPI00790298.1 20 kDa protein 120 19591 4 4 4 4 5481 7317 1 0 1 717.3727 2149.0962 3 2149.0976 -0.0014 1 21.8 0.009 R ADLEMQIENLKEELAYLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8299.8299.3.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 120 49898 3 3 3 3 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 120 49898 3 3 3 3 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 120 49898 3 3 3 3 4674 7045 1 0 1 606.6608 1816.9607 3 1816.9604 0.0002 0 48.57 2.80E-05 R TLQGLEIELQSQLSMK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7967.7967.3.dta 2 IPI00418663.3 Keratin-28 108 53733 3 3 3 3 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00418663.3 Keratin-28 108 53733 3 3 3 3 1719 1825 1 0 0 553.766 1105.5174 2 1105.5186 -0.0012 0 77.68 3.40E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1892.1892.2.dta 2 IPI00418663.3 Keratin-28 108 53733 3 3 3 3 1727 5209 1 0 1 555.2481 1108.4817 2 1108.4825 -0.0008 0 45.64 0.00029 K DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5664.5664.2.dta 2 IPI00791342.1 13 kDa protein 105 13121 5 5 5 5 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00791342.1 13 kDa protein 105 13121 5 5 5 5 1431 3370 1 0 0 518.7691 1035.5237 2 1035.525 -0.0013 1 36.97 0.0013 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3621.3621.2.dta 2 IPI00791342.1 13 kDa protein 105 13121 5 5 5 5 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00791342.1 13 kDa protein 105 13121 5 5 5 5 2419 3729 1 0 1 422.894 1265.6601 3 1265.6615 -0.0014 1 42.29 0.001 R TKYETELNLR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4028.4028.3.dta 2 IPI00791342.1 13 kDa protein 105 13121 5 5 5 5 5323 6277 1 0 1 685.379 2053.1153 3 2053.1167 -0.0015 0 31.94 0.0016 K ILTATVDNANVLLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6990.6990.3.dta 2 IPI00328103.2 Keratin-27 99 50419 2 2 2 2 1719 1825 1 0 0 553.766 1105.5174 2 1105.5186 -0.0012 0 77.68 3.40E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1892.1892.2.dta 2 IPI00328103.2 Keratin-27 99 50419 2 2 2 2 1727 5209 1 0 1 555.2481 1108.4817 2 1108.4825 -0.0008 0 45.64 0.00029 R DAEAWFNEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5664.5664.2.dta 2 IPI00304458.1 "Keratin, type I cytoskeletal 23" 91 48209 2 2 1 1 1538 2460 1 0 1 531.7531 1061.4916 2 1061.4924 -0.0008 0 67.24 3.40E-06 K ATMQNLNDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2575.2575.2.dta 2 IPI00304458.1 "Keratin, type I cytoskeletal 23" 91 48209 2 2 1 1 1612 1544 1 0 1 539.7504 1077.4862 2 1077.4873 -0.0011 0 47.82 0.00023 K ATMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1582.1582.2.dta 2 IPI00021298.1 "Keratin, type I cytoskeletal 20" 89 48514 2 2 2 2 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00021298.1 "Keratin, type I cytoskeletal 20" 89 48514 2 2 2 2 2930 4133 1 0 0 690.3649 1378.7152 2 1378.7204 -0.0053 1 45.68 5.20E-05 K TRLEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4463.4463.2.dta 2 IPI00375910.2 Keratin-26 78 52620 1 1 1 1 1719 1825 1 0 0 553.766 1105.5174 2 1105.5186 -0.0012 0 77.68 3.40E-07 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1892.1892.2.dta 2 IPI00791348.1 20 kDa protein 76 19811 3 3 3 3 1187 2354 1 0 0 494.7743 987.5341 2 987.5349 -0.0008 1 32.93 0.015 K TIEDLRNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2462.2462.2.dta 2 IPI00791348.1 20 kDa protein 76 19811 3 3 3 3 1274 2301 1 0 0 501.7305 1001.4465 2 1001.4488 -0.0023 0 36.4 0.0016 R QFTSSSSMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2405.2405.2.dta 2 IPI00791348.1 20 kDa protein 76 19811 3 3 3 3 1720 3311 1 0 0 553.7842 1105.5539 2 1105.555 -0.0011 0 55.23 5.00E-05 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3556.3556.2.dta 2 IPI00789893.1 22 kDa protein 68 21912 4 4 4 4 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00789893.1 22 kDa protein 68 21912 4 4 4 4 1187 2354 1 0 0 494.7743 987.5341 2 987.5349 -0.0008 1 32.93 0.015 K TIEDLRNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2462.2462.2.dta 2 IPI00789893.1 22 kDa protein 68 21912 4 4 4 4 1274 2301 1 0 0 501.7305 1001.4465 2 1001.4488 -0.0023 0 36.4 0.0016 R QFTSSSSMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2405.2405.2.dta 2 IPI00789893.1 22 kDa protein 68 21912 4 4 4 4 5323 6277 1 0 1 685.379 2053.1153 3 2053.1167 -0.0015 0 31.94 0.0016 K ILTATVDNANVLLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6990.6990.3.dta 2 IPI00015309.1 "Keratin, type I cytoskeletal 12" 67 53592 2 2 2 2 1147 2296 2 0 1 488.2636 974.5127 2 974.5145 -0.0018 1 45.92 0.00097 K SEVTDLRR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2400.2400.2.dta 2 IPI00015309.1 "Keratin, type I cytoskeletal 12" 67 53592 2 2 2 2 1549 3726 1 0 0 532.8103 1063.6061 2 1063.6026 0.0035 1 45.46 0.00018 R LASYLDKVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4025.4025.2.dta 2 IPI00166126.2 Keratin 222 pseudogene 63 34308 1 1 1 1 1782 3555 1 0 0 561.7921 1121.5696 2 1121.5717 -0.0021 0 63.35 9.60E-06 R LEQEIATYR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3839.3839.2.dta 2 IPI00743092.1 36 kDa protein 53 36504 4 4 2 2 1169 5136 1 0 1 491.725 981.4355 2 981.4345 0.001 0 33.94 0.0053 R DWSHYFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5582.5582.2.dta 2 IPI00743092.1 36 kDa protein 53 36504 4 4 2 2 5520 7970 1 0 1 1089.0916 2176.1686 2 2176.17 -0.0015 1 15.68 0.034 R LQLETEIEALKEELLFMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9080.9080.2.dta 2 IPI00743092.1 36 kDa protein 53 36504 4 4 2 2 5521 7954 1 0 1 726.3979 2176.1718 3 2176.17 0.0018 1 36.57 0.0005 R LQLETEIEALKEELLFMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9061.9061.3.dta 2 IPI00743092.1 36 kDa protein 53 36504 4 4 2 2 5541 7595 1 0 1 731.7297 2192.1674 3 2192.165 0.0024 1 18.75 0.03 R LQLETEIEALKEELLFMK K Oxidation (M) 0.000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8633.8633.3.dta 2 IPI00793191.1 14 kDa protein 52 14545 3 3 3 3 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 2 IPI00793191.1 14 kDa protein 52 14545 3 3 3 3 1187 2354 1 0 0 494.7743 987.5341 2 987.5349 -0.0008 1 32.93 0.015 K TIEDLRNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2462.2462.2.dta 2 IPI00793191.1 14 kDa protein 52 14545 3 3 3 3 5323 6277 1 0 1 685.379 2053.1153 3 2053.1167 -0.0015 0 31.94 0.0016 K ILTATVDNANVLLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6990.6990.3.dta 2 IPI00550661.2 "Isoform 2 of Keratin, type I cytoskeletal 13" 49 38783 1 1 1 1 4674 7045 1 0 1 606.6608 1816.9607 3 1816.9604 0.0002 0 48.57 2.80E-05 R TLQGLEIELQSQLSMK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7967.7967.3.dta 2 IPI00748465.1 44 kDa protein 47 44811 2 2 2 2 1169 5136 1 0 1 491.725 981.4355 2 981.4345 0.001 0 33.94 0.0053 R DWSHYFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5582.5582.2.dta 2 IPI00748465.1 44 kDa protein 47 44811 2 2 2 2 2534 4267 1 0 1 431.5785 1291.7137 3 1291.7136 0.0002 1 35.94 0.0019 K VKLEAEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4607.4607.3.dta 2 IPI00793909.1 19 kDa protein 45 19713 2 2 2 2 1187 2354 1 0 0 494.7743 987.5341 2 987.5349 -0.0008 1 32.93 0.015 K TIEDLRNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2462.2462.2.dta 2 IPI00793909.1 19 kDa protein 45 19713 2 2 2 2 1274 2301 1 0 0 501.7305 1001.4465 2 1001.4488 -0.0023 0 36.4 0.0016 R QFTSSSSMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2405.2405.2.dta 2 IPI00737922.1 "similar to Keratin, type I cytoskeletal 18" 39 9331 2 2 1 1 3315 4597 1 0 1 737.3844 1472.7542 2 1472.7583 -0.004 1 35.61 0.0055 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4974.4974.2.dta 2 IPI00737922.1 "similar to Keratin, type I cytoskeletal 18" 39 9331 2 2 1 1 3316 4591 1 0 1 491.9274 1472.7603 3 1472.7583 0.002 1 26.29 0.012 K ASLENSLREVEAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4966.4966.3.dta 2 IPI00004550.5 Keratin-24 30 55567 1 1 1 1 487 3560 1 0 0 404.2034 806.3923 2 806.3923 0 0 29.54 0.0052 R LAADDFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3845.3845.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 86 3155 1 1 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 90 4701 1 1 1 322.7205 643.4264 2 643.4268 -0.0004 0 33.59 0.0028 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5088.5088.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 874 1924 1 1 1 453.2287 904.4429 2 904.4436 -0.0007 1 40.31 0.0025 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1996.1996.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 1151 2726 1 1 1 488.7274 975.4403 2 975.441 -0.0007 0 79.87 9.60E-08 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2867.2867.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 1256 5956 1 1 1 499.7472 997.4799 2 997.479 0.0009 0 38.89 0.00086 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6599.6599.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 1337 5172 1 1 1 507.7446 1013.4747 2 1013.4739 0.0008 0 36.69 0.00036 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5623.5623.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 1434 3564 1 1 1 518.8283 1035.6421 2 1035.644 -0.002 1 31.6 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3849.3849.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 1955 4314 1 1 1 581.3138 1160.6131 2 1160.6111 0.002 0 53.26 0.00012 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4657.4657.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 1989 2786 1 1 1 586.2913 1170.5681 2 1170.5638 0.0043 0 57.68 2.40E-05 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2938.2938.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 2021 3558 1 1 1 589.3094 1176.6043 2 1176.606 -0.0017 0 31.46 0.0022 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3842.3842.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 2055 1826 1 1 1 594.2859 1186.5572 2 1186.5587 -0.0015 0 32.64 0.0024 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1893.1893.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 2167 1449 1 1 1 602.2837 1202.5528 2 1202.5536 -0.0008 0 26.73 0.0048 R HQGVMVGMGQK D 2 Oxidation (M) 0.00001001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1481.1481.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 2788 2038 1 1 1 677.8152 1353.6158 2 1353.6161 -0.0002 1 68.43 3.80E-07 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2118.2118.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 2789 2036 1 1 1 452.2132 1353.6177 3 1353.6161 0.0016 1 37.17 0.00041 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2116.2116.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 3461 3056 1 1 1 506.2389 1515.6949 3 1515.6954 -0.0004 0 39.27 0.00021 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3256.3256.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 4612 5803 1 1 1 895.9484 1789.8822 2 1789.8846 -0.0025 0 84.14 6.50E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6413.6413.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 4613 5828 1 1 1 597.6363 1789.887 3 1789.8846 0.0024 0 33.68 0.0015 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6440.6440.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 5113 4941 1 1 1 652.025 1953.0532 3 1953.0571 -0.0039 0 31.36 0.0061 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5361.5361.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 5571 6152 1 1 1 739.0276 2214.0611 3 2214.0627 -0.0016 0 29.39 0.0018 K DLYANTVLSGGTTMYPGIADR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6843.6843.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 5572 6154 1 1 1 1108.0388 2214.0631 2 2214.0627 0.0004 0 55.84 8.40E-06 K DLYANTVLSGGTTMYPGIADR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6847.6847.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 5596 5716 1 1 1 744.3608 2230.0605 3 2230.0576 0.0029 0 22.33 0.008 K DLYANTVLSGGTTMYPGIADR M Oxidation (M) 0.000000000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6306.6306.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 6037 5451 1 1 1 781.7258 2342.1555 3 2342.1576 -0.0022 1 52.63 1.20E-05 R KDLYANTVLSGGTTMYPGIADR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5955.5955.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 6712 7210 1 1 1 1275.5895 2549.1644 2 2549.1665 -0.0021 0 71.99 1.80E-07 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8158.8158.2.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 6713 7202 1 1 1 850.732 2549.1742 3 2549.1665 0.0076 0 103.94 1.80E-10 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8150.8150.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 8264 6035 1 1 1 1061.8755 3182.6046 3 3182.6071 -0.0024 0 19.44 0.015 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6699.6699.3.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 8265 6032 1 1 1 796.6597 3182.6096 4 3182.6071 0.0025 0 23.87 0.0058 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6694.6694.4.dta 3 1 IPI00021439.1 "Actin, cytoplasmic 1" 726 42052 27 27 16 16 8283 5853 1 1 1 800.657 3198.5988 4 3198.602 -0.0032 0 44.07 7.40E-05 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L Oxidation (M) 0.000001000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6472.6472.4.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 86 3155 1 0 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 874 1924 1 0 1 453.2287 904.4429 2 904.4436 -0.0007 1 40.31 0.0025 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1996.1996.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 1256 5956 1 0 1 499.7472 997.4799 2 997.479 0.0009 0 38.89 0.00086 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6599.6599.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 1337 5172 1 0 1 507.7446 1013.4747 2 1013.4739 0.0008 0 36.69 0.00036 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5623.5623.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 1434 3564 1 0 1 518.8283 1035.6421 2 1035.644 -0.002 1 31.6 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3849.3849.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 1955 4314 1 0 1 581.3138 1160.6131 2 1160.6111 0.002 0 53.26 0.00012 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4657.4657.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 2021 3558 1 0 1 589.3094 1176.6043 2 1176.606 -0.0017 0 31.46 0.0022 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3842.3842.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 3461 3056 1 0 1 506.2389 1515.6949 3 1515.6954 -0.0004 0 39.27 0.00021 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3256.3256.3.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 4612 5803 1 0 1 895.9484 1789.8822 2 1789.8846 -0.0025 0 84.14 6.50E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6413.6413.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 4613 5828 1 0 1 597.6363 1789.887 3 1789.8846 0.0024 0 33.68 0.0015 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6440.6440.3.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 5571 6152 1 0 1 739.0276 2214.0611 3 2214.0627 -0.0016 0 29.39 0.0018 K DLYANTVLSGGTTMYPGIADR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6843.6843.3.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 5572 6154 1 0 1 1108.0388 2214.0631 2 2214.0627 0.0004 0 55.84 8.40E-06 K DLYANTVLSGGTTMYPGIADR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6847.6847.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 5596 5716 1 0 1 744.3608 2230.0605 3 2230.0576 0.0029 0 22.33 0.008 K DLYANTVLSGGTTMYPGIADR M Oxidation (M) 0.000000000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6306.6306.3.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 6037 5451 1 0 1 781.7258 2342.1555 3 2342.1576 -0.0022 1 52.63 1.20E-05 R KDLYANTVLSGGTTMYPGIADR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5955.5955.3.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 6712 7210 1 0 1 1275.5895 2549.1644 2 2549.1665 -0.0021 0 71.99 1.80E-07 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8158.8158.2.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 6713 7202 1 0 1 850.732 2549.1742 3 2549.1665 0.0076 0 103.94 1.80E-10 K LCYVALDFEQEMATAASSSSLEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8150.8150.3.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 8264 6035 1 0 1 1061.8755 3182.6046 3 3182.6071 -0.0024 0 19.44 0.015 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6699.6699.3.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 8265 6032 1 0 1 796.6597 3182.6096 4 3182.6071 0.0025 0 23.87 0.0058 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6694.6694.4.dta 3 IPI00794523.2 ACTG1 protein 515 28478 19 19 11 11 8283 5853 1 0 1 800.657 3198.5988 4 3198.602 -0.0032 0 44.07 7.40E-05 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L Oxidation (M) 0.000001000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6472.6472.4.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 86 3155 1 0 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 90 4701 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 33.59 0.0028 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5088.5088.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 1151 2726 1 0 1 488.7274 975.4403 2 975.441 -0.0007 0 79.87 9.60E-08 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2867.2867.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 1256 5956 1 0 1 499.7472 997.4799 2 997.479 0.0009 0 38.89 0.00086 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6599.6599.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 1337 5172 1 0 1 507.7446 1013.4747 2 1013.4739 0.0008 0 36.69 0.00036 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5623.5623.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 1434 3564 1 0 1 518.8283 1035.6421 2 1035.644 -0.002 1 31.6 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3849.3849.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 1955 4314 1 0 1 581.3138 1160.6131 2 1160.6111 0.002 0 53.26 0.00012 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4657.4657.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 1989 2786 1 0 1 586.2913 1170.5681 2 1170.5638 0.0043 0 57.68 2.40E-05 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2938.2938.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 2021 3558 1 0 1 589.3094 1176.6043 2 1176.606 -0.0017 0 31.46 0.0022 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3842.3842.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 2055 1826 1 0 1 594.2859 1186.5572 2 1186.5587 -0.0015 0 32.64 0.0024 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1893.1893.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 2167 1449 1 0 1 602.2837 1202.5528 2 1202.5536 -0.0008 0 26.73 0.0048 R HQGVMVGMGQK D 2 Oxidation (M) 0.00001001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1481.1481.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 2788 2038 1 0 1 677.8152 1353.6158 2 1353.6161 -0.0002 1 68.43 3.80E-07 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2118.2118.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 2789 2036 1 0 1 452.2132 1353.6177 3 1353.6161 0.0016 1 37.17 0.00041 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2116.2116.3.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 4612 5803 1 0 1 895.9484 1789.8822 2 1789.8846 -0.0025 0 84.14 6.50E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6413.6413.2.dta 3 IPI00008603.1 "Actin, aortic smooth muscle" 398 42381 15 15 9 9 4613 5828 1 0 1 597.6363 1789.887 3 1789.8846 0.0024 0 33.68 0.0015 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6440.6440.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 90 4701 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 33.59 0.0028 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5088.5088.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 1151 2726 1 0 1 488.7274 975.4403 2 975.441 -0.0007 0 79.87 9.60E-08 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2867.2867.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 1434 3564 1 0 1 518.8283 1035.6421 2 1035.644 -0.002 1 31.6 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3849.3849.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 1955 4314 1 0 1 581.3138 1160.6131 2 1160.6111 0.002 0 53.26 0.00012 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4657.4657.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 1989 2786 1 0 1 586.2913 1170.5681 2 1170.5638 0.0043 0 57.68 2.40E-05 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2938.2938.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 2021 3558 1 0 1 589.3094 1176.6043 2 1176.606 -0.0017 0 31.46 0.0022 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3842.3842.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 2055 1826 1 0 1 594.2859 1186.5572 2 1186.5587 -0.0015 0 32.64 0.0024 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1893.1893.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 2167 1449 1 0 1 602.2837 1202.5528 2 1202.5536 -0.0008 0 26.73 0.0048 R HQGVMVGMGQK D 2 Oxidation (M) 0.00001001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1481.1481.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 2788 2038 1 0 1 677.8152 1353.6158 2 1353.6161 -0.0002 1 68.43 3.80E-07 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2118.2118.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 2789 2036 1 0 1 452.2132 1353.6177 3 1353.6161 0.0016 1 37.17 0.00041 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2116.2116.3.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 4612 5803 1 0 1 895.9484 1789.8822 2 1789.8846 -0.0025 0 84.14 6.50E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6413.6413.2.dta 3 IPI00515047.1 "Actin, alpha 1, skeletal muscle" 353 32370 12 12 7 7 4613 5828 1 0 1 597.6363 1789.887 3 1789.8846 0.0024 0 33.68 0.0015 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6440.6440.3.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 86 3155 1 0 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 90 4701 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 33.59 0.0028 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5088.5088.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 1151 2726 1 0 1 488.7274 975.4403 2 975.441 -0.0007 0 79.87 9.60E-08 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2867.2867.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 1256 5956 1 0 1 499.7472 997.4799 2 997.479 0.0009 0 38.89 0.00086 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6599.6599.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 1337 5172 1 0 1 507.7446 1013.4747 2 1013.4739 0.0008 0 36.69 0.00036 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5623.5623.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 1955 4314 1 0 1 581.3138 1160.6131 2 1160.6111 0.002 0 53.26 0.00012 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4657.4657.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 1989 2786 1 0 1 586.2913 1170.5681 2 1170.5638 0.0043 0 57.68 2.40E-05 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2938.2938.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 2021 3558 1 0 1 589.3094 1176.6043 2 1176.606 -0.0017 0 31.46 0.0022 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3842.3842.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 2055 1826 1 0 1 594.2859 1186.5572 2 1186.5587 -0.0015 0 32.64 0.0024 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1893.1893.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 2167 1449 1 0 1 602.2837 1202.5528 2 1202.5536 -0.0008 0 26.73 0.0048 R HQGVMVGMGQK D 2 Oxidation (M) 0.00001001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1481.1481.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 4612 5803 1 0 1 895.9484 1789.8822 2 1789.8846 -0.0025 0 84.14 6.50E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6413.6413.2.dta 3 IPI00816229.1 ACTA2 protein (Fragment) 311 37125 12 12 7 7 4613 5828 1 0 1 597.6363 1789.887 3 1789.8846 0.0024 0 33.68 0.0015 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6440.6440.3.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 90 4701 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 33.59 0.0028 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5088.5088.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 1151 2726 1 0 1 488.7274 975.4403 2 975.441 -0.0007 0 79.87 9.60E-08 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2867.2867.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 1434 3564 1 0 1 518.8283 1035.6421 2 1035.644 -0.002 1 31.6 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3849.3849.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 1955 4314 1 0 1 581.3138 1160.6131 2 1160.6111 0.002 0 53.26 0.00012 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4657.4657.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 1989 2786 1 0 1 586.2913 1170.5681 2 1170.5638 0.0043 0 57.68 2.40E-05 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2938.2938.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 2021 3558 1 0 1 589.3094 1176.6043 2 1176.606 -0.0017 0 31.46 0.0022 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3842.3842.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 2055 1826 1 0 1 594.2859 1186.5572 2 1186.5587 -0.0015 0 32.64 0.0024 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1893.1893.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 2167 1449 1 0 1 602.2837 1202.5528 2 1202.5536 -0.0008 0 26.73 0.0048 R HQGVMVGMGQK D 2 Oxidation (M) 0.00001001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1481.1481.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 2788 2038 1 0 1 677.8152 1353.6158 2 1353.6161 -0.0002 1 68.43 3.80E-07 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2118.2118.2.dta 3 IPI00414057.2 Actin alpha 1 skeletal muscle protein 278 28454 10 10 6 6 2789 2036 1 0 1 452.2132 1353.6177 3 1353.6161 0.0016 1 37.17 0.00041 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2116.2116.3.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 86 3155 1 0 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 874 1924 1 0 1 453.2287 904.4429 2 904.4436 -0.0007 1 40.31 0.0025 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1996.1996.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 1256 5956 1 0 1 499.7472 997.4799 2 997.479 0.0009 0 38.89 0.00086 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6599.6599.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 1337 5172 1 0 1 507.7446 1013.4747 2 1013.4739 0.0008 0 36.69 0.00036 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5623.5623.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 1434 3564 1 0 1 518.8283 1035.6421 2 1035.644 -0.002 1 31.6 0.0015 K IKIIAPPER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3849.3849.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 1989 2786 1 0 1 586.2913 1170.5681 2 1170.5638 0.0043 0 57.68 2.40E-05 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2938.2938.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 2055 1826 1 0 1 594.2859 1186.5572 2 1186.5587 -0.0015 0 32.64 0.0024 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1893.1893.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 2167 1449 1 0 1 602.2837 1202.5528 2 1202.5536 -0.0008 0 26.73 0.0048 R HQGVMVGMGQK D 2 Oxidation (M) 0.00001001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1481.1481.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 4612 5803 1 0 1 895.9484 1789.8822 2 1789.8846 -0.0025 0 84.14 6.50E-08 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6413.6413.2.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 4613 5828 1 0 1 597.6363 1789.887 3 1789.8846 0.0024 0 33.68 0.0015 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6440.6440.3.dta 3 IPI00003269.1 hypothetical protein LOC345651 234 42318 11 11 7 7 5113 4941 2 0 1 652.025 1953.0532 3 1953.0571 -0.0039 0 28.34 0.012 R VAPDEHPILLTEAPLNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5361.5361.3.dta 3 IPI00790339.1 22 kDa protein 230 22189 8 8 5 5 90 4701 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 33.59 0.0028 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5088.5088.2.dta 3 IPI00790339.1 22 kDa protein 230 22189 8 8 5 5 1151 2726 1 0 1 488.7274 975.4403 2 975.441 -0.0007 0 79.87 9.60E-08 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2867.2867.2.dta 3 IPI00790339.1 22 kDa protein 230 22189 8 8 5 5 1989 2786 1 0 1 586.2913 1170.5681 2 1170.5638 0.0043 0 57.68 2.40E-05 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2938.2938.2.dta 3 IPI00790339.1 22 kDa protein 230 22189 8 8 5 5 2055 1826 1 0 1 594.2859 1186.5572 2 1186.5587 -0.0015 0 32.64 0.0024 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1893.1893.2.dta 3 IPI00790339.1 22 kDa protein 230 22189 8 8 5 5 2167 1449 1 0 1 602.2837 1202.5528 2 1202.5536 -0.0008 0 26.73 0.0048 R HQGVMVGMGQK D 2 Oxidation (M) 0.00001001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1481.1481.2.dta 3 IPI00790339.1 22 kDa protein 230 22189 8 8 5 5 2788 2038 1 0 1 677.8152 1353.6158 2 1353.6161 -0.0002 1 68.43 3.80E-07 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2118.2118.2.dta 3 IPI00790339.1 22 kDa protein 230 22189 8 8 5 5 2789 2036 1 0 1 452.2132 1353.6177 3 1353.6161 0.0016 1 37.17 0.00041 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2116.2116.3.dta 3 IPI00790339.1 22 kDa protein 230 22189 8 8 5 5 5113 4941 1 0 1 652.025 1953.0532 3 1953.0571 -0.0039 0 31.36 0.0061 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5361.5361.3.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 220 16919 7 7 4 4 90 4701 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 33.59 0.0028 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5088.5088.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 220 16919 7 7 4 4 1151 2726 1 0 1 488.7274 975.4403 2 975.441 -0.0007 0 79.87 9.60E-08 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2867.2867.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 220 16919 7 7 4 4 1989 2786 1 0 1 586.2913 1170.5681 2 1170.5638 0.0043 0 57.68 2.40E-05 R HQGVMVGMGQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2938.2938.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 220 16919 7 7 4 4 2055 1826 1 0 1 594.2859 1186.5572 2 1186.5587 -0.0015 0 32.64 0.0024 R HQGVMVGMGQK D Oxidation (M) 0.00000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1893.1893.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 220 16919 7 7 4 4 2167 1449 1 0 1 602.2837 1202.5528 2 1202.5536 -0.0008 0 26.73 0.0048 R HQGVMVGMGQK D 2 Oxidation (M) 0.00001001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1481.1481.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 220 16919 7 7 4 4 2788 2038 1 0 1 677.8152 1353.6158 2 1353.6161 -0.0002 1 68.43 3.80E-07 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2118.2118.2.dta 3 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 220 16919 7 7 4 4 2789 2036 1 0 1 452.2132 1353.6177 3 1353.6161 0.0016 1 37.17 0.00041 K DSYVGDEAQSKR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2116.2116.3.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 196 123020 6 6 5 5 86 3155 1 0 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 196 123020 6 6 5 5 90 4701 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 33.59 0.0028 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5088.5088.2.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 196 123020 6 6 5 5 1151 2726 1 0 1 488.7274 975.4403 2 975.441 -0.0007 0 79.87 9.60E-08 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2867.2867.2.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 196 123020 6 6 5 5 3461 3056 1 0 1 506.2389 1515.6949 3 1515.6954 -0.0004 0 39.27 0.00021 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3256.3256.3.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 196 123020 6 6 5 5 4612 5803 1 0 1 895.9484 1789.8822 2 1789.8846 -0.0025 0 84.14 6.50E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6413.6413.2.dta 3 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 196 123020 6 6 5 5 4613 5828 1 0 1 597.6363 1789.887 3 1789.8846 0.0024 0 33.68 0.0015 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6440.6440.3.dta 3 IPI00555900.1 FKSG30 126 42331 4 4 3 3 86 3155 1 0 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 IPI00555900.1 FKSG30 126 42331 4 4 3 3 3461 3056 1 0 1 506.2389 1515.6949 3 1515.6954 -0.0004 0 39.27 0.00021 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3256.3256.3.dta 3 IPI00555900.1 FKSG30 126 42331 4 4 3 3 4612 5803 1 0 1 895.9484 1789.8822 2 1789.8846 -0.0025 0 84.14 6.50E-08 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6413.6413.2.dta 3 IPI00555900.1 FKSG30 126 42331 4 4 3 3 4613 5828 1 0 1 597.6363 1789.887 3 1789.8846 0.0024 0 33.68 0.0015 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6440.6440.3.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 122 118740 4 4 4 4 86 3155 1 0 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 122 118740 4 4 4 4 90 4701 1 0 1 322.7205 643.4264 2 643.4268 -0.0004 0 33.59 0.0028 R GILTLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5088.5088.2.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 122 118740 4 4 4 4 1151 2726 1 0 1 488.7274 975.4403 2 975.441 -0.0007 0 79.87 9.60E-08 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2867.2867.2.dta 3 IPI00738655.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 122 118740 4 4 4 4 3461 3056 1 0 1 506.2389 1515.6949 3 1515.6954 -0.0004 0 39.27 0.00021 K QEYDESGPSIVHR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3256.3256.3.dta 3 IPI00807522.1 FSD1L protein (Fragment) 107 11457 6 6 3 3 86 3155 1 0 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 IPI00807522.1 FSD1L protein (Fragment) 107 11457 6 6 3 3 1256 5956 1 0 1 499.7472 997.4799 2 997.479 0.0009 0 38.89 0.00086 R DLTDYLMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6599.6599.2.dta 3 IPI00807522.1 FSD1L protein (Fragment) 107 11457 6 6 3 3 1337 5172 1 0 1 507.7446 1013.4747 2 1013.4739 0.0008 0 36.69 0.00036 R DLTDYLMK I Oxidation (M) 0.00000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5623.5623.2.dta 3 IPI00807522.1 FSD1L protein (Fragment) 107 11457 6 6 3 3 8264 6035 1 0 1 1061.8755 3182.6046 3 3182.6071 -0.0024 0 19.44 0.015 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6699.6699.3.dta 3 IPI00807522.1 FSD1L protein (Fragment) 107 11457 6 6 3 3 8265 6032 1 0 1 796.6597 3182.6096 4 3182.6071 0.0025 0 23.87 0.0058 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6694.6694.4.dta 3 IPI00807522.1 FSD1L protein (Fragment) 107 11457 6 6 3 3 8283 5853 1 0 1 800.657 3198.5988 4 3198.602 -0.0032 0 44.07 7.40E-05 R TTGIVMDSGDGVTHTVPIYEGYALPHAILR L Oxidation (M) 0.000001000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6472.6472.4.dta 3 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 63 23821 2 2 1 1 1955 4314 1 0 1 581.3138 1160.6131 2 1160.6111 0.002 0 53.26 0.00012 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4657.4657.2.dta 3 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 63 23821 2 2 1 1 2021 3558 1 0 1 589.3094 1176.6043 2 1176.606 -0.0017 0 31.46 0.0022 K EITALAPSTMK I Oxidation (M) 0.00000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3842.3842.2.dta 3 IPI00739998.1 "Similar to Actin, cytoplasmic 1" 40 22865 1 1 1 1 874 1924 1 0 1 453.2287 904.4429 2 904.4436 -0.0007 1 40.31 0.0025 K CDVDIRK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1996.1996.2.dta 3 IPI00655798.3 Actin-like protein (Fragment) 40 11513 2 2 2 2 86 3155 1 0 0 322.6899 643.3653 2 643.3653 0 0 34.13 0.018 R LDLAGR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3366.3366.2.dta 3 IPI00655798.3 Actin-like protein (Fragment) 40 11513 2 2 2 2 5113 4941 1 0 1 652.025 1953.0532 3 1953.0571 -0.0039 0 31.36 0.0061 R VAPEEHPVLLTEAPLNPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5361.5361.3.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 147 1582 1 1 1 342.7068 683.399 2 683.3966 0.0024 0 44.18 0.00041 K GPAAIQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1623.1623.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 454 1175 1 1 1 399.1806 796.3467 2 796.3464 0.0003 0 43.86 0.00011 R GGSGGSYGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1188.1188.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 529 1290 1 1 1 406.7529 811.4912 2 811.4916 -0.0003 1 56.09 2.10E-05 K KGPAAIQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1310.1310.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 1105 1282 1 1 1 481.7484 961.4823 2 961.4828 -0.0005 1 55.38 8.10E-05 K SLEDTKNR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1302.1302.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 1635 1707 1 1 1 541.25 1080.4854 2 1080.487 -0.0015 0 47.37 0.00017 K STMQELNSR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1764.1764.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 1770 4050 1 1 1 561.2951 1120.5757 2 1120.5764 -0.0007 0 46.06 0.00035 R QEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4374.4374.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 2279 2576 1 1 1 616.8019 1231.5893 2 1231.5906 -0.0012 0 111.16 7.40E-11 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2700.2700.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 2294 2121 1 1 1 618.2675 1234.5204 2 1234.5215 -0.0011 0 80 5.00E-08 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2215.2215.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 4614 1920 1 1 1 597.9133 1790.718 3 1790.7205 -0.0025 0 80.76 1.40E-08 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1992.1992.3.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 4739 5943 1 1 1 919.487 1836.9594 2 1836.9581 0.0013 0 104.88 1.50E-10 R HGVQELEIELQSQLSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6585.6585.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 4740 5926 1 1 1 613.3278 1836.9614 3 1836.9581 0.0033 0 59.08 2.90E-06 R HGVQELEIELQSQLSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6567.6567.3.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 4781 5730 1 1 1 926.4651 1850.9156 2 1850.9196 -0.004 1 54.52 7.90E-06 K TLNDMRQEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6323.6323.2.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 4782 5712 1 1 1 617.9804 1850.9194 3 1850.9196 -0.0002 1 37.04 0.0037 K TLNDMRQEYEQLIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6302.6302.3.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 5140 5553 1 1 1 656.0247 1965.0523 3 1965.0531 -0.0007 1 49.21 2.40E-05 R HGVQELEIELQSQLSKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6083.6083.3.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 6620 5245 1 1 1 837.3813 2509.122 3 2509.1245 -0.0024 0 71.94 2.00E-07 K EIETYHNLLEGGQEDFESSGAGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5713.5713.3.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 7278 5674 1 1 1 902.3898 2704.1477 3 2704.1539 -0.0062 0 51.8 2.20E-05 R GGGGSFGYSYGGGSGGGFSASSLGGGFGGGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6252.6252.3.dta 4 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 702 62320 17 17 15 15 7871 7404 1 1 1 726.3583 2901.4042 4 2901.4032 0.001 1 27.75 0.0072 K NYSPYYNTIDDLKDQIVDLTVGNNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8411.8411.4.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 152 2315 1 1 0 343.2394 684.4643 2 684.4646 -0.0003 1 31.68 0.0031 R ILGVKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2420.2420.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 1047 1244 1 1 1 473.7691 945.5237 2 945.5243 -0.0007 1 42.34 0.0011 K IRQDSVTK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1262.1262.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 1402 5183 1 1 1 514.7526 1027.4907 2 1027.4909 -0.0002 0 24.59 0.0049 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5635.5635.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 1504 3399 1 1 1 527.7559 1053.4972 2 1053.4992 -0.002 0 54.13 2.00E-05 K HENEALWR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3655.3655.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 1534 5335 1 1 1 530.8075 1059.6004 2 1059.5998 0.0006 0 56.19 3.30E-05 K LLTDVQLMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5813.5813.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 1591 3285 1 1 1 538.2585 1074.5024 2 1074.5029 -0.0005 0 34.48 0.00058 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3525.3525.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 1602 4426 1 1 1 538.8049 1075.5952 2 1075.5947 0.0005 0 44.92 0.00067 K LLTDVQLMK G Oxidation (M) 0.000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4783.4783.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 1677 2238 1 1 1 546.2562 1090.4978 2 1090.4978 0 0 57.95 3.70E-06 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2338.2338.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 2683 3975 1 1 1 664.3661 1326.7177 2 1326.7255 -0.0078 1 41.21 0.00021 R GQEQLLENIKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4294.4294.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 3054 3117 1 1 1 703.8892 1405.7639 2 1405.7664 -0.0025 1 77.86 2.10E-07 K VTSVSTLKSEDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3325.3325.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 3458 3614 1 1 1 505.2491 1512.7254 3 1512.7296 -0.0042 1 37.16 0.00044 K YFKHNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3904.3904.3.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 3599 3112 1 1 1 520.9666 1559.878 3 1559.8784 -0.0004 0 48.5 6.60E-05 K VVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3320.3320.3.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 3814 4525 1 1 1 807.9016 1613.7887 2 1613.7897 -0.001 0 93.08 3.20E-09 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4893.4893.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 3815 4172 1 1 1 807.902 1613.7895 2 1613.7897 -0.0001 0 86.16 8.30E-09 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4505.4505.2.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 3816 4547 1 1 1 538.9377 1613.7914 3 1613.7897 0.0017 0 46.13 0.00012 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4918.4918.3.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 4749 3687 1 1 1 614.6447 1840.9123 3 1840.9175 -0.0052 1 49.38 2.30E-05 R KIPLMLNDSGSAHSMPK Y Oxidation (M) 0.00001000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3983.3983.3.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 4806 3190 1 1 1 619.9772 1856.9097 3 1856.9124 -0.0027 1 15.47 0.035 R KIPLMLNDSGSAHSMPK Y 2 Oxidation (M) 0.00001000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3404.3404.3.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 7650 8132 1 1 1 941.8408 2822.5004 3 2822.5025 -0.0021 0 72.23 2.50E-07 R VEEASPGRPSSVDTLLSPTALIDSILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9271.9271.3.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 7651 8153 1 1 1 706.6341 2822.5073 4 2822.5025 0.0047 0 30.22 0.0032 R VEEASPGRPSSVDTLLSPTALIDSILR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9293.9293.4.dta 5 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 604 57510 20 20 14 14 8193 4585 1 1 1 518.5977 3105.5423 6 3105.5455 -0.0032 1 20.39 0.044 K VVHIEQGGLVKPERDDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4960.4960.6.dta 5 IPI00012878.1 Heat shock factor protein 2 108 60482 4 4 3 3 1402 5183 1 0 1 514.7526 1027.4907 2 1027.4909 -0.0002 0 24.59 0.0049 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5635.5635.2.dta 5 IPI00012878.1 Heat shock factor protein 2 108 60482 4 4 3 3 1591 3285 1 0 1 538.2585 1074.5024 2 1074.5029 -0.0005 0 34.48 0.00058 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3525.3525.2.dta 5 IPI00012878.1 Heat shock factor protein 2 108 60482 4 4 3 3 1677 2238 1 0 1 546.2562 1090.4978 2 1090.4978 0 0 57.95 3.70E-06 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2338.2338.2.dta 5 IPI00012878.1 Heat shock factor protein 2 108 60482 4 4 3 3 3458 3614 1 0 1 505.2491 1512.7254 3 1512.7296 -0.0042 1 37.16 0.00044 K YFKHNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3904.3904.3.dta 5 IPI00008456.1 Isoform HSF4B of Heat shock factor protein 4 25 53362 1 1 1 1 1402 5183 1 0 1 514.7526 1027.4907 2 1027.4909 -0.0002 0 24.59 0.0049 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5635.5635.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 484 3492 1 1 1 403.7307 805.4469 2 805.4446 0.0023 0 33.84 0.0075 K YNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3767.3767.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 1301 4327 1 1 1 504.2545 1006.4944 2 1006.494 0.0005 0 46.34 0.00039 K SCNCLLLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4671.4671.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 1578 3976 1 1 1 358.1822 1071.5248 3 1071.5237 0.0012 1 19.05 0.016 R SGKYDLDFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4295.4295.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 1899 3175 1 1 1 572.3107 1142.6068 2 1142.6084 -0.0016 0 29.92 0.0024 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3388.3388.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 1900 3148 1 1 1 381.8769 1142.6088 3 1142.6084 0.0005 0 31 0.0039 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3358.3358.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 3051 5595 1 1 1 703.861 1405.7074 2 1405.7089 -0.0015 0 75.59 6.10E-07 R GNPTVEVDLFTSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6143.6143.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 3110 5914 1 1 1 713.3665 1424.7185 2 1424.7187 -0.0002 0 66.64 2.40E-06 R YISPDQLADLYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6552.6552.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 3925 4563 1 1 1 817.41 1632.8054 2 1632.8141 -0.0087 0 95.24 1.20E-09 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4936.4936.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 3926 4549 1 1 1 817.4125 1632.8105 2 1632.8141 -0.0036 0 99.04 5.20E-10 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4920.4920.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 4972 7598 1 1 1 954.4966 1906.9787 2 1906.9797 -0.001 0 30.81 0.0013 K LAMQEFMILPVGAANFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8637.8637.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 4973 7596 1 1 1 636.6675 1906.9808 3 1906.9797 0.0011 0 28.76 0.0026 K LAMQEFMILPVGAANFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8635.8635.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 5517 7300 1 1 1 726.0303 2175.069 3 2175.067 0.0019 1 39.82 0.00018 K AGYTDKVVIGMDVAASEFFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8278.8278.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 6078 8165 1 1 1 1177.0837 2352.1529 2 2352.1519 0.001 0 29.9 0.0047 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9306.9306.2.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 6079 8160 1 1 1 785.0583 2352.153 3 2352.1519 0.0011 0 52.03 1.30E-05 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9301.9301.3.dta 6 1 IPI00465248.5 Isoform alpha-enolase of Alpha-enolase 459 47481 15 15 11 11 7989 7158 1 1 1 995.8002 2984.3789 3 2984.3869 -0.008 1 41.9 0.00012 K SFIKDYPVVSIEDPFDQDDWGAWQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8095.8095.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 484 3492 1 0 1 403.7307 805.4469 2 805.4446 0.0023 0 33.84 0.0075 K YNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3767.3767.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 1301 4327 1 0 1 504.2545 1006.4944 2 1006.494 0.0005 0 46.34 0.00039 K SCNCLLLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4671.4671.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 1578 3976 1 0 1 358.1822 1071.5248 3 1071.5237 0.0012 1 19.05 0.016 R SGKYDLDFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4295.4295.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 1899 3175 1 0 1 572.3107 1142.6068 2 1142.6084 -0.0016 0 29.92 0.0024 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3388.3388.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 1900 3148 1 0 1 381.8769 1142.6088 3 1142.6084 0.0005 0 31 0.0039 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3358.3358.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 3110 5914 1 0 1 713.3665 1424.7185 2 1424.7187 -0.0002 0 66.64 2.40E-06 R YISPDQLADLYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6552.6552.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 3925 4563 1 0 1 817.41 1632.8054 2 1632.8141 -0.0087 0 95.24 1.20E-09 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4936.4936.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 3926 4549 1 0 1 817.4125 1632.8105 2 1632.8141 -0.0036 0 99.04 5.20E-10 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4920.4920.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 4972 7598 1 0 1 954.4966 1906.9787 2 1906.9797 -0.001 0 30.81 0.0013 K LAMQEFMILPVGAANFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8637.8637.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 4973 7596 1 0 1 636.6675 1906.9808 3 1906.9797 0.0011 0 28.76 0.0026 K LAMQEFMILPVGAANFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8635.8635.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 5517 7300 1 0 1 726.0303 2175.069 3 2175.067 0.0019 1 39.82 0.00018 K AGYTDKVVIGMDVAASEFFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8278.8278.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 6078 8165 1 0 1 1177.0837 2352.1529 2 2352.1519 0.001 0 29.9 0.0047 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9306.9306.2.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 6079 8160 1 0 1 785.0583 2352.153 3 2352.1519 0.0011 0 52.03 1.30E-05 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9301.9301.3.dta 6 IPI00759806.1 Isoform MBP-1 of Alpha-enolase 409 37247 14 14 10 10 7989 7158 1 0 1 995.8002 2984.3789 3 2984.3869 -0.008 1 41.9 0.00012 K SFIKDYPVVSIEDPFDQDDWGAWQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8095.8095.3.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 256 49845 6 6 4 4 484 3492 1 0 1 403.7307 805.4469 2 805.4446 0.0023 0 33.84 0.0075 K YNQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3767.3767.2.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 256 49845 6 6 4 4 1899 3175 1 0 1 572.3107 1142.6068 2 1142.6084 -0.0016 0 29.92 0.0024 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3388.3388.2.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 256 49845 6 6 4 4 1900 3148 1 0 1 381.8769 1142.6088 3 1142.6084 0.0005 0 31 0.0039 R IGAEVYHNLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3358.3358.3.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 256 49845 6 6 4 4 3110 5914 1 0 1 713.3665 1424.7185 2 1424.7187 -0.0002 0 66.64 2.40E-06 R YISPDQLADLYK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6552.6552.2.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 256 49845 6 6 4 4 3925 4563 1 0 1 817.41 1632.8054 2 1632.8141 -0.0087 0 95.24 1.20E-09 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4936.4936.2.dta 6 IPI00013769.1 "Alpha-enolase, lung specific" 256 49845 6 6 4 4 3926 4549 1 0 1 817.4125 1632.8105 2 1632.8141 -0.0036 0 99.04 5.20E-10 K VNQIGSVTESLQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4920.4920.2.dta 6 IPI00218474.5 Beta-enolase 222 47299 4 4 2 2 3925 4563 1 0 1 817.41 1632.8054 2 1632.8141 -0.0087 0 95.24 1.20E-09 K VNQIGSVTESIQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4936.4936.2.dta 6 IPI00218474.5 Beta-enolase 222 47299 4 4 2 2 3926 4549 1 0 1 817.4125 1632.8105 2 1632.8141 -0.0036 0 99.04 5.20E-10 K VNQIGSVTESIQACK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4920.4920.2.dta 6 IPI00218474.5 Beta-enolase 222 47299 4 4 2 2 6078 8165 1 0 1 1177.0837 2352.1529 2 2352.1519 0.001 0 29.9 0.0047 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9306.9306.2.dta 6 IPI00218474.5 Beta-enolase 222 47299 4 4 2 2 6079 8160 1 0 1 785.0583 2352.153 3 2352.1519 0.0011 0 52.03 1.30E-05 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9301.9301.3.dta 6 IPI00216171.3 Gamma-enolase 102 47581 4 4 3 3 119 1419 1 0 1 334.663 667.3114 2 667.3177 -0.0063 0 31.62 0.009 K AGYTEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1449.1449.2.dta 6 IPI00216171.3 Gamma-enolase 102 47581 4 4 3 3 3051 5595 2 0 1 703.861 1405.7074 2 1405.7089 -0.0015 0 52.28 0.00013 R GNPTVEVDLYTAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6143.6143.2.dta 6 IPI00216171.3 Gamma-enolase 102 47581 4 4 3 3 6078 8165 1 0 1 1177.0837 2352.1529 2 2352.1519 0.001 0 29.9 0.0047 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9306.9306.2.dta 6 IPI00216171.3 Gamma-enolase 102 47581 4 4 3 3 6079 8160 1 0 1 785.0583 2352.153 3 2352.1519 0.0011 0 52.03 1.30E-05 R SGETEDTFIADLVVGLCTGQIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9301.9301.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 900 2444 1 1 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 1352 4488 1 1 1 508.2928 1014.571 2 1014.5709 0 0 65.03 6.70E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4852.4852.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 3707 6523 1 1 1 792.8803 1583.7461 2 1583.7443 0.0018 0 33.84 0.0013 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7321.7321.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 4367 6596 1 1 1 567.9731 1700.8974 3 1700.8985 -0.0011 0 38.72 0.00032 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7416.7416.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 4368 6594 1 1 1 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.73 2.30E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7414.7414.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 4433 4250 1 1 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 4531 5952 1 1 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 4694 5246 1 1 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 4751 6912 1 1 1 614.6758 1841.0055 3 1841.0047 0.0008 1 57.7 6.50E-06 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7805.7805.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 4868 6627 1 1 1 622.3069 1863.8988 3 1863.8971 0.0017 0 33.21 0.0016 R AVCMLSNTTAIAEAWAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7454.7454.3.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 5230 6218 1 1 1 1004.4499 2006.8852 2 2006.8858 -0.0006 0 98.01 6.50E-10 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6921.6921.2.dta 7 1 IPI00387144.4 Tubulin alpha-ubiquitous chain 368 50804 12 12 11 11 6361 4931 1 1 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 1352 4488 1 0 1 508.2928 1014.571 2 1014.5709 0 0 65.03 6.70E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4852.4852.2.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 4367 6596 1 0 1 567.9731 1700.8974 3 1700.8985 -0.0011 0 38.72 0.00032 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7416.7416.3.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 4368 6594 1 0 1 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.73 2.30E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7414.7414.2.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 4531 5952 1 0 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 4694 5246 1 0 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 4751 6912 1 0 1 614.6758 1841.0055 3 1841.0047 0.0008 1 57.7 6.50E-06 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7805.7805.3.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 4868 6627 1 0 1 622.3069 1863.8988 3 1863.8971 0.0017 0 33.21 0.0016 R AVCMLSNTTAIAEAWAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7454.7454.3.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 5230 6218 1 0 1 1004.4499 2006.8852 2 2006.8858 -0.0006 0 98.01 6.50E-10 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6921.6921.2.dta 7 IPI00180675.4 Tubulin alpha-3 chain 353 50788 11 11 10 10 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 1352 4488 1 0 1 508.2928 1014.571 2 1014.5709 0 0 65.03 6.70E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4852.4852.2.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 4367 6596 1 0 1 567.9731 1700.8974 3 1700.8985 -0.0011 0 38.72 0.00032 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7416.7416.3.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 4368 6594 1 0 1 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.73 2.30E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7414.7414.2.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 4531 5952 1 0 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 4694 5246 1 0 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 4751 6912 1 0 1 614.6758 1841.0055 3 1841.0047 0.0008 1 57.7 6.50E-06 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7805.7805.3.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 5230 6218 1 0 1 1004.4499 2006.8852 2 2006.8858 -0.0006 0 98.01 6.50E-10 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6921.6921.2.dta 7 IPI00218343.4 Tubulin alpha-6 chain 337 50548 10 10 9 9 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00166768.2 TUBA6 protein 323 37681 8 8 7 7 1352 4488 1 0 1 508.2928 1014.571 2 1014.5709 0 0 65.03 6.70E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4852.4852.2.dta 7 IPI00166768.2 TUBA6 protein 323 37681 8 8 7 7 4367 6596 1 0 1 567.9731 1700.8974 3 1700.8985 -0.0011 0 38.72 0.00032 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7416.7416.3.dta 7 IPI00166768.2 TUBA6 protein 323 37681 8 8 7 7 4368 6594 1 0 1 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.73 2.30E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7414.7414.2.dta 7 IPI00166768.2 TUBA6 protein 323 37681 8 8 7 7 4531 5952 1 0 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 IPI00166768.2 TUBA6 protein 323 37681 8 8 7 7 4694 5246 1 0 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 IPI00166768.2 TUBA6 protein 323 37681 8 8 7 7 4751 6912 1 0 1 614.6758 1841.0055 3 1841.0047 0.0008 1 57.7 6.50E-06 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7805.7805.3.dta 7 IPI00166768.2 TUBA6 protein 323 37681 8 8 7 7 5230 6218 1 0 1 1004.4499 2006.8852 2 2006.8858 -0.0006 0 98.01 6.50E-10 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6921.6921.2.dta 7 IPI00166768.2 TUBA6 protein 323 37681 8 8 7 7 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00793930.1 K-ALPHA-1 protein 314 37707 9 9 8 8 1352 4488 1 0 1 508.2928 1014.571 2 1014.5709 0 0 65.03 6.70E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4852.4852.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 314 37707 9 9 8 8 3707 6523 1 0 1 792.8803 1583.7461 2 1583.7443 0.0018 0 33.84 0.0013 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7321.7321.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 314 37707 9 9 8 8 4367 6596 1 0 1 567.9731 1700.8974 3 1700.8985 -0.0011 0 38.72 0.00032 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7416.7416.3.dta 7 IPI00793930.1 K-ALPHA-1 protein 314 37707 9 9 8 8 4368 6594 1 0 1 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.73 2.30E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7414.7414.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 314 37707 9 9 8 8 4531 5952 1 0 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 IPI00793930.1 K-ALPHA-1 protein 314 37707 9 9 8 8 4694 5246 1 0 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 314 37707 9 9 8 8 4868 6627 1 0 1 622.3069 1863.8988 3 1863.8971 0.0017 0 33.21 0.0016 R AVCMLSNTTAIAEAWAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7454.7454.3.dta 7 IPI00793930.1 K-ALPHA-1 protein 314 37707 9 9 8 8 5230 6218 1 0 1 1004.4499 2006.8852 2 2006.8858 -0.0006 0 98.01 6.50E-10 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6921.6921.2.dta 7 IPI00793930.1 K-ALPHA-1 protein 314 37707 9 9 8 8 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 8 8 7 7 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 8 8 7 7 4367 6596 1 0 1 567.9731 1700.8974 3 1700.8985 -0.0011 0 38.72 0.00032 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7416.7416.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 8 8 7 7 4368 6594 1 0 1 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.73 2.30E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7414.7414.2.dta 7 IPI00478908.3 29 kDa protein 275 28716 8 8 7 7 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 8 8 7 7 4531 5952 1 0 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 8 8 7 7 4751 6912 1 0 1 614.6758 1841.0055 3 1841.0047 0.0008 1 57.7 6.50E-06 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7805.7805.3.dta 7 IPI00478908.3 29 kDa protein 275 28716 8 8 7 7 5230 6218 1 0 1 1004.4499 2006.8852 2 2006.8858 -0.0006 0 98.01 6.50E-10 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6921.6921.2.dta 7 IPI00478908.3 29 kDa protein 275 28716 8 8 7 7 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00795002.1 19 kDa protein 247 19479 6 6 5 5 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 IPI00795002.1 19 kDa protein 247 19479 6 6 5 5 4367 6596 1 0 1 567.9731 1700.8974 3 1700.8985 -0.0011 0 38.72 0.00032 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7416.7416.3.dta 7 IPI00795002.1 19 kDa protein 247 19479 6 6 5 5 4368 6594 1 0 1 851.4562 1700.8979 2 1700.8985 -0.0006 0 70.73 2.30E-07 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7414.7414.2.dta 7 IPI00795002.1 19 kDa protein 247 19479 6 6 5 5 4751 6912 1 0 1 614.6758 1841.0055 3 1841.0047 0.0008 1 57.7 6.50E-06 R GHYTIGKEIIDLVLDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7805.7805.3.dta 7 IPI00795002.1 19 kDa protein 247 19479 6 6 5 5 5230 6218 1 0 1 1004.4499 2006.8852 2 2006.8858 -0.0006 0 98.01 6.50E-10 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6921.6921.2.dta 7 IPI00795002.1 19 kDa protein 247 19479 6 6 5 5 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 237 50612 8 8 8 8 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 237 50612 8 8 8 8 1352 4488 1 0 1 508.2928 1014.571 2 1014.5709 0 0 65.03 6.70E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4852.4852.2.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 237 50612 8 8 8 8 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 237 50612 8 8 8 8 4531 5952 1 0 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 237 50612 8 8 8 8 4694 5246 1 0 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 237 50612 8 8 8 8 4868 6627 1 0 1 622.3069 1863.8988 3 1863.8971 0.0017 0 33.21 0.0016 R AVCMLSNTTAIAEAWAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7454.7454.3.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 237 50612 8 8 8 8 5230 6218 1 0 1 1004.4499 2006.8852 2 2006.8858 -0.0006 0 98.01 6.50E-10 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6921.6921.2.dta 7 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 237 50612 8 8 8 8 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00410402.2 Similar to alpha tubulin 203 50568 6 6 6 6 1352 4488 1 0 1 508.2928 1014.571 2 1014.5709 0 0 65.03 6.70E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4852.4852.2.dta 7 IPI00410402.2 Similar to alpha tubulin 203 50568 6 6 6 6 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00410402.2 Similar to alpha tubulin 203 50568 6 6 6 6 4531 5952 1 0 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 IPI00410402.2 Similar to alpha tubulin 203 50568 6 6 6 6 4694 5246 1 0 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 IPI00410402.2 Similar to alpha tubulin 203 50568 6 6 6 6 4868 6627 1 0 1 622.3069 1863.8988 3 1863.8971 0.0017 0 33.21 0.0016 R AVCMLSNTTAIAEAWAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7454.7454.3.dta 7 IPI00410402.2 Similar to alpha tubulin 203 50568 6 6 6 6 5230 6218 1 0 1 1004.4499 2006.8852 2 2006.8858 -0.0006 0 98.01 6.50E-10 K TIGGGDDSFNTFFSETGAGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6921.6921.2.dta 7 IPI00007750.1 Tubulin alpha-1 chain 134 50634 7 7 7 7 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 IPI00007750.1 Tubulin alpha-1 chain 134 50634 7 7 7 7 3707 6523 1 0 1 792.8803 1583.7461 2 1583.7443 0.0018 0 33.84 0.0013 R SIQFVDWCPTGFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7321.7321.2.dta 7 IPI00007750.1 Tubulin alpha-1 chain 134 50634 7 7 7 7 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00007750.1 Tubulin alpha-1 chain 134 50634 7 7 7 7 4531 5952 1 0 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 IPI00007750.1 Tubulin alpha-1 chain 134 50634 7 7 7 7 4694 5246 1 0 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 IPI00007750.1 Tubulin alpha-1 chain 134 50634 7 7 7 7 4868 6627 1 0 1 622.3069 1863.8988 3 1863.8971 0.0017 0 33.21 0.0016 R AVCMLSNTTAIAEAWAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7454.7454.3.dta 7 IPI00007750.1 Tubulin alpha-1 chain 134 50634 7 7 7 7 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00646909.2 Tubulin alpha-8 chain 100 50746 4 4 4 4 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00646909.2 Tubulin alpha-8 chain 100 50746 4 4 4 4 4694 5246 1 0 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 IPI00646909.2 Tubulin alpha-8 chain 100 50746 4 4 4 4 4868 6627 1 0 1 622.3069 1863.8988 3 1863.8971 0.0017 0 33.21 0.0016 R AVCMLSNTTAIAEAWAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7454.7454.3.dta 7 IPI00646909.2 Tubulin alpha-8 chain 100 50746 4 4 4 4 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00784332.1 Similar to Tubulin alpha-2 chain 98 17148 3 3 3 3 1352 4488 1 0 1 508.2928 1014.571 2 1014.5709 0 0 65.03 6.70E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4852.4852.2.dta 7 IPI00784332.1 Similar to Tubulin alpha-2 chain 98 17148 3 3 3 3 4694 5246 1 0 1 912.9974 1823.9802 2 1823.9782 0.002 0 41.56 0.00031 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5714.5714.2.dta 7 IPI00784332.1 Similar to Tubulin alpha-2 chain 98 17148 3 3 3 3 4868 6627 1 0 1 622.3069 1863.8988 3 1863.8971 0.0017 0 33.21 0.0016 R AVCMLSNTTAIAEAWAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7454.7454.3.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 89 23560 4 4 4 4 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 89 23560 4 4 4 4 1352 4488 1 0 1 508.2928 1014.571 2 1014.5709 0 0 65.03 6.70E-06 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4852.4852.2.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 89 23560 4 4 4 4 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00414274.3 similar to Tubulin alpha-3 chain 89 23560 4 4 4 4 4531 5952 1 0 1 586.3256 1755.9549 3 1755.9559 -0.0011 0 33.78 0.0017 R IHFPLATYAPVISAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6594.6594.3.dta 7 IPI00335314.3 30 kDa protein 65 30008 3 3 3 3 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 IPI00335314.3 30 kDa protein 65 30008 3 3 3 3 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00335314.3 30 kDa protein 65 30008 3 3 3 3 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00794009.1 22 kDa protein 53 21949 2 2 2 2 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 7 IPI00794009.1 22 kDa protein 53 21949 2 2 2 2 6361 4931 1 0 1 805.7407 2414.2002 3 2414.1978 0.0023 1 48.29 3.30E-05 R QLFHPEQLITGKEDAANNYAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5348.5348.3.dta 7 IPI00017454.3 Tubulin alpha-4 chain 30 27757 1 1 1 1 4433 4250 1 0 1 573.6321 1717.8746 3 1717.8747 -0.0001 0 29.9 0.0028 R NLDIERPTYTNLNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4589.4589.3.dta 7 IPI00062209.5 Alpha tubulin-like 24 16843 1 1 1 1 900 2444 1 0 1 303.8396 908.4969 3 908.4967 0.0002 1 23.78 0.039 R LSVDYGKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2558.2558.3.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 1404 2824 1 1 1 514.7608 1027.5071 2 1027.5121 -0.005 0 48.84 0.00021 K TAVCDIPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2978.2978.2.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 1606 2057 1 1 1 539.2693 1076.5241 2 1076.525 -0.0009 1 30.4 0.0083 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2138.2138.2.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 1903 5855 1 1 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 2565 3838 1 1 1 651.3209 1300.6273 2 1300.6299 -0.0026 0 54.72 7.70E-06 R ISVYYNEATGGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4147.4147.2.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 3211 3992 1 1 1 723.8472 1445.6798 2 1445.682 -0.0022 0 64.75 5.00E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4312.4312.2.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 3818 6012 1 1 1 808.4216 1614.8286 2 1614.8287 -0.0001 0 51.12 2.20E-05 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6669.6669.2.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 4135 6656 1 1 1 830.4517 1658.8888 2 1658.8879 0.0008 0 47.4 3.60E-05 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7490.7490.2.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 4345 6408 1 1 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 4670 4168 1 1 1 606.3129 1815.917 3 1815.9155 0.0014 1 28.45 0.0024 R ISVYYNEATGGKYVPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4501.4501.3.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 5311 6644 1 1 1 681.3633 2041.068 3 2041.0666 0.0014 1 21.07 0.011 K MAVTFIGNSTAIQELFKR I Oxidation (M) 0.100000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7472.7472.3.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 5387 6581 1 1 1 696.364 2086.0702 3 2086.0695 0.0007 1 47.4 0.00023 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7399.7399.3.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 5388 6585 1 1 1 522.5249 2086.0705 4 2086.0695 0.001 1 36.48 0.0006 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7404.7404.4.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 5436 3556 1 1 1 528.2704 2109.0527 4 2109.0571 -0.0045 1 31.73 0.0015 - MREIVHIQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3840.3840.4.dta 8 1 IPI00011654.2 Tubulin beta chain 345 50095 14 14 13 13 7599 6791 1 1 1 933.4531 2797.3374 3 2797.3361 0.0012 0 26.44 0.0033 R SGPFGQIFRPDNFVFGQSGAGNNWAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7650.7650.3.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 1404 2824 1 0 1 514.7608 1027.5071 2 1027.5121 -0.005 0 48.84 0.00021 K TAVCDIPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2978.2978.2.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 1606 2057 1 0 1 539.2693 1076.5241 2 1076.525 -0.0009 1 30.4 0.0083 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2138.2138.2.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 2565 3838 1 0 1 651.3209 1300.6273 2 1300.6299 -0.0026 0 54.72 7.70E-06 R ISVYYNEATGGK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4147.4147.2.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 3211 3992 1 0 1 723.8472 1445.6798 2 1445.682 -0.0022 0 64.75 5.00E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4312.4312.2.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 3818 6012 1 0 1 808.4216 1614.8286 2 1614.8287 -0.0001 0 51.12 2.20E-05 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6669.6669.2.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 4135 6656 1 0 1 830.4517 1658.8888 2 1658.8879 0.0008 0 47.4 3.60E-05 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7490.7490.2.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 4670 4168 1 0 1 606.3129 1815.917 3 1815.9155 0.0014 1 28.45 0.0024 R ISVYYNEATGGKYVPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4501.4501.3.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 5311 6644 1 0 1 681.3633 2041.068 3 2041.0666 0.0014 1 21.07 0.011 K MAVTFIGNSTAIQELFKR I Oxidation (M) 0.100000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7472.7472.3.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 5387 6581 1 0 1 696.364 2086.0702 3 2086.0695 0.0007 1 47.4 0.00023 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7399.7399.3.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 5388 6585 1 0 1 522.5249 2086.0705 4 2086.0695 0.001 1 36.48 0.0006 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7404.7404.4.dta 8 IPI00645452.1 "Tubulin, beta polypeptide" 330 48135 13 13 12 12 7599 6791 1 0 1 933.4531 2797.3374 3 2797.3361 0.0012 0 26.44 0.0033 R SGPFGQIFRPDNFVFGQSGAGNNWAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7650.7650.3.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 1404 2824 1 0 1 514.7608 1027.5071 2 1027.5121 -0.005 0 48.84 0.00021 K TAVCDIPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2978.2978.2.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 1606 2057 1 0 1 539.2693 1076.5241 2 1076.525 -0.0009 1 30.4 0.0083 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2138.2138.2.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 3211 3992 1 0 1 723.8472 1445.6798 2 1445.682 -0.0022 0 64.75 5.00E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4312.4312.2.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 3818 6012 1 0 1 808.4216 1614.8286 2 1614.8287 -0.0001 0 51.12 2.20E-05 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6669.6669.2.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 5387 6581 1 0 1 696.364 2086.0702 3 2086.0695 0.0007 1 47.4 0.00023 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7399.7399.3.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 5388 6585 1 0 1 522.5249 2086.0705 4 2086.0695 0.001 1 36.48 0.0006 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7404.7404.4.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 5436 3556 1 0 1 528.2704 2109.0527 4 2109.0571 -0.0045 1 31.73 0.0015 - MREIVHIQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3840.3840.4.dta 8 IPI00013475.1 Tubulin beta-2A chain 255 50274 10 10 9 9 7599 6791 1 0 1 933.4531 2797.3374 3 2797.3361 0.0012 0 26.44 0.0033 R SGPFGQIFRPDNFVFGQSGAGNNWAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7650.7650.3.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 1404 2824 1 0 1 514.7608 1027.5071 2 1027.5121 -0.005 0 48.84 0.00021 K TAVCDIPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2978.2978.2.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 1606 2057 1 0 1 539.2693 1076.5241 2 1076.525 -0.0009 1 30.4 0.0083 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2138.2138.2.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 3211 3992 1 0 1 723.8472 1445.6798 2 1445.682 -0.0022 0 64.75 5.00E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4312.4312.2.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 4135 6656 1 0 1 830.4517 1658.8888 2 1658.8879 0.0008 0 47.4 3.60E-05 R ALTVPELTQQVFDAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7490.7490.2.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 5311 6644 1 0 1 681.3633 2041.068 3 2041.0666 0.0014 1 21.07 0.011 K MAVTFIGNSTAIQELFKR I Oxidation (M) 0.100000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7472.7472.3.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 5387 6581 1 0 1 696.364 2086.0702 3 2086.0695 0.0007 1 47.4 0.00023 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7399.7399.3.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 5388 6585 1 0 1 522.5249 2086.0705 4 2086.0695 0.001 1 36.48 0.0006 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7404.7404.4.dta 8 IPI00647896.1 "Tubulin, beta" 244 42114 10 10 9 9 7599 6791 1 0 1 933.4531 2797.3374 3 2797.3361 0.0012 0 26.44 0.0033 R SGPFGQIFRPDNFVFGQSGAGNNWAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7650.7650.3.dta 8 IPI00007752.1 Tubulin beta-2C chain 221 50255 9 9 8 8 1404 2824 1 0 1 514.7608 1027.5071 2 1027.5121 -0.005 0 48.84 0.00021 K TAVCDIPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2978.2978.2.dta 8 IPI00007752.1 Tubulin beta-2C chain 221 50255 9 9 8 8 1606 2057 1 0 1 539.2693 1076.5241 2 1076.525 -0.0009 1 30.4 0.0083 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2138.2138.2.dta 8 IPI00007752.1 Tubulin beta-2C chain 221 50255 9 9 8 8 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00007752.1 Tubulin beta-2C chain 221 50255 9 9 8 8 3211 3992 1 0 1 723.8472 1445.6798 2 1445.682 -0.0022 0 64.75 5.00E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4312.4312.2.dta 8 IPI00007752.1 Tubulin beta-2C chain 221 50255 9 9 8 8 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00007752.1 Tubulin beta-2C chain 221 50255 9 9 8 8 5387 6581 1 0 1 696.364 2086.0702 3 2086.0695 0.0007 1 47.4 0.00023 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7399.7399.3.dta 8 IPI00007752.1 Tubulin beta-2C chain 221 50255 9 9 8 8 5388 6585 1 0 1 522.5249 2086.0705 4 2086.0695 0.001 1 36.48 0.0006 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7404.7404.4.dta 8 IPI00007752.1 Tubulin beta-2C chain 221 50255 9 9 8 8 5436 3556 1 0 1 528.2704 2109.0527 4 2109.0571 -0.0045 1 31.73 0.0015 - MREIVHLQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3840.3840.4.dta 8 IPI00007752.1 Tubulin beta-2C chain 221 50255 9 9 8 8 7599 6791 1 0 1 933.4531 2797.3374 3 2797.3361 0.0012 0 26.44 0.0033 R SGPFGQIFRPDNFVFGQSGAGNNWAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7650.7650.3.dta 8 IPI00013683.2 Tubulin beta-3 chain 169 50856 6 6 5 5 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00013683.2 Tubulin beta-3 chain 169 50856 6 6 5 5 3818 6012 1 0 1 808.4216 1614.8286 2 1614.8287 -0.0001 0 51.12 2.20E-05 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6669.6669.2.dta 8 IPI00013683.2 Tubulin beta-3 chain 169 50856 6 6 5 5 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00013683.2 Tubulin beta-3 chain 169 50856 6 6 5 5 5387 6581 1 0 1 696.364 2086.0702 3 2086.0695 0.0007 1 47.4 0.00023 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7399.7399.3.dta 8 IPI00013683.2 Tubulin beta-3 chain 169 50856 6 6 5 5 5388 6585 1 0 1 522.5249 2086.0705 4 2086.0695 0.001 1 36.48 0.0006 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7404.7404.4.dta 8 IPI00013683.2 Tubulin beta-3 chain 169 50856 6 6 5 5 5436 3556 1 0 1 528.2704 2109.0527 4 2109.0571 -0.0045 1 31.73 0.0015 - MREIVHIQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3840.3840.4.dta 8 IPI00152453.1 "Tubulin, beta, 4" 154 89693 5 5 4 4 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00152453.1 "Tubulin, beta, 4" 154 89693 5 5 4 4 3818 6012 1 0 1 808.4216 1614.8286 2 1614.8287 -0.0001 0 51.12 2.20E-05 R AILVDLEPGTMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6669.6669.2.dta 8 IPI00152453.1 "Tubulin, beta, 4" 154 89693 5 5 4 4 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00152453.1 "Tubulin, beta, 4" 154 89693 5 5 4 4 5387 6581 1 0 1 696.364 2086.0702 3 2086.0695 0.0007 1 47.4 0.00023 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7399.7399.3.dta 8 IPI00152453.1 "Tubulin, beta, 4" 154 89693 5 5 4 4 5388 6585 1 0 1 522.5249 2086.0705 4 2086.0695 0.001 1 36.48 0.0006 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7404.7404.4.dta 8 IPI00646779.2 TUBB6 protein 129 50514 5 5 4 4 1606 2057 1 0 1 539.2693 1076.5241 2 1076.525 -0.0009 1 30.4 0.0083 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2138.2138.2.dta 8 IPI00646779.2 TUBB6 protein 129 50514 5 5 4 4 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00646779.2 TUBB6 protein 129 50514 5 5 4 4 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00646779.2 TUBB6 protein 129 50514 5 5 4 4 5387 6581 1 0 1 696.364 2086.0702 3 2086.0695 0.0007 1 47.4 0.00023 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7399.7399.3.dta 8 IPI00646779.2 TUBB6 protein 129 50514 5 5 4 4 5388 6585 1 0 1 522.5249 2086.0705 4 2086.0695 0.001 1 36.48 0.0006 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7404.7404.4.dta 8 IPI00023598.2 Tubulin beta-4 chain 128 50010 5 5 5 5 1404 2824 1 0 1 514.7608 1027.5071 2 1027.5121 -0.005 0 48.84 0.00021 K TAVCDIPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2978.2978.2.dta 8 IPI00023598.2 Tubulin beta-4 chain 128 50010 5 5 5 5 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00023598.2 Tubulin beta-4 chain 128 50010 5 5 5 5 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00023598.2 Tubulin beta-4 chain 128 50010 5 5 5 5 5436 3556 1 0 1 528.2704 2109.0527 4 2109.0571 -0.0045 1 31.73 0.0015 - MREIVHLQAGQCGNQIGAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3840.3840.4.dta 8 IPI00023598.2 Tubulin beta-4 chain 128 50010 5 5 5 5 7599 6791 1 0 1 933.4531 2797.3374 3 2797.3361 0.0012 0 26.44 0.0033 R SGPFGQIFRPDNFVFGQSGAGNNWAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7650.7650.3.dta 8 IPI00640115.1 TUBB3 protein 121 42804 4 4 3 3 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00640115.1 TUBB3 protein 121 42804 4 4 3 3 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00640115.1 TUBB3 protein 121 42804 4 4 3 3 5387 6581 1 0 1 696.364 2086.0702 3 2086.0695 0.0007 1 47.4 0.00023 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7399.7399.3.dta 8 IPI00640115.1 TUBB3 protein 121 42804 4 4 3 3 5388 6585 1 0 1 522.5249 2086.0705 4 2086.0695 0.001 1 36.48 0.0006 K GHYTEGAELVDSVLDVVRK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7404.7404.4.dta 8 IPI00398982.1 "similar to tubulin, beta 5" 105 12210 3 3 3 3 1404 2824 1 0 1 514.7608 1027.5071 2 1027.5121 -0.005 0 48.84 0.00021 K TAVCDIPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2978.2978.2.dta 8 IPI00398982.1 "similar to tubulin, beta 5" 105 12210 3 3 3 3 3211 3992 1 0 1 723.8472 1445.6798 2 1445.682 -0.0022 0 64.75 5.00E-06 K EVDEQMLNVQNK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4312.4312.2.dta 8 IPI00398982.1 "similar to tubulin, beta 5" 105 12210 3 3 3 3 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00174849.4 50 kDa protein 95 50168 3 3 3 3 1404 2824 1 0 1 514.7608 1027.5071 2 1027.5121 -0.005 0 48.84 0.00021 K TAVCDIPPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2978.2978.2.dta 8 IPI00174849.4 50 kDa protein 95 50168 3 3 3 3 1606 2057 1 0 1 539.2693 1076.5241 2 1076.525 -0.0009 1 30.4 0.0083 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2138.2138.2.dta 8 IPI00174849.4 50 kDa protein 95 50168 3 3 3 3 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00641706.1 46 kDa protein 77 46248 2 2 2 2 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00641706.1 46 kDa protein 77 46248 2 2 2 2 4345 6408 1 0 1 848.9205 1695.8265 2 1695.8257 0.0009 0 40.34 0.0016 K NSSYFVEWIPNNVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7175.7175.2.dta 8 IPI00006510.1 Tubulin beta-1 chain 69 50865 2 2 2 2 1606 2057 1 0 1 539.2693 1076.5241 2 1076.525 -0.0009 1 30.4 0.0083 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2138.2138.2.dta 8 IPI00006510.1 Tubulin beta-1 chain 69 50865 2 2 2 2 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00784416.1 Similar to Tubulin beta-2 chain 59 46052 1 1 1 1 1903 5855 1 0 1 572.3209 1142.6273 2 1142.627 0.0003 0 58.62 4.60E-06 K LAVNMVPFPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6474.6474.2.dta 8 IPI00827736.1 Hypothetical protein (Fragment) 30 16876 1 1 1 1 1606 2057 1 0 1 539.2693 1076.5241 2 1076.525 -0.0009 1 30.4 0.0083 K IREEYPDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2138.2138.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 479 3134 1 1 0 402.1732 802.3318 2 802.332 -0.0002 0 21.21 0.01 R FFSDCK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3343.3343.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 1271 41 1 1 0 334.491 1000.4513 3 1000.4509 0.0004 1 30.43 0.0035 K DRETMGHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1005.1005.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 1684 3595 1 1 0 364.8645 1091.5716 3 1091.5724 -0.0008 0 28.12 0.0023 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3883.3883.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 2702 5945 1 1 1 667.824 1333.6334 2 1333.6336 -0.0002 0 52.07 3.00E-05 K SNNVEMDWVLK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6587.6587.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 3418 4937 1 1 1 752.8459 1503.6772 2 1503.6776 -0.0004 0 75.8 7.80E-08 R GLPWSCSADEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5355.5355.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 4272 2931 1 1 0 562.2599 1683.758 3 1683.7601 -0.0021 0 86.47 1.80E-08 K HTGPNSPDTANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3095.3095.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 4748 6263 1 1 0 614.6359 1840.8858 3 1840.8843 0.0015 0 57.14 4.40E-06 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6973.6973.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 5191 7326 1 1 0 998.991 1995.9675 2 1995.969 -0.0015 0 56.18 5.40E-06 R ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8313.8313.2.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 5192 7324 1 1 0 666.3318 1995.9737 3 1995.969 0.0047 0 48.96 4.60E-05 R ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8310.8310.3.dta 9 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 330 49484 10 10 9 9 5523 4871 2 1 1 726.6708 2176.9907 3 2176.9947 -0.004 0 24.75 0.0049 R VTGEADVEFATHEDAVAAMSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5283.5283.3.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 227 45985 8 8 6 6 172 3888 1 0 1 346.7211 691.4277 2 691.4268 0.0009 0 26.9 0.0063 R YIGIVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4201.4201.2.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 227 45985 8 8 6 6 679 3022 1 0 1 424.7713 847.5281 2 847.528 0.0002 1 26.39 0.0075 R RYIGIVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3218.3218.2.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 227 45985 8 8 6 6 1684 3595 1 0 0 364.8645 1091.5716 3 1091.5724 -0.0008 0 28.12 0.0023 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3883.3883.3.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 227 45985 8 8 6 6 4884 6935 1 0 1 934.4752 1866.9359 2 1866.9363 -0.0004 0 86.22 3.10E-08 K ITGEAFVQFASQELAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7835.7835.2.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 227 45985 8 8 6 6 4885 6951 1 0 1 623.32 1866.9382 3 1866.9363 0.0019 0 50.3 3.80E-05 K ITGEAFVQFASQELAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7855.7855.3.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 227 45985 8 8 6 6 5191 7326 1 0 0 998.991 1995.9675 2 1995.969 -0.0015 0 56.18 5.40E-06 K ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8313.8313.2.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 227 45985 8 8 6 6 5192 7324 1 0 0 666.3318 1995.9737 3 1995.969 0.0047 0 48.96 4.60E-05 K ATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8310.8310.3.dta 9 2 IPI00003881.5 Heterogeneous nuclear ribonucleoprotein F 227 45985 8 8 6 6 6722 7169 1 0 1 852.437 2554.289 3 2554.2856 0.0034 1 26.52 0.0033 R GLPYKATENDIYNFFSPLNPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8109.8109.3.dta 9 3 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 168 49517 6 6 6 6 479 3134 1 0 0 402.1732 802.3318 2 802.332 -0.0002 0 21.21 0.01 R FFSDCK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3343.3343.2.dta 9 3 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 168 49517 6 6 6 6 1271 41 1 0 0 334.491 1000.4513 3 1000.4509 0.0004 1 30.43 0.0035 K DRETMGHR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1005.1005.3.dta 9 3 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 168 49517 6 6 6 6 1684 3595 1 0 0 364.8645 1091.5716 3 1091.5724 -0.0008 0 28.12 0.0023 R VHIEIGPDGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3883.3883.3.dta 9 3 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 168 49517 6 6 6 6 4272 2931 1 0 0 562.2599 1683.758 3 1683.7601 -0.0021 0 86.47 1.80E-08 K HTGPNSPDTANDGFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3095.3095.3.dta 9 3 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 168 49517 6 6 6 6 4748 6263 1 0 0 614.6359 1840.8858 3 1840.8843 0.0015 0 57.14 4.40E-06 R STGEAFVQFASQEIAEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6973.6973.3.dta 9 3 IPI00026230.1 Heterogeneous nuclear ribonucleoprotein H~ 168 49517 6 6 6 6 5523 4871 1 0 1 726.6708 2176.9907 3 2176.9947 -0.004 0 26.32 0.0034 R VTGEADVEFATHEDAVAAMAK D Oxidation (M) 0.000000000000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5283.5283.3.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 605 4665 1 1 1 418.2202 834.4259 2 834.4269 -0.001 0 38.91 0.0031 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5049.5049.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 606 5093 1 1 1 418.2203 834.4261 2 834.4269 -0.0008 0 44.69 0.00084 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5529.5529.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 607 4175 1 1 1 418.2206 834.4266 2 834.4269 -0.0003 0 41.1 0.0024 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4509.4509.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 608 4950 1 1 1 418.2206 834.4266 2 834.4269 -0.0003 0 35.05 0.0095 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5371.5371.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 609 4026 1 1 1 418.2207 834.4268 2 834.4269 -0.0001 0 31.85 0.02 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4349.4349.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 610 4468 1 1 1 418.2209 834.4273 2 834.4269 0.0004 0 30.86 0.025 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4831.4831.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 611 4803 1 1 1 418.2211 834.4276 2 834.4269 0.0007 0 30.25 0.029 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5202.5202.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 627 3391 1 1 1 419.755 837.4955 2 837.496 -0.0005 0 25.77 0.013 K ALPAPIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3646.3646.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 645 3497 1 1 1 419.7573 837.5 2 837.496 0.004 0 29.33 0.01 K ALPAPIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3773.3773.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 691 3887 1 1 1 426.2177 850.4208 2 850.4218 -0.0011 0 33.17 0.0087 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4200.4200.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 692 3603 1 1 1 426.2178 850.4211 2 850.4218 -0.0008 0 43.57 0.00079 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3892.3892.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 693 8417 1 1 1 426.2178 850.4211 2 850.4218 -0.0007 0 38.73 0.0024 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9609.9609.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 694 8518 1 1 1 426.218 850.4214 2 850.4218 -0.0004 0 27.76 0.028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9736.9736.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 695 4249 1 1 1 426.218 850.4214 2 850.4218 -0.0004 0 35.1 0.0082 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4587.4587.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 696 8287 1 1 1 426.218 850.4215 2 850.4218 -0.0003 0 36.48 0.006 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9448.9448.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 697 3754 1 1 1 426.218 850.4215 2 850.4218 -0.0003 0 40.49 0.0024 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4056.4056.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 699 3355 1 1 1 426.2181 850.4217 2 850.4218 -0.0002 0 43.54 0.0012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3605.3605.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 700 4407 1 1 1 426.2181 850.4217 2 850.4218 -0.0002 0 36.4 0.0061 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4761.4761.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 702 3235 1 1 1 426.2183 850.422 2 850.4218 0.0001 0 50.59 0.00023 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3462.3462.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 703 989 1 1 1 426.2183 850.422 2 850.4218 0.0001 0 32.8 0.014 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.11330.11330.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 705 1081 1 1 1 426.2183 850.422 2 850.4218 0.0002 0 36.15 0.0064 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.11443.11443.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 706 4055 1 1 1 426.2183 850.422 2 850.4218 0.0002 0 38.26 0.004 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4379.4379.2.dta 10 1 IPI00168728.1 FLJ00385 protein (Fragment) 291 57272 23 23 3 3 2429 4045 1 1 1 634.3838 1266.7531 2 1266.7547 -0.0016 1 54.01 1.70E-05 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4369.4369.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 605 4665 1 0 1 418.2202 834.4259 2 834.4269 -0.001 0 38.91 0.0031 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5049.5049.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 606 5093 1 0 1 418.2203 834.4261 2 834.4269 -0.0008 0 44.69 0.00084 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5529.5529.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 607 4175 1 0 1 418.2206 834.4266 2 834.4269 -0.0003 0 41.1 0.0024 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4509.4509.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 608 4950 1 0 1 418.2206 834.4266 2 834.4269 -0.0003 0 35.05 0.0095 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5371.5371.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 609 4026 1 0 1 418.2207 834.4268 2 834.4269 -0.0001 0 31.85 0.02 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4349.4349.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 610 4468 1 0 1 418.2209 834.4273 2 834.4269 0.0004 0 30.86 0.025 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4831.4831.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 611 4803 1 0 1 418.2211 834.4276 2 834.4269 0.0007 0 30.25 0.029 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5202.5202.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 691 3887 1 0 1 426.2177 850.4208 2 850.4218 -0.0011 0 33.17 0.0087 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4200.4200.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 692 3603 1 0 1 426.2178 850.4211 2 850.4218 -0.0008 0 43.57 0.00079 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3892.3892.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 693 8417 1 0 1 426.2178 850.4211 2 850.4218 -0.0007 0 38.73 0.0024 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9609.9609.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 694 8518 1 0 1 426.218 850.4214 2 850.4218 -0.0004 0 27.76 0.028 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9736.9736.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 695 4249 1 0 1 426.218 850.4214 2 850.4218 -0.0004 0 35.1 0.0082 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4587.4587.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 696 8287 1 0 1 426.218 850.4215 2 850.4218 -0.0003 0 36.48 0.006 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9448.9448.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 697 3754 1 0 1 426.218 850.4215 2 850.4218 -0.0003 0 40.49 0.0024 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4056.4056.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 699 3355 1 0 1 426.2181 850.4217 2 850.4218 -0.0002 0 43.54 0.0012 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3605.3605.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 700 4407 1 0 1 426.2181 850.4217 2 850.4218 -0.0002 0 36.4 0.0061 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4761.4761.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 702 3235 1 0 1 426.2183 850.422 2 850.4218 0.0001 0 50.59 0.00023 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3462.3462.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 703 989 1 0 1 426.2183 850.422 2 850.4218 0.0001 0 32.8 0.014 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.11330.11330.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 705 1081 1 0 1 426.2183 850.422 2 850.4218 0.0002 0 36.15 0.0064 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.11443.11443.2.dta 10 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 242 46716 20 20 1 1 706 4055 1 0 1 426.2183 850.422 2 850.4218 0.0002 0 38.26 0.004 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4379.4379.2.dta 11 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 248 46353 5 5 5 5 1368 4125 1 1 0 509.7815 1017.5484 2 1017.5495 -0.0011 1 38.1 0.0044 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4454.4454.2.dta 11 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 248 46353 5 5 5 5 1755 5898 1 1 1 557.8451 1113.6756 2 1113.6758 -0.0001 0 61.95 3.80E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6533.6533.2.dta 11 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 248 46353 5 5 5 5 2994 3884 1 1 1 697.8488 1393.6831 2 1393.6838 -0.0007 0 113.26 9.80E-11 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4197.4197.2.dta 11 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 248 46353 5 5 5 5 3582 6905 1 1 1 778.3611 1554.7077 2 1554.7058 0.0019 0 88.93 1.80E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7797.7797.2.dta 11 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 248 46353 5 5 5 5 3828 4935 1 1 1 540.2962 1617.8668 3 1617.8661 0.0007 0 35.36 0.00058 K LQMEAPHIIVGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5352.5352.3.dta 11 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 180 47126 6 6 5 5 392 4975 1 0 1 390.7072 779.3999 2 779.4 -0.0001 0 25.44 0.03 R VFDMIR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5399.5399.2.dta 11 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 180 47126 6 6 5 5 1368 4125 1 0 0 509.7815 1017.5484 2 1017.5495 -0.0011 1 38.1 0.0044 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4454.4454.2.dta 11 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 180 47126 6 6 5 5 2063 2124 1 0 1 595.8035 1189.5924 2 1189.5939 -0.0015 0 85.48 3.30E-08 R DVIAQSQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2218.2218.2.dta 11 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 180 47126 6 6 5 5 3036 1786 1 0 1 702.3651 1402.7156 2 1402.7165 -0.0009 1 64.81 8.40E-07 K GRDVIAQSQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1851.1851.2.dta 11 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 180 47126 6 6 5 5 3037 1782 1 0 1 468.5792 1402.7157 3 1402.7165 -0.0008 1 39.88 0.00018 K GRDVIAQSQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1847.1847.3.dta 11 2 IPI00009328.4 Probable ATP-dependent RNA helicase DDX48 180 47126 6 6 5 5 3311 3214 1 0 1 490.5876 1468.7408 3 1468.7423 -0.0015 0 29.03 0.0047 K LDYGQHVVAGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3433.3433.3.dta 11 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 229 46601 4 4 4 4 1368 4125 1 0 0 509.7815 1017.5484 2 1017.5495 -0.0011 1 38.1 0.0044 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4454.4454.2.dta 11 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 229 46601 4 4 4 4 1755 5898 1 0 1 557.8451 1113.6756 2 1113.6758 -0.0001 0 61.95 3.80E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6533.6533.2.dta 11 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 229 46601 4 4 4 4 2994 3884 1 0 1 697.8488 1393.6831 2 1393.6838 -0.0007 0 113.26 9.80E-11 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4197.4197.2.dta 11 IPI00328328.3 Isoform 1 of Eukaryotic initiation factor 4A-II 229 46601 4 4 4 4 3582 6905 1 0 1 778.3611 1554.7077 2 1554.7058 0.0019 0 88.93 1.80E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7797.7797.2.dta 11 IPI00555602.1 CD68 antigen variant (Fragment) 207 42846 4 4 4 4 1368 4125 1 0 0 509.7815 1017.5484 2 1017.5495 -0.0011 1 38.1 0.0044 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4454.4454.2.dta 11 IPI00555602.1 CD68 antigen variant (Fragment) 207 42846 4 4 4 4 2994 3884 1 0 1 697.8488 1393.6831 2 1393.6838 -0.0007 0 113.26 9.80E-11 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4197.4197.2.dta 11 IPI00555602.1 CD68 antigen variant (Fragment) 207 42846 4 4 4 4 3582 6905 1 0 1 778.3611 1554.7077 2 1554.7058 0.0019 0 88.93 1.80E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7797.7797.2.dta 11 IPI00555602.1 CD68 antigen variant (Fragment) 207 42846 4 4 4 4 3828 4935 1 0 1 540.2962 1617.8668 3 1617.8661 0.0007 0 35.36 0.00058 K LQMEAPHIIVGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5352.5352.3.dta 11 IPI00790077.1 25 kDa protein 177 24740 2 2 2 2 2994 3884 1 0 1 697.8488 1393.6831 2 1393.6838 -0.0007 0 113.26 9.80E-11 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4197.4197.2.dta 11 IPI00790077.1 25 kDa protein 177 24740 2 2 2 2 3582 6905 1 0 1 778.3611 1554.7077 2 1554.7058 0.0019 0 88.93 1.80E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7797.7797.2.dta 11 IPI00386604.1 Hypothetical protein (Fragment) 160 51913 4 4 4 4 1368 4125 1 0 0 509.7815 1017.5484 2 1017.5495 -0.0011 1 38.1 0.0044 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4454.4454.2.dta 11 IPI00386604.1 Hypothetical protein (Fragment) 160 51913 4 4 4 4 1755 5898 1 0 1 557.8451 1113.6756 2 1113.6758 -0.0001 0 61.95 3.80E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6533.6533.2.dta 11 IPI00386604.1 Hypothetical protein (Fragment) 160 51913 4 4 4 4 3582 6905 1 0 1 778.3611 1554.7077 2 1554.7058 0.0019 0 88.93 1.80E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7797.7797.2.dta 11 IPI00386604.1 Hypothetical protein (Fragment) 160 51913 4 4 4 4 3828 4935 1 0 1 540.2962 1617.8668 3 1617.8661 0.0007 0 35.36 0.00058 K LQMEAPHIIVGTPGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5352.5352.3.dta 11 IPI00030296.6 BM-010 142 36301 3 3 3 3 1368 4125 1 0 0 509.7815 1017.5484 2 1017.5495 -0.0011 1 38.1 0.0044 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4454.4454.2.dta 11 IPI00030296.6 BM-010 142 36301 3 3 3 3 1755 5898 1 0 1 557.8451 1113.6756 2 1113.6758 -0.0001 0 61.95 3.80E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6533.6533.2.dta 11 IPI00030296.6 BM-010 142 36301 3 3 3 3 3582 6905 1 0 1 778.3611 1554.7077 2 1554.7058 0.0019 0 88.93 1.80E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7797.7797.2.dta 11 IPI00792676.1 14 kDa protein 113 14612 1 1 1 1 2994 3884 1 0 1 697.8488 1393.6831 2 1393.6838 -0.0007 0 113.26 9.80E-11 K GYDVIAQAQSGTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4197.4197.2.dta 11 IPI00793220.1 18 kDa protein 89 17876 1 1 1 1 3582 6905 1 0 1 778.3611 1554.7077 2 1554.7058 0.0019 0 88.93 1.80E-08 K MFVLDEADEMLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7797.7797.2.dta 11 IPI00163147.6 46 kDa protein 77 45900 2 2 2 2 1368 4125 1 0 0 509.7815 1017.5484 2 1017.5495 -0.0011 1 38.1 0.0044 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4454.4454.2.dta 11 IPI00163147.6 46 kDa protein 77 45900 2 2 2 2 1755 5898 1 0 1 557.8451 1113.6756 2 1113.6758 -0.0001 0 61.95 3.80E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6533.6533.2.dta 11 IPI00790597.1 6 kDa protein 62 6359 1 1 1 1 1755 5898 1 0 1 557.8451 1113.6756 2 1113.6758 -0.0001 0 61.95 3.80E-06 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6533.6533.2.dta 11 IPI00794607.1 21 kDa protein 38 21019 1 1 1 1 1368 4125 1 0 0 509.7815 1017.5484 2 1017.5495 -0.0011 1 38.1 0.0044 R KVDWLTEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4454.4454.2.dta 12 1 IPI00169383.3 Phosphoglycerate kinase 1 242 44985 9 9 9 9 255 4382 1 1 1 362.1962 722.3778 2 722.3785 -0.0007 0 37.65 0.0042 K AGGFLMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4730.4730.2.dta 12 1 IPI00169383.3 Phosphoglycerate kinase 1 242 44985 9 9 9 9 513 2008 1 1 1 405.2114 808.4082 2 808.4079 0.0003 0 39.08 0.00078 K YAEAVTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2086.2086.2.dta 12 1 IPI00169383.3 Phosphoglycerate kinase 1 242 44985 9 9 9 9 802 4393 1 1 1 442.729 883.4434 2 883.4439 -0.0005 0 32.92 0.0061 K ELNYFAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4743.4743.2.dta 12 1 IPI00169383.3 Phosphoglycerate kinase 1 242 44985 9 9 9 9 1466 4349 1 1 1 348.8818 1043.6235 3 1043.6226 0.0008 1 21.43 0.02 K LTLDKLDVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4694.4694.3.dta 12 1 IPI00169383.3 Phosphoglycerate kinase 1 242 44985 9 9 9 9 1702 6756 1 1 1 549.3138 1096.613 2 1096.6128 0.0002 0 52.71 2.60E-05 K VLPGVDALSNI - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7607.7607.2.dta 12 1 IPI00169383.3 Phosphoglycerate kinase 1 242 44985 9 9 9 9 1712 1396 1 1 1 551.272 1100.5295 2 1100.5323 -0.0027 0 30.27 0.0014 K NNQITNNQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1424.1424.2.dta 12 1 IPI00169383.3 Phosphoglycerate kinase 1 242 44985 9 9 9 9 3929 4813 1 1 1 545.6028 1633.7865 3 1633.7849 0.0016 0 45.11 6.30E-05 K LGDVYVNDAFGTAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5215.5215.3.dta 12 1 IPI00169383.3 Phosphoglycerate kinase 1 242 44985 9 9 9 9 4523 4416 1 1 1 877.8961 1753.7776 2 1753.7798 -0.0022 0 96.95 2.10E-09 R GCITIIGGGDTATCCAK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4772.4772.2.dta 12 1 IPI00169383.3 Phosphoglycerate kinase 1 242 44985 9 9 9 9 4572 6498 1 1 1 590.3369 1767.9887 3 1767.9883 0.0005 0 45.25 0.00017 K ALESPERPFLAILGGAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7290.7290.3.dta 12 IPI00219568.4 "Phosphoglycerate kinase, testis specific" 45 45166 1 1 1 1 3929 4813 1 0 1 545.6028 1633.7865 3 1633.7849 0.0016 0 45.11 6.30E-05 K LGDVYVNDAFGTAHR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5215.5215.3.dta 12 IPI00396468.3 36 kDa protein 38 36633 1 1 1 1 255 4382 1 0 1 362.1962 722.3778 2 722.3785 -0.0007 0 37.65 0.0042 K AGGFLMK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4730.4730.2.dta 13 1 IPI00016610.2 Poly(rC)-binding protein 1 240 37987 7 7 6 6 721 2105 1 1 0 431.7263 861.438 2 861.4378 0.0002 0 54.46 8.70E-05 R QMSGAQIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2198.2198.2.dta 13 1 IPI00016610.2 Poly(rC)-binding protein 1 240 37987 7 7 6 6 1338 3021 1 1 1 507.7694 1013.5243 2 1013.5254 -0.0011 0 52.42 9.80E-05 R QGANINEIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3215.3215.2.dta 13 1 IPI00016610.2 Poly(rC)-binding protein 1 240 37987 7 7 6 6 1657 2709 1 1 1 543.7804 1085.5462 2 1085.5465 -0.0003 0 47.64 3.40E-05 K IANPVEGSSGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2848.2848.2.dta 13 1 IPI00016610.2 Poly(rC)-binding protein 1 240 37987 7 7 6 6 2508 2927 1 1 0 644.7989 1287.5832 2 1287.5877 -0.0045 0 67.48 1.00E-06 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3090.3090.2.dta 13 1 IPI00016610.2 Poly(rC)-binding protein 1 240 37987 7 7 6 6 2509 2930 1 1 0 644.7996 1287.5846 2 1287.5877 -0.0032 0 67.28 4.90E-07 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3094.3094.2.dta 13 1 IPI00016610.2 Poly(rC)-binding protein 1 240 37987 7 7 6 6 2961 6178 1 1 1 694.9107 1387.8069 2 1387.8075 -0.0006 0 38.27 0.00026 R IITLTGPTNAIFK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6876.6876.2.dta 13 1 IPI00016610.2 Poly(rC)-binding protein 1 240 37987 7 7 6 6 3355 3926 1 1 0 494.6213 1480.8421 3 1480.8436 -0.0015 1 25.64 0.0039 R LLMHGKEVGSIIGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4242.4242.3.dta 13 2 IPI00012066.2 poly(rC)-binding protein 2 isoform b 187 38597 5 5 4 4 721 2105 1 0 0 431.7263 861.438 2 861.4378 0.0002 0 54.46 8.70E-05 R QMSGAQIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2198.2198.2.dta 13 2 IPI00012066.2 poly(rC)-binding protein 2 isoform b 187 38597 5 5 4 4 2508 2927 1 0 0 644.7989 1287.5832 2 1287.5877 -0.0045 0 67.48 1.00E-06 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3090.3090.2.dta 13 2 IPI00012066.2 poly(rC)-binding protein 2 isoform b 187 38597 5 5 4 4 2509 2930 1 0 0 644.7996 1287.5846 2 1287.5877 -0.0032 0 67.28 4.90E-07 R INISEGNCPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3094.3094.2.dta 13 2 IPI00012066.2 poly(rC)-binding protein 2 isoform b 187 38597 5 5 4 4 3118 4681 1 0 1 714.8948 1427.7751 2 1427.7806 -0.0055 0 50.88 6.70E-05 R LVVPASQCGSLIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5066.5066.2.dta 13 2 IPI00012066.2 poly(rC)-binding protein 2 isoform b 187 38597 5 5 4 4 3355 3926 1 0 0 494.6213 1480.8421 3 1480.8436 -0.0015 1 25.64 0.0039 R LLMHGKEVGSIIGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4242.4242.3.dta 13 IPI00788837.1 16 kDa protein 54 16028 1 1 1 1 721 2105 1 0 0 431.7263 861.438 2 861.4378 0.0002 0 54.46 8.70E-05 R QMSGAQIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2198.2198.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 232 3078 1 1 1 358.2209 714.4273 2 714.4276 -0.0003 0 26.27 0.04 R AVLGEVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3281.3281.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 346 4246 1 1 1 381.7107 761.4069 2 761.4072 -0.0003 0 32.96 0.013 R TPEFLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4584.4584.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 563 4278 1 1 1 411.2295 820.4444 2 820.4443 0.0001 0 34.65 0.004 R TFLVGER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4618.4618.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 1052 1583 1 1 1 474.7613 947.508 2 947.5076 0.0004 1 27.24 0.036 K KFAETQPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1624.1624.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 1766 7174 1 1 1 559.8448 1117.6751 2 1117.6747 0.0005 0 64.91 8.90E-07 R ILGLLDAYLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8114.8114.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 1790 3519 1 1 1 375.2133 1122.6181 3 1122.6186 -0.0004 1 45.99 0.00017 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3800.3800.3.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 2317 5200 1 1 1 621.3289 1240.6433 2 1240.6452 -0.0019 1 35.72 0.00045 K STFVLDEFKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5653.5653.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 2761 4190 1 1 1 674.3723 1346.7301 2 1346.7306 -0.0005 0 78.39 1.30E-07 K ALIAAQYSGAQVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4525.4525.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 3208 3960 1 1 1 722.8665 1443.7184 2 1443.7205 -0.0022 0 17.73 0.022 K LDPGSEETQTLVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4278.4278.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 3638 3510 1 1 1 786.9157 1571.8169 2 1571.8155 0.0014 1 32.03 0.0056 R KLDPGSEETQTLVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3789.3789.2.dta 14 1 IPI00000875.6 Elongation factor 1-gamma 218 50429 11 11 11 11 8278 7879 1 1 1 1066.8156 3197.4248 3 3197.4288 -0.004 0 31.17 0.0032 K VPAFEGDDGFCVFESNAIAYYVSNEELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8969.8969.3.dta 14 IPI00738381.2 similar to Elongation factor 1-gamma 140 50612 6 6 6 6 563 4278 1 0 1 411.2295 820.4444 2 820.4443 0.0001 0 34.65 0.004 R TFLVGER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4618.4618.2.dta 14 IPI00738381.2 similar to Elongation factor 1-gamma 140 50612 6 6 6 6 1052 1583 1 0 1 474.7613 947.508 2 947.5076 0.0004 1 27.24 0.036 K KFAETQPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1624.1624.2.dta 14 IPI00738381.2 similar to Elongation factor 1-gamma 140 50612 6 6 6 6 1766 7174 1 0 1 559.8448 1117.6751 2 1117.6747 0.0005 0 64.91 8.90E-07 R ILGLLDAYLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8114.8114.2.dta 14 IPI00738381.2 similar to Elongation factor 1-gamma 140 50612 6 6 6 6 1790 3519 1 0 1 375.2133 1122.6181 3 1122.6186 -0.0004 1 45.99 0.00017 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3800.3800.3.dta 14 IPI00738381.2 similar to Elongation factor 1-gamma 140 50612 6 6 6 6 2317 5200 1 0 1 621.3289 1240.6433 2 1240.6452 -0.0019 1 35.72 0.00045 K STFVLDEFKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5653.5653.2.dta 14 IPI00738381.2 similar to Elongation factor 1-gamma 140 50612 6 6 6 6 8278 7879 1 0 1 1066.8156 3197.4248 3 3197.4288 -0.004 0 31.17 0.0032 K VPAFEGDDGFCVFESNAIAYYVSNEELR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8969.8969.3.dta 14 IPI00744181.1 "Glutathione S-transferase, N-terminal domain containing protein" 46 36806 1 1 1 1 1790 3519 1 0 1 375.2133 1122.6181 3 1122.6186 -0.0004 1 45.99 0.00017 K AKDPFAHLPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3800.3800.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 184 5427 2 1 1 348.6949 695.3752 2 695.3755 -0.0003 0 27.42 0.021 K GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5926.5926.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 306 3576 1 1 0 376.203 750.3914 2 750.3912 0.0002 0 35.29 0.0069 K TFNLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3862.3862.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 807 3388 1 1 1 443.7539 885.4933 2 885.492 0.0013 0 29.73 0.0034 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3643.3643.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 851 2924 1 1 1 300.8359 899.4859 3 899.4865 -0.0006 0 26.73 0.044 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3087.3087.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 1655 8649 1 1 1 543.7752 1085.5359 2 1085.5366 -0.0008 1 50.57 0.00018 K NQQFHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.990.990.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 1656 8633 2 1 1 362.8531 1085.5375 3 1085.5366 0.0009 1 19.96 0.046 K NQQFHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.988.988.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 2254 2644 1 1 1 614.826 1227.6374 2 1227.636 0.0014 1 28.83 0.002 R AAPGAEFAPNKR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2772.2772.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 2272 3549 1 1 1 411.2316 1230.6729 3 1230.6721 0.0008 0 25.53 0.0085 K GIVEFSGKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3833.3833.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 2345 2983 1 1 1 416.8758 1247.6056 3 1247.6081 -0.0024 0 54.6 2.00E-05 R FACHSASLTVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3165.3165.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 2346 2990 1 1 1 416.8762 1247.6068 3 1247.6081 -0.0013 0 39.34 0.00084 R FACHSASLTVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3179.3179.3.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 4337 5465 1 1 1 848.3768 1694.7391 2 1694.7399 -0.0008 0 65.42 7.30E-07 R FAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5971.5971.2.dta 15 1 IPI00304596.3 Non-POU domain-containing octamer-binding protein 200 54311 12 12 10 10 7181 415 1 1 1 890.1138 2667.3197 3 2667.318 0.0016 0 20.33 0.026 R NLPQYVSNELLEEAFSVFGQVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.10560.10560.3.dta 15 IPI00645010.1 30 kDa protein 138 29660 6 6 5 5 184 5427 2 0 1 348.6949 695.3752 2 695.3755 -0.0003 0 27.42 0.021 K GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5926.5926.2.dta 15 IPI00645010.1 30 kDa protein 138 29660 6 6 5 5 306 3576 1 0 0 376.203 750.3914 2 750.3912 0.0002 0 35.29 0.0069 K TFNLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3862.3862.2.dta 15 IPI00645010.1 30 kDa protein 138 29660 6 6 5 5 851 2924 1 0 1 300.8359 899.4859 3 899.4865 -0.0006 0 26.73 0.044 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3087.3087.3.dta 15 IPI00645010.1 30 kDa protein 138 29660 6 6 5 5 2345 2983 1 0 1 416.8758 1247.6056 3 1247.6081 -0.0024 0 54.6 2.00E-05 R FACHSASLTVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3165.3165.3.dta 15 IPI00645010.1 30 kDa protein 138 29660 6 6 5 5 2346 2990 1 0 1 416.8762 1247.6068 3 1247.6081 -0.0013 0 39.34 0.00084 R FACHSASLTVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3179.3179.3.dta 15 IPI00645010.1 30 kDa protein 138 29660 6 6 5 5 4337 5465 1 0 1 848.3768 1694.7391 2 1694.7399 -0.0008 0 65.42 7.30E-07 R FAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5971.5971.2.dta 15 IPI00644848.1 Protein 120 28341 7 7 6 6 184 5427 2 0 1 348.6949 695.3752 2 695.3755 -0.0003 0 27.42 0.021 K GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5926.5926.2.dta 15 IPI00644848.1 Protein 120 28341 7 7 6 6 807 3388 1 0 1 443.7539 885.4933 2 885.492 0.0013 0 29.73 0.0034 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3643.3643.2.dta 15 IPI00644848.1 Protein 120 28341 7 7 6 6 851 2924 1 0 1 300.8359 899.4859 3 899.4865 -0.0006 0 26.73 0.044 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3087.3087.3.dta 15 IPI00644848.1 Protein 120 28341 7 7 6 6 1655 8649 1 0 1 543.7752 1085.5359 2 1085.5366 -0.0008 1 50.57 0.00018 K NQQFHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.990.990.2.dta 15 IPI00644848.1 Protein 120 28341 7 7 6 6 1656 8633 2 0 1 362.8531 1085.5375 3 1085.5366 0.0009 1 19.96 0.046 K NQQFHKER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.988.988.3.dta 15 IPI00644848.1 Protein 120 28341 7 7 6 6 2272 3549 1 0 1 411.2316 1230.6729 3 1230.6721 0.0008 0 25.53 0.0085 K GIVEFSGKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3833.3833.3.dta 15 IPI00644848.1 Protein 120 28341 7 7 6 6 4337 5465 1 0 1 848.3768 1694.7391 2 1694.7399 -0.0008 0 65.42 7.30E-07 R FAQPGSFEYEYAMR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5971.5971.2.dta 15 IPI00645966.1 24 kDa protein 112 23715 8 8 7 7 184 5427 2 0 1 348.6949 695.3752 2 695.3755 -0.0003 0 27.42 0.021 K GFGFIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5926.5926.2.dta 15 IPI00645966.1 24 kDa protein 112 23715 8 8 7 7 306 3576 1 0 0 376.203 750.3914 2 750.3912 0.0002 0 35.29 0.0069 K TFNLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3862.3862.2.dta 15 IPI00645966.1 24 kDa protein 112 23715 8 8 7 7 807 3388 1 0 1 443.7539 885.4933 2 885.492 0.0013 0 29.73 0.0034 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3643.3643.2.dta 15 IPI00645966.1 24 kDa protein 112 23715 8 8 7 7 851 2924 1 0 1 300.8359 899.4859 3 899.4865 -0.0006 0 26.73 0.044 K AGEVFIHK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3087.3087.3.dta 15 IPI00645966.1 24 kDa protein 112 23715 8 8 7 7 2272 3549 1 0 1 411.2316 1230.6729 3 1230.6721 0.0008 0 25.53 0.0085 K GIVEFSGKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3833.3833.3.dta 15 IPI00645966.1 24 kDa protein 112 23715 8 8 7 7 2345 2983 1 0 1 416.8758 1247.6056 3 1247.6081 -0.0024 0 54.6 2.00E-05 R FACHSASLTVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3165.3165.3.dta 15 IPI00645966.1 24 kDa protein 112 23715 8 8 7 7 2346 2990 1 0 1 416.8762 1247.6068 3 1247.6081 -0.0013 0 39.34 0.00084 R FACHSASLTVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3179.3179.3.dta 15 IPI00645966.1 24 kDa protein 112 23715 8 8 7 7 7181 415 1 0 1 890.1138 2667.3197 3 2667.318 0.0016 0 20.33 0.026 R NLPQYVSNELLEEAFSVFGQVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.10560.10560.3.dta 15 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 30 76216 1 1 1 1 807 3388 1 0 1 443.7539 885.4933 2 885.492 0.0013 0 29.73 0.0034 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3643.3643.2.dta 16 1 IPI00396485.3 Elongation factor 1-alpha 1 186 50451 7 7 6 6 650 3139 1 1 1 420.2293 838.444 2 838.4436 0.0004 0 25.79 0.046 K EVSTYIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3349.3349.2.dta 16 1 IPI00396485.3 Elongation factor 1-alpha 1 186 50451 7 7 6 6 753 3779 1 1 1 435.7739 869.5333 2 869.5334 -0.0002 0 29.57 0.0067 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4083.4083.2.dta 16 1 IPI00396485.3 Elongation factor 1-alpha 1 186 50451 7 7 6 6 828 2241 1 1 1 447.7513 893.488 2 893.4858 0.0021 1 32.47 0.0062 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2341.2341.2.dta 16 1 IPI00396485.3 Elongation factor 1-alpha 1 186 50451 7 7 6 6 1769 2730 1 1 1 560.8025 1119.5904 2 1119.5924 -0.002 0 56.32 3.70E-05 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2873.2873.2.dta 16 1 IPI00396485.3 Elongation factor 1-alpha 1 186 50451 7 7 6 6 3727 4282 1 1 1 530.2987 1587.8743 3 1587.8733 0.001 0 56.44 5.10E-06 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4623.4623.3.dta 16 1 IPI00396485.3 Elongation factor 1-alpha 1 186 50451 7 7 6 6 7878 8576 1 1 1 970.4834 2908.4284 3 2908.431 -0.0027 0 71.04 9.30E-07 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9808.9808.3.dta 16 1 IPI00396485.3 Elongation factor 1-alpha 1 186 50451 7 7 6 6 7907 8355 1 1 1 975.8151 2924.4235 3 2924.426 -0.0024 0 40.19 0.00017 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9528.9528.3.dta 16 IPI00014424.1 Elongation factor 1-alpha 2 184 50780 6 6 5 5 753 3779 1 0 1 435.7739 869.5333 2 869.5334 -0.0002 0 29.57 0.0067 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4083.4083.2.dta 16 IPI00014424.1 Elongation factor 1-alpha 2 184 50780 6 6 5 5 828 2241 1 0 1 447.7513 893.488 2 893.4858 0.0021 1 32.47 0.0062 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2341.2341.2.dta 16 IPI00014424.1 Elongation factor 1-alpha 2 184 50780 6 6 5 5 1769 2730 1 0 1 560.8025 1119.5904 2 1119.5924 -0.002 0 56.32 3.70E-05 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2873.2873.2.dta 16 IPI00014424.1 Elongation factor 1-alpha 2 184 50780 6 6 5 5 3727 4282 1 0 1 530.2987 1587.8743 3 1587.8733 0.001 0 56.44 5.10E-06 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4623.4623.3.dta 16 IPI00014424.1 Elongation factor 1-alpha 2 184 50780 6 6 5 5 7878 8576 1 0 1 970.4834 2908.4284 3 2908.431 -0.0027 0 71.04 9.30E-07 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9808.9808.3.dta 16 IPI00014424.1 Elongation factor 1-alpha 2 184 50780 6 6 5 5 7907 8355 1 0 1 975.8151 2924.4235 3 2924.426 -0.0024 0 40.19 0.00017 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9528.9528.3.dta 16 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 175 16040 5 5 4 4 828 2241 1 0 1 447.7513 893.488 2 893.4858 0.0021 1 32.47 0.0062 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2341.2341.2.dta 16 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 175 16040 5 5 4 4 1769 2730 1 0 1 560.8025 1119.5904 2 1119.5924 -0.002 0 56.32 3.70E-05 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2873.2873.2.dta 16 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 175 16040 5 5 4 4 3727 4282 1 0 1 530.2987 1587.8743 3 1587.8733 0.001 0 56.44 5.10E-06 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4623.4623.3.dta 16 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 175 16040 5 5 4 4 7878 8576 1 0 1 970.4834 2908.4284 3 2908.431 -0.0027 0 71.04 9.30E-07 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9808.9808.3.dta 16 IPI00641459.2 Eukaryotic translation elongation factor 1 alpha 1 175 16040 5 5 4 4 7907 8355 1 0 1 975.8151 2924.4235 3 2924.426 -0.0024 0 40.19 0.00017 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9528.9528.3.dta 16 IPI00180730.1 Similar to Elongation factor 1-alpha 1 113 50464 5 5 5 5 650 3139 1 0 1 420.2293 838.444 2 838.4436 0.0004 0 25.79 0.046 K EVSTYIK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3349.3349.2.dta 16 IPI00180730.1 Similar to Elongation factor 1-alpha 1 113 50464 5 5 5 5 753 3779 1 0 1 435.7739 869.5333 2 869.5334 -0.0002 0 29.57 0.0067 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4083.4083.2.dta 16 IPI00180730.1 Similar to Elongation factor 1-alpha 1 113 50464 5 5 5 5 828 2241 1 0 1 447.7513 893.488 2 893.4858 0.0021 1 32.47 0.0062 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2341.2341.2.dta 16 IPI00180730.1 Similar to Elongation factor 1-alpha 1 113 50464 5 5 5 5 1769 2730 1 0 1 560.8025 1119.5904 2 1119.5924 -0.002 0 56.32 3.70E-05 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2873.2873.2.dta 16 IPI00180730.1 Similar to Elongation factor 1-alpha 1 113 50464 5 5 5 5 3727 4282 1 0 1 530.2987 1587.8743 3 1587.8733 0.001 0 56.44 5.10E-06 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4623.4623.3.dta 16 IPI00431441.1 EEF1A1 protein 103 7639 3 3 3 3 828 2241 1 0 1 447.7513 893.488 2 893.4858 0.0021 1 32.47 0.0062 R TIEKFEK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2341.2341.2.dta 16 IPI00431441.1 EEF1A1 protein 103 7639 3 3 3 3 1769 2730 1 0 1 560.8025 1119.5904 2 1119.5924 -0.002 0 56.32 3.70E-05 K STTTGHLIYK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2873.2873.2.dta 16 IPI00431441.1 EEF1A1 protein 103 7639 3 3 3 3 3727 4282 1 0 1 530.2987 1587.8743 3 1587.8733 0.001 0 56.44 5.10E-06 K THINIVVIGHVDSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4623.4623.3.dta 16 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 102 37116 3 3 2 2 753 3779 1 0 1 435.7739 869.5333 2 869.5334 -0.0002 0 29.57 0.0067 K QLIVGVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4083.4083.2.dta 16 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 102 37116 3 3 2 2 7878 8576 1 0 1 970.4834 2908.4284 3 2908.431 -0.0027 0 71.04 9.30E-07 K NMITGTSQADCAVLIVAAGVGEFEAGISK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9808.9808.3.dta 16 IPI00556204.1 Eukaryotic translation elongation factor 1 alpha 2 variant (Fragment) 102 37116 3 3 2 2 7907 8355 1 0 1 975.8151 2924.4235 3 2924.426 -0.0024 0 40.19 0.00017 K NMITGTSQADCAVLIVAAGVGEFEAGISK N Oxidation (M) 0.01000000000000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9528.9528.3.dta 16 IPI00011757.1 RNA polymerase II elongation factor ELL2 26 72766 1 1 1 1 650 3139 1 0 1 420.2293 838.444 2 838.4436 0.0004 0 25.79 0.046 K DLSYTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3349.3349.2.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 237 1762 1 1 1 359.2113 716.4081 2 716.4069 0.0012 0 36.72 0.0078 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1826.1826.2.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 1763 2180 1 1 1 559.8056 1117.5967 2 1117.5979 -0.0012 1 47.02 0.00014 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2278.2278.2.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 1764 2177 1 1 1 373.5406 1117.5998 3 1117.5979 0.002 1 29.76 0.015 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2275.2275.3.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 2999 2196 1 1 1 465.5963 1393.7669 3 1393.7677 -0.0008 1 17.41 0.043 K IISKIENHEGVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2295.2295.3.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 3272 6231 1 1 1 731.9114 1461.8082 2 1461.8079 0.0003 0 67.75 4.40E-07 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6937.6937.2.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 4688 5987 1 1 1 607.9773 1820.9101 3 1820.9091 0.001 1 31.98 0.0094 R RFDEILEASDGIMVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6634.6634.3.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 4814 8545 1 1 1 620.6379 1858.892 3 1858.8924 -0.0004 0 42.63 0.00027 K FGVEQDVDMVFASFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9768.9768.3.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 4898 8156 1 1 1 625.9697 1874.8874 3 1874.8873 0 0 27.97 0.006 K FGVEQDVDMVFASFIR K Oxidation (M) 0.0000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9296.9296.3.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 5175 7840 1 1 1 663.3364 1986.9874 3 1986.9874 0.0001 1 19.86 0.014 K FGVEQDVDMVFASFIRK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8922.8922.3.dta 17 1 IPI00479186.5 Isoform M2 of Pyruvate kinase isozymes M1/M2 185 58470 10 10 8 8 5516 6416 1 1 1 725.7125 2174.1156 3 2174.1107 0.0049 0 40.34 0.00016 R LAPITSDPTEATAVGAVEASFK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7183.7183.3.dta 17 IPI00784179.1 58 kDa protein 176 58474 8 8 6 6 237 1762 1 0 1 359.2113 716.4081 2 716.4069 0.0012 0 36.72 0.0078 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1826.1826.2.dta 17 IPI00784179.1 58 kDa protein 176 58474 8 8 6 6 1763 2180 1 0 1 559.8056 1117.5967 2 1117.5979 -0.0012 1 47.02 0.00014 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2278.2278.2.dta 17 IPI00784179.1 58 kDa protein 176 58474 8 8 6 6 1764 2177 1 0 1 373.5406 1117.5998 3 1117.5979 0.002 1 29.76 0.015 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2275.2275.3.dta 17 IPI00784179.1 58 kDa protein 176 58474 8 8 6 6 3272 6231 1 0 1 731.9114 1461.8082 2 1461.8079 0.0003 0 67.75 4.40E-07 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6937.6937.2.dta 17 IPI00784179.1 58 kDa protein 176 58474 8 8 6 6 4814 8545 1 0 1 620.6379 1858.892 3 1858.8924 -0.0004 0 42.63 0.00027 K FGVEQDVDMVFASFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9768.9768.3.dta 17 IPI00784179.1 58 kDa protein 176 58474 8 8 6 6 4898 8156 1 0 1 625.9697 1874.8874 3 1874.8873 0 0 27.97 0.006 K FGVEQDVDMVFASFIR K Oxidation (M) 0.0000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9296.9296.3.dta 17 IPI00784179.1 58 kDa protein 176 58474 8 8 6 6 5175 7840 1 0 1 663.3364 1986.9874 3 1986.9874 0.0001 1 19.86 0.014 K FGVEQDVDMVFASFIRK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8922.8922.3.dta 17 IPI00784179.1 58 kDa protein 176 58474 8 8 6 6 5516 6416 1 0 1 725.7125 2174.1156 3 2174.1107 0.0049 0 40.34 0.00016 R LAPITSDPTEATAVGAVEASFK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7183.7183.3.dta 17 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 160 58538 9 9 7 7 237 1762 1 0 1 359.2113 716.4081 2 716.4069 0.0012 0 36.72 0.0078 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1826.1826.2.dta 17 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 160 58538 9 9 7 7 1763 2180 1 0 1 559.8056 1117.5967 2 1117.5979 -0.0012 1 47.02 0.00014 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2278.2278.2.dta 17 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 160 58538 9 9 7 7 1764 2177 1 0 1 373.5406 1117.5998 3 1117.5979 0.002 1 29.76 0.015 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2275.2275.3.dta 17 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 160 58538 9 9 7 7 2999 2196 1 0 1 465.5963 1393.7669 3 1393.7677 -0.0008 1 17.41 0.043 K IISKIENHEGVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2295.2295.3.dta 17 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 160 58538 9 9 7 7 3272 6231 1 0 1 731.9114 1461.8082 2 1461.8079 0.0003 0 67.75 4.40E-07 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6937.6937.2.dta 17 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 160 58538 9 9 7 7 4688 5987 1 0 1 607.9773 1820.9101 3 1820.9091 0.001 1 31.98 0.0094 R RFDEILEASDGIMVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6634.6634.3.dta 17 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 160 58538 9 9 7 7 4814 8545 1 0 1 620.6379 1858.892 3 1858.8924 -0.0004 0 42.63 0.00027 K FGVEQDVDMVFASFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9768.9768.3.dta 17 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 160 58538 9 9 7 7 4898 8156 1 0 1 625.9697 1874.8874 3 1874.8873 0 0 27.97 0.006 K FGVEQDVDMVFASFIR K Oxidation (M) 0.0000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9296.9296.3.dta 17 IPI00220644.8 Isoform M1 of Pyruvate kinase isozymes M1/M2 160 58538 9 9 7 7 5175 7840 1 0 1 663.3364 1986.9874 3 1986.9874 0.0001 1 19.86 0.014 K FGVEQDVDMVFASFIRK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8922.8922.3.dta 17 IPI00783061.1 58 kDa protein 151 58542 7 7 5 5 237 1762 1 0 1 359.2113 716.4081 2 716.4069 0.0012 0 36.72 0.0078 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1826.1826.2.dta 17 IPI00783061.1 58 kDa protein 151 58542 7 7 5 5 1763 2180 1 0 1 559.8056 1117.5967 2 1117.5979 -0.0012 1 47.02 0.00014 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2278.2278.2.dta 17 IPI00783061.1 58 kDa protein 151 58542 7 7 5 5 1764 2177 1 0 1 373.5406 1117.5998 3 1117.5979 0.002 1 29.76 0.015 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2275.2275.3.dta 17 IPI00783061.1 58 kDa protein 151 58542 7 7 5 5 3272 6231 1 0 1 731.9114 1461.8082 2 1461.8079 0.0003 0 67.75 4.40E-07 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6937.6937.2.dta 17 IPI00783061.1 58 kDa protein 151 58542 7 7 5 5 4814 8545 1 0 1 620.6379 1858.892 3 1858.8924 -0.0004 0 42.63 0.00027 K FGVEQDVDMVFASFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9768.9768.3.dta 17 IPI00783061.1 58 kDa protein 151 58542 7 7 5 5 4898 8156 1 0 1 625.9697 1874.8874 3 1874.8873 0 0 27.97 0.006 K FGVEQDVDMVFASFIR K Oxidation (M) 0.0000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9296.9296.3.dta 17 IPI00783061.1 58 kDa protein 151 58542 7 7 5 5 5175 7840 1 0 1 663.3364 1986.9874 3 1986.9874 0.0001 1 19.86 0.014 K FGVEQDVDMVFASFIRK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8922.8922.3.dta 17 IPI00607698.1 PKM2 protein 146 30540 6 6 4 4 237 1762 1 0 1 359.2113 716.4081 2 716.4069 0.0012 0 36.72 0.0078 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1826.1826.2.dta 17 IPI00607698.1 PKM2 protein 146 30540 6 6 4 4 1763 2180 1 0 1 559.8056 1117.5967 2 1117.5979 -0.0012 1 47.02 0.00014 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2278.2278.2.dta 17 IPI00607698.1 PKM2 protein 146 30540 6 6 4 4 1764 2177 1 0 1 373.5406 1117.5998 3 1117.5979 0.002 1 29.76 0.015 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2275.2275.3.dta 17 IPI00607698.1 PKM2 protein 146 30540 6 6 4 4 3272 6231 1 0 1 731.9114 1461.8082 2 1461.8079 0.0003 0 67.75 4.40E-07 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6937.6937.2.dta 17 IPI00607698.1 PKM2 protein 146 30540 6 6 4 4 4814 8545 1 0 1 620.6379 1858.892 3 1858.8924 -0.0004 0 42.63 0.00027 K FGVEQDVDMVFASFIR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9768.9768.3.dta 17 IPI00607698.1 PKM2 protein 146 30540 6 6 4 4 4898 8156 1 0 1 625.9697 1874.8874 3 1874.8873 0 0 27.97 0.006 K FGVEQDVDMVFASFIR - Oxidation (M) 0.0000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9296.9296.3.dta 17 IPI00788663.1 26 kDa protein 114 26594 4 4 3 3 237 1762 1 0 1 359.2113 716.4081 2 716.4069 0.0012 0 36.72 0.0078 K VVEVGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1826.1826.2.dta 17 IPI00788663.1 26 kDa protein 114 26594 4 4 3 3 1763 2180 1 0 1 559.8056 1117.5967 2 1117.5979 -0.0012 1 47.02 0.00014 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2278.2278.2.dta 17 IPI00788663.1 26 kDa protein 114 26594 4 4 3 3 1764 2177 1 0 1 373.5406 1117.5998 3 1117.5979 0.002 1 29.76 0.015 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2275.2275.3.dta 17 IPI00788663.1 26 kDa protein 114 26594 4 4 3 3 3272 6231 1 0 1 731.9114 1461.8082 2 1461.8079 0.0003 0 67.75 4.40E-07 K IYVDDGLISLQVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6937.6937.2.dta 17 IPI00604528.2 PKM2 protein 56 40882 3 3 2 2 4814 8545 1 0 1 620.6379 1858.892 3 1858.8924 -0.0004 0 42.63 0.00027 K FGVEQDVDMVFASFIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9768.9768.3.dta 17 IPI00604528.2 PKM2 protein 56 40882 3 3 2 2 4898 8156 1 0 1 625.9697 1874.8874 3 1874.8873 0 0 27.97 0.006 K FGVEQDVDMVFASFIR K Oxidation (M) 0.0000000010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9296.9296.3.dta 17 IPI00604528.2 PKM2 protein 56 40882 3 3 2 2 5175 7840 1 0 1 663.3364 1986.9874 3 1986.9874 0.0001 1 19.86 0.014 K FGVEQDVDMVFASFIRK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8922.8922.3.dta 17 IPI00792817.1 24 kDa protein 54 24489 2 2 1 1 1763 2180 1 0 1 559.8056 1117.5967 2 1117.5979 -0.0012 1 47.02 0.00014 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2278.2278.2.dta 17 IPI00792817.1 24 kDa protein 54 24489 2 2 1 1 1764 2177 1 0 1 373.5406 1117.5998 3 1117.5979 0.002 1 29.76 0.015 K GSGTAEVELKK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2275.2275.3.dta 18 1 IPI00465439.5 Fructose-bisphosphate aldolase A 148 39851 6 6 6 6 61 2817 2 1 1 315.2033 628.3921 2 628.3908 0.0013 0 16.66 0.045 K GGVVGIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2971.2971.2.dta 18 1 IPI00465439.5 Fructose-bisphosphate aldolase A 148 39851 6 6 6 6 473 2907 1 1 1 401.2452 800.4759 2 800.4756 0.0003 0 57.38 4.10E-05 R ALQASALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3069.3069.2.dta 18 1 IPI00465439.5 Fructose-bisphosphate aldolase A 148 39851 6 6 6 6 1025 2593 1 1 1 470.7453 939.476 2 939.4774 -0.0013 0 35.84 0.0019 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2718.2718.2.dta 18 1 IPI00465439.5 Fructose-bisphosphate aldolase A 148 39851 6 6 6 6 1689 1713 1 1 1 547.2864 1092.5582 2 1092.5563 0.0019 1 43.88 0.00095 K AAQEEYVKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1771.1771.2.dta 18 1 IPI00465439.5 Fructose-bisphosphate aldolase A 148 39851 6 6 6 6 2698 4113 1 1 1 666.8532 1331.6919 2 1331.6932 -0.0014 0 34.2 0.0009 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4441.4441.2.dta 18 1 IPI00465439.5 Fructose-bisphosphate aldolase A 148 39851 6 6 6 6 5431 6244 1 1 1 703.037 2106.0893 3 2106.0891 0.0002 0 61.17 1.80E-06 K IGEHTPSALAIMENANVLAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6950.6950.3.dta 18 IPI00789118.1 Protein 117 23121 3 3 3 3 473 2907 1 0 1 401.2452 800.4759 2 800.4756 0.0003 0 57.38 4.10E-05 R ALQASALK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3069.3069.2.dta 18 IPI00789118.1 Protein 117 23121 3 3 3 3 1689 1713 1 0 1 547.2864 1092.5582 2 1092.5563 0.0019 1 43.88 0.00095 K AAQEEYVKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1771.1771.2.dta 18 IPI00789118.1 Protein 117 23121 3 3 3 3 5431 6244 1 0 1 703.037 2106.0893 3 2106.0891 0.0002 0 61.17 1.80E-06 K IGEHTPSALAIMENANVLAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6950.6950.3.dta 18 IPI00791070.1 23 kDa protein 96 23062 4 4 4 4 61 2817 2 0 1 315.2033 628.3921 2 628.3908 0.0013 0 16.66 0.045 K GGVVGIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2971.2971.2.dta 18 IPI00791070.1 23 kDa protein 96 23062 4 4 4 4 1025 2593 1 0 1 470.7453 939.476 2 939.4774 -0.0013 0 35.84 0.0019 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2718.2718.2.dta 18 IPI00791070.1 23 kDa protein 96 23062 4 4 4 4 2698 4113 1 0 1 666.8532 1331.6919 2 1331.6932 -0.0014 0 34.2 0.0009 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4441.4441.2.dta 18 IPI00791070.1 23 kDa protein 96 23062 4 4 4 4 5431 6244 1 0 1 703.037 2106.0893 3 2106.0891 0.0002 0 61.17 1.80E-06 K IGEHTPSALAIMENANVLAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6950.6950.3.dta 18 IPI00797597.1 18 kDa protein 78 17953 3 3 3 3 61 2817 2 0 1 315.2033 628.3921 2 628.3908 0.0013 0 16.66 0.045 K GGVVGIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2971.2971.2.dta 18 IPI00797597.1 18 kDa protein 78 17953 3 3 3 3 1025 2593 1 0 1 470.7453 939.476 2 939.4774 -0.0013 0 35.84 0.0019 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2718.2718.2.dta 18 IPI00797597.1 18 kDa protein 78 17953 3 3 3 3 5431 6244 1 0 1 703.037 2106.0893 3 2106.0891 0.0002 0 61.17 1.80E-06 K IGEHTPSALAIMENANVLAR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6950.6950.3.dta 18 IPI00791830.1 20 kDa protein 51 19592 3 3 3 3 61 2817 2 0 1 315.2033 628.3921 2 628.3908 0.0013 0 16.66 0.045 K GGVVGIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2971.2971.2.dta 18 IPI00791830.1 20 kDa protein 51 19592 3 3 3 3 1025 2593 1 0 1 470.7453 939.476 2 939.4774 -0.0013 0 35.84 0.0019 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2718.2718.2.dta 18 IPI00791830.1 20 kDa protein 51 19592 3 3 3 3 2698 4113 1 0 1 666.8532 1331.6919 2 1331.6932 -0.0014 0 34.2 0.0009 K GILAADESTGSIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4441.4441.2.dta 18 IPI00798237.1 15 kDa protein 34 15624 2 2 2 2 61 2817 2 0 1 315.2033 628.3921 2 628.3908 0.0013 0 16.66 0.045 K GGVVGIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2971.2971.2.dta 18 IPI00798237.1 15 kDa protein 34 15624 2 2 2 2 1025 2593 1 0 1 470.7453 939.476 2 939.4774 -0.0013 0 35.84 0.0019 K ELSDIAHR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2718.2718.2.dta 19 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 113 57356 2 2 2 2 1183 7586 1 1 1 493.8053 985.596 2 985.596 0 0 36.62 0.00086 R DLPLLLFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8623.8623.2.dta 19 1 IPI00011200.5 D-3-phosphoglycerate dehydrogenase 113 57356 2 2 2 2 3372 4170 1 1 1 744.8666 1487.7186 2 1487.7216 -0.003 0 97.07 2.80E-09 R AGTGVDNVDLEAATR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4503.4503.2.dta 20 1 IPI00021405.3 Isoform A of Lamin-A/C 111 74380 4 4 4 4 1409 4946 1 1 1 514.7902 1027.5659 2 1027.5662 -0.0003 0 62.9 8.60E-06 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5367.5367.2.dta 20 1 IPI00021405.3 Isoform A of Lamin-A/C 111 74380 4 4 4 4 3416 1523 1 1 1 501.579 1501.7153 3 1501.7161 -0.0008 1 61.28 1.00E-05 R AQHEDQVEQYKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1560.1560.3.dta 20 1 IPI00021405.3 Isoform A of Lamin-A/C 111 74380 4 4 4 4 3467 8470 1 1 1 506.9092 1517.7059 3 1517.707 -0.0011 0 29.99 0.013 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.968.968.3.dta 20 1 IPI00021405.3 Isoform A of Lamin-A/C 111 74380 4 4 4 4 4517 3901 1 1 1 584.9587 1751.8544 3 1751.855 -0.0006 0 23.65 0.0088 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4215.4215.3.dta 21 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 110 38581 6 6 6 6 911 6988 1 1 1 457.7605 913.5065 2 913.5062 0.0003 0 32.18 0.0038 R GFGFVLFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7899.7899.2.dta 21 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 110 38581 6 6 6 6 923 2093 1 1 1 306.5001 916.4784 3 916.4767 0.0017 0 28.23 0.015 K YHNVGLSK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2183.2183.3.dta 21 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 110 38581 6 6 6 6 3373 4943 1 1 1 744.8811 1487.7477 2 1487.7508 -0.0031 0 70.3 1.80E-06 K IFVGGLSPDTPEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5364.5364.2.dta 21 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 110 38581 6 6 6 6 3560 2027 1 1 1 514.9145 1541.7216 3 1541.7222 -0.0006 1 20.5 0.012 R HSEAATAQREEWK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2106.2106.3.dta 21 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 110 38581 6 6 6 6 4532 4857 1 1 1 586.6535 1756.9387 3 1756.9359 0.0027 1 33.98 0.00095 K IFVGGLSPDTPEEKIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5267.5267.3.dta 21 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 110 38581 6 6 6 6 5046 5799 1 1 1 640.6688 1918.9846 3 1918.9823 0.0024 1 24.2 0.023 K FGEVVDCTLKLDPITGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6409.6409.3.dta 21 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 105 36420 5 5 5 5 911 6988 1 0 1 457.7605 913.5065 2 913.5062 0.0003 0 32.18 0.0038 R GFGFVLFK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7899.7899.2.dta 21 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 105 36420 5 5 5 5 923 2093 1 0 1 306.5001 916.4784 3 916.4767 0.0017 0 28.23 0.015 K YHNVGLSK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2183.2183.3.dta 21 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 105 36420 5 5 5 5 3373 4943 1 0 1 744.8811 1487.7477 2 1487.7508 -0.0031 0 70.3 1.80E-06 K IFVGGLSPDTPEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5364.5364.2.dta 21 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 105 36420 5 5 5 5 4532 4857 1 0 1 586.6535 1756.9387 3 1756.9359 0.0027 1 33.98 0.00095 K IFVGGLSPDTPEEKIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5267.5267.3.dta 21 IPI00220683.1 Isoform 2 of Heterogeneous nuclear ribonucleoprotein D0 105 36420 5 5 5 5 5046 5799 1 0 1 640.6688 1918.9846 3 1918.9823 0.0024 1 24.2 0.023 K FGEVVDCTLKLDPITGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6409.6409.3.dta 21 IPI00011274.2 heterogeneous nuclear ribonucleoprotein D-like 32 46580 1 1 1 1 911 6988 1 0 1 457.7605 913.5065 2 913.5062 0.0003 0 32.18 0.0038 R GFGFVLFK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7899.7899.2.dta 22 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 109 34833 4 4 4 4 974 4432 1 1 1 465.7614 929.5083 2 929.5083 0 0 54.41 6.00E-05 K LATVNWAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4789.4789.2.dta 22 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 109 34833 4 4 4 4 1462 4121 1 1 1 522.2864 1042.5583 2 1042.5593 -0.001 0 50.53 0.00019 R LCNIPLASR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4450.4450.2.dta 22 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 109 34833 4 4 4 4 2091 4264 1 1 1 399.2438 1194.7096 3 1194.7098 -0.0002 1 45.31 0.00012 R RRPALGWLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4603.4603.3.dta 22 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 109 34833 4 4 4 4 5186 6795 1 1 1 665.9793 1994.9161 3 1994.9131 0.003 0 21.77 0.0091 R LVCYDLFHWACLNER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7656.7656.3.dta 22 IPI00384589.1 Isoform 2 of Zinc finger protein-like 1 52 14135 2 2 2 2 1462 4121 1 0 1 522.2864 1042.5583 2 1042.5593 -0.001 0 50.53 0.00019 R LCNIPLASR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4450.4450.2.dta 22 IPI00384589.1 Isoform 2 of Zinc finger protein-like 1 52 14135 2 2 2 2 5186 6795 1 0 1 665.9793 1994.9161 3 1994.9131 0.003 0 21.77 0.0091 R LVCYDLFHWACLNER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7656.7656.3.dta 23 1 IPI00004968.1 Pre-mRNA-processing factor 19 106 55603 3 3 3 3 817 2710 1 1 1 445.7502 889.4859 2 889.4869 -0.001 0 38.38 0.0027 K ATVLTTER K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2849.2849.2.dta 23 1 IPI00004968.1 Pre-mRNA-processing factor 19 106 55603 3 3 3 3 1188 1613 1 1 1 494.7924 987.5702 2 987.5713 -0.001 1 51.71 1.40E-05 R LTKEVTAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1655.1655.2.dta 23 1 IPI00004968.1 Pre-mRNA-processing factor 19 106 55603 3 3 3 3 2652 5103 1 1 1 660.8433 1319.6721 2 1319.6721 0 0 56.89 1.40E-05 K TLQLDNNFEVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5545.5545.2.dta 24 1 IPI00163187.10 Fascin 102 55123 6 6 6 6 1045 2151 1 1 1 473.7503 945.4861 2 945.488 -0.0019 0 55.84 8.60E-05 K VTGTLDANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2247.2247.2.dta 24 1 IPI00163187.10 Fascin 102 55123 6 6 6 6 1418 2759 1 1 1 344.8276 1031.461 3 1031.4607 0.0003 0 20.43 0.024 R GEHGFIGCR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2908.2908.3.dta 24 1 IPI00163187.10 Fascin 102 55123 6 6 6 6 1589 1868 1 1 1 537.798 1073.5814 2 1073.5829 -0.0015 1 24.87 0.014 R KVTGTLDANR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1938.1938.2.dta 24 1 IPI00163187.10 Fascin 102 55123 6 6 6 6 2064 3635 1 1 1 595.8242 1189.6338 2 1189.6343 -0.0005 0 30.25 0.021 R YLAPSGPSGTLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3927.3927.2.dta 24 1 IPI00163187.10 Fascin 102 55123 6 6 6 6 3806 2523 1 1 1 537.919 1610.7352 3 1610.7359 -0.0007 1 21.27 0.015 R YLAADKDGNVTCER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2642.2642.3.dta 24 1 IPI00163187.10 Fascin 102 55123 6 6 6 6 4684 4981 1 1 1 607.3279 1818.962 3 1818.9628 -0.0008 0 55.2 2.90E-05 R LVARPEPATGYTLEFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5406.5406.3.dta 25 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 100 32375 4 4 4 4 326 1317 1 1 1 378.7403 755.466 2 755.4654 0.0006 1 33.37 0.0038 R AVVPSKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1339.1339.2.dta 25 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 100 32375 4 4 4 4 847 1551 1 1 1 300.4975 898.4707 3 898.4695 0.0012 0 26.71 0.017 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1590.1590.3.dta 25 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 100 32375 4 4 4 4 1030 3201 1 1 1 472.29 942.5655 2 942.5651 0.0004 0 35.27 0.0008 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3418.3418.2.dta 25 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 100 32375 4 4 4 4 2688 5867 1 1 1 665.3332 1328.6518 2 1328.6513 0.0005 0 64.17 1.60E-06 K GFAFVQYVNER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6491.6491.2.dta 25 IPI00759596.1 Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 87 27861 3 3 3 3 847 1551 1 0 1 300.4975 898.4707 3 898.4695 0.0012 0 26.71 0.017 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1590.1590.3.dta 25 IPI00759596.1 Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 87 27861 3 3 3 3 1030 3201 1 0 1 472.29 942.5655 2 942.5651 0.0004 0 35.27 0.0008 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3418.3418.2.dta 25 IPI00759596.1 Isoform 4 of Heterogeneous nuclear ribonucleoproteins C1/C2 87 27861 3 3 3 3 2688 5867 1 0 1 665.3332 1328.6518 2 1328.6513 0.0005 0 64.17 1.60E-06 K GFAFVQYVNER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6491.6491.2.dta 25 IPI00736458.1 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 2 55 26507 3 3 3 3 326 1317 1 0 1 378.7403 755.466 2 755.4654 0.0006 1 33.37 0.0038 R AVVPSKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1339.1339.2.dta 25 IPI00736458.1 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 2 55 26507 3 3 3 3 847 1551 1 0 1 300.4975 898.4707 3 898.4695 0.0012 0 26.71 0.017 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1590.1590.3.dta 25 IPI00736458.1 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 2 55 26507 3 3 3 3 1030 3201 1 0 1 472.29 942.5655 2 942.5651 0.0004 0 35.27 0.0008 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3418.3418.2.dta 25 IPI00759822.1 Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 49 25215 2 2 2 2 326 1317 1 0 1 378.7403 755.466 2 755.4654 0.0006 1 33.37 0.0038 R AVVPSKR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1339.1339.2.dta 25 IPI00759822.1 Isoform 3 of Heterogeneous nuclear ribonucleoproteins C1/C2 49 25215 2 2 2 2 1030 3201 1 0 1 472.29 942.5655 2 942.5651 0.0004 0 35.27 0.0008 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3418.3418.2.dta 25 IPI00740914.2 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 1 42 27938 2 2 2 2 847 1551 1 0 1 300.4975 898.4707 3 898.4695 0.0012 0 26.71 0.017 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1590.1590.3.dta 25 IPI00740914.2 similar to heterogeneous nuclear ribonucleoprotein C isoform b isoform 1 42 27938 2 2 2 2 1030 3201 1 0 1 472.29 942.5655 2 942.5651 0.0004 0 35.27 0.0008 R VPPPPPIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3418.3418.2.dta 25 IPI00166137.5 RALY-like protein isoform 1 27 32425 1 1 1 1 847 1551 1 0 1 300.4975 898.4707 3 898.4695 0.0012 0 26.71 0.017 K IVGCSVHK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1590.1590.3.dta 26 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 98 60311 2 2 2 2 2880 3699 1 1 1 686.8737 1371.7329 2 1371.7358 -0.0029 0 97.12 3.70E-09 K AIADTGANVVVTGGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3996.3996.2.dta 26 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 98 60311 2 2 2 2 6349 8122 1 1 1 804.7038 2411.0896 3 2411.0911 -0.0015 1 22.38 0.024 R GSTDNLMDDIERAVDDGVNTFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9259.9259.3.dta 26 IPI00797206.1 Protein 97 35913 1 1 1 1 2880 3699 1 0 1 686.8737 1371.7329 2 1371.7358 -0.0029 0 97.12 3.70E-09 K AIADTGANVVVTGGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3996.3996.2.dta 27 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 97 51230 3 3 3 3 198 3202 3 1 1 351.2314 700.4482 2 700.4483 -0.0001 0 31.73 0.013 R ILLQSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3419.3419.2.dta 27 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 97 51230 3 3 3 3 268 2123 1 1 1 365.2177 728.4208 2 728.4181 0.0027 0 44.54 0.001 K NAGAVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2217.2217.2.dta 27 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 97 51230 3 3 3 3 4602 3616 1 1 1 890.9023 1779.79 2 1779.7911 -0.0011 0 67.85 4.30E-07 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3906.3906.2.dta 27 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 78 47756 2 2 2 2 198 3202 3 0 1 351.2314 700.4482 2 700.4483 -0.0001 0 31.73 0.013 R ILLQSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3419.3419.2.dta 27 IPI00514561.1 Heterogeneous nuclear ribonucleoprotein K 78 47756 2 2 2 2 4602 3616 1 0 1 890.9023 1779.79 2 1779.7911 -0.0011 0 67.85 4.30E-07 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3906.3906.2.dta 27 IPI00796697.1 42 kDa protein 45 42582 1 1 1 1 268 2123 1 0 1 365.2177 728.4208 2 728.4181 0.0027 0 44.54 0.001 K NAGAVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2217.2217.2.dta 28 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 97 67889 4 4 3 3 1268 2638 1 1 1 500.7666 999.5187 2 999.5172 0.0015 0 43.33 0.00025 R VCTISPAPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2766.2766.2.dta 28 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 97 67889 4 4 3 3 1429 4509 1 1 1 518.2776 1034.5406 2 1034.5396 0.001 0 64.61 5.00E-06 K AFEVIATER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4875.4875.2.dta 28 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 97 67889 4 4 3 3 1975 1901 1 1 1 583.7925 1165.5705 2 1165.5727 -0.0022 1 22.14 0.022 R YNENTELRK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1973.1973.2.dta 28 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 97 67889 4 4 3 3 1976 1888 1 1 1 389.5314 1165.5725 3 1165.5727 -0.0002 1 28.83 0.0096 R YNENTELRK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1959.1959.3.dta 29 1 IPI00025815.1 TAR DNA-binding protein 43 94 45053 2 2 2 2 1905 3211 1 1 1 572.7793 1143.544 2 1143.5448 -0.0008 0 48.42 6.70E-05 R FTEYETQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3430.3430.2.dta 29 1 IPI00025815.1 TAR DNA-binding protein 43 94 45053 2 2 2 2 4455 4464 1 1 1 863.8871 1725.7596 2 1725.7608 -0.0012 0 64.01 1.00E-06 R FGGNPGGFGNQGGFGNSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4826.4826.2.dta 29 IPI00639819.1 TAR DNA binding protein 48 33783 1 1 1 1 1905 3211 1 0 1 572.7793 1143.544 2 1143.5448 -0.0008 0 48.42 6.70E-05 R FTEYETQVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3430.3430.2.dta 30 1 IPI00328550.3 Thrombospondin-4 precursor 94 108482 3 3 3 3 1393 4022 1 1 1 513.3033 1024.592 2 1024.5917 0.0003 0 40.5 0.0006 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4344.4344.2.dta 30 1 IPI00328550.3 Thrombospondin-4 precursor 94 108482 3 3 3 3 1505 2515 1 1 1 528.2048 1054.3951 2 1054.3961 -0.0009 0 48.88 1.30E-05 R CDSNPCFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2633.2633.2.dta 30 1 IPI00328550.3 Thrombospondin-4 precursor 94 108482 3 3 3 3 5332 7517 1 1 1 1028.0205 2054.0265 2 2054.0295 -0.0031 0 42.47 0.00064 R LGVFCFSQENIIWSNLK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8541.8541.2.dta 30 IPI00028030.3 Cartilage oligomeric matrix protein precursor 40 85402 1 1 1 1 1393 4022 1 0 1 513.3033 1024.592 2 1024.5917 0.0003 0 40.5 0.0006 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4344.4344.2.dta 31 1 IPI00010720.1 T-complex protein 1 subunit epsilon 85 60089 2 2 2 2 1686 2512 2 0 1 547.2673 1092.5201 2 1092.52 0.0002 0 28.44 0.029 R IADGYEQAAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2630.2630.2.dta 31 1 IPI00010720.1 T-complex protein 1 subunit epsilon 85 60089 2 2 2 2 4483 7825 1 1 1 869.9787 1737.9428 2 1737.9414 0.0015 0 79.39 6.50E-08 R WVGGPEIELIAIATGGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8906.8906.2.dta 32 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 76 55674 2 2 2 2 1590 4829 1 1 1 537.8068 1073.599 2 1073.5981 0.0008 0 71.04 1.80E-06 K LAANAFLAQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5234.5234.2.dta 32 1 IPI00031420.3 UDP-glucose 6-dehydrogenase 76 55674 2 2 2 2 8198 8149 1 1 1 1036.8302 3107.4688 3 3107.4751 -0.0063 0 25.18 0.0043 R ISSINSISALCEATGADVEEVATAIGMDQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9289.9289.3.dta 33 1 IPI00304692.1 Heterogeneous nuclear ribonucleoprotein G 76 42306 3 3 3 3 767 1397 1 1 1 437.2565 872.4985 2 872.4981 0.0004 1 40.5 0.0016 R RGPPPPPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1425.1425.2.dta 33 1 IPI00304692.1 Heterogeneous nuclear ribonucleoprotein G 76 42306 3 3 3 3 1535 1788 1 1 1 531.2536 1060.4927 2 1060.4938 -0.0011 0 40.68 0.00066 R GPPPSYGGSSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1853.1853.2.dta 33 1 IPI00304692.1 Heterogeneous nuclear ribonucleoprotein G 76 42306 3 3 3 3 4962 5869 1 1 1 633.9795 1898.9166 3 1898.9163 0.0004 1 38.92 0.00076 R GFAFVTFESPADAKDAAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6493.6493.3.dta 33 IPI00061178.1 "RNA binding motif protein, X-linked-like 1" 59 42173 2 2 2 2 1535 1788 1 0 1 531.2536 1060.4927 2 1060.4938 -0.0011 0 40.68 0.00066 R GPPPSYGGSSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1853.1853.2.dta 33 IPI00061178.1 "RNA binding motif protein, X-linked-like 1" 59 42173 2 2 2 2 4962 5869 1 0 1 633.9795 1898.9166 3 1898.9163 0.0004 1 38.92 0.00076 R GFAFVTFESPADAKDAAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6493.6493.3.dta 33 IPI00816796.1 "CDNA FLJ38696 fis, clone KIDNE2001931, highly similar to HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN G" 58 40822 2 2 2 2 767 1397 1 0 1 437.2565 872.4985 2 872.4981 0.0004 1 40.5 0.0016 R RGPPPPPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1425.1425.2.dta 33 IPI00816796.1 "CDNA FLJ38696 fis, clone KIDNE2001931, highly similar to HETEROGENEOUS NUCLEAR RIBONUCLEOPROTEIN G" 58 40822 2 2 2 2 1535 1788 1 0 1 531.2536 1060.4927 2 1060.4938 -0.0011 0 40.68 0.00066 R GPPPSYGGSSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1853.1853.2.dta 33 IPI00737790.1 "similar to RNA binding motif protein, X-linked" 40 15207 1 1 1 1 767 1397 1 0 1 437.2565 872.4985 2 872.4981 0.0004 1 40.5 0.0016 R RGPPPPPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1425.1425.2.dta 33 IPI00643486.1 "RNA binding motif protein, X-linked-like 1" 39 16840 1 1 1 1 4962 5869 1 0 1 633.9795 1898.9166 3 1898.9163 0.0004 1 38.92 0.00076 R GFAFVTFESPADAKDAAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6493.6493.3.dta 34 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 74 56784 4 4 4 4 869 1676 1 1 1 453.2168 904.419 2 904.4185 0.0005 0 33.54 0.00072 K GAQGISCGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1721.1721.2.dta 34 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 74 56784 4 4 4 4 1593 2150 1 1 1 538.29 1074.5655 2 1074.5669 -0.0014 0 23.36 0.0064 K TQGQQVSSLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2246.2246.2.dta 34 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 74 56784 4 4 4 4 1710 3325 1 1 1 550.7828 1099.551 2 1099.5523 -0.0013 0 42.76 0.00021 K AAVAWANQNR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3570.3570.2.dta 34 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 74 56784 4 4 4 4 3065 1947 1 1 1 471.2562 1410.7467 3 1410.7467 0 0 28.56 0.022 K KPASSSSAPQNIPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2021.2021.3.dta 35 1 IPI00032406.1 DnaJ homolog subfamily A member 2 73 46344 1 1 1 1 2711 2594 1 1 1 669.3007 1336.5869 2 1336.5864 0.0005 0 73.49 1.30E-07 K NVLCSACSGQGGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2719.2719.2.dta 36 1 IPI00302927.6 T-complex protein 1 subunit delta 71 58401 2 2 2 2 2568 4247 1 1 1 651.7938 1301.5731 2 1301.5744 -0.0013 0 44.83 6.30E-05 R TLSGMESYCVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4585.4585.2.dta 36 1 IPI00302927.6 T-complex protein 1 subunit delta 71 58401 2 2 2 2 3255 7356 1 1 1 728.8934 1455.7722 2 1455.7722 0 0 43.79 0.00021 R DALSDLALHFLNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8353.8353.2.dta 36 IPI00794046.1 20 kDa protein 45 19834 1 1 1 1 2568 4247 1 0 1 651.7938 1301.5731 2 1301.5744 -0.0013 0 44.83 6.30E-05 R TLSGMESYCVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4585.4585.2.dta 37 1 IPI00183526.5 NCL protein 69 51667 2 2 2 2 2072 1338 1 1 1 596.8117 1191.6089 2 1191.6095 -0.0007 1 41.86 0.00037 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1361.1361.2.dta 37 1 IPI00183526.5 NCL protein 69 51667 2 2 2 2 6610 7690 1 1 1 834.4279 2500.2619 3 2500.2584 0.0035 0 44.68 6.50E-05 K TLVLSNLSYSATEETLQEVFEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8746.8746.3.dta 38 1 IPI00027107.5 "Tu translation elongation factor, mitochondrial" 58 50185 1 1 1 1 1419 3336 1 1 1 516.7875 1031.5605 2 1031.5611 -0.0006 0 58.37 4.10E-05 R GTVVTGTLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3583.3583.2.dta 39 1 IPI00030320.4 Probable ATP-dependent RNA helicase DDX6 58 54781 3 3 3 3 2273 6736 1 1 1 616.3564 1230.6982 2 1230.6972 0.001 0 39.51 0.00081 K SGAYLIPLLER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7583.7583.2.dta 39 1 IPI00030320.4 Probable ATP-dependent RNA helicase DDX6 58 54781 3 3 3 3 2306 5701 1 1 1 619.813 1237.6114 2 1237.6125 -0.0011 0 34.69 0.00056 R NLVCTDLFTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6287.6287.2.dta 39 1 IPI00030320.4 Probable ATP-dependent RNA helicase DDX6 58 54781 3 3 3 3 5180 4141 1 1 1 664.6468 1990.9185 3 1990.916 0.0026 0 17.38 0.023 K SLYVAEYHSEPVEDEKP - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4471.4471.3.dta 40 1 IPI00022434.2 ALB protein 58 73881 1 1 1 1 3298 5504 1 1 1 489.9528 1466.8366 3 1466.8358 0.0009 1 57.65 1.20E-05 R RHPDYSVVLLLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6023.6023.3.dta 41 1 IPI00398958.3 similar to 40S ribosomal protein SA 56 32951 1 1 1 1 909 4237 1 1 1 456.7792 911.5438 2 911.544 -0.0002 0 56.06 1.20E-05 R LLVVTDPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4575.4575.2.dta 42 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 54 38936 1 1 1 1 4323 2012 1 1 1 847.8536 1693.6927 2 1693.6928 -0.0001 0 54.01 7.70E-06 R NQGGYGGSSSSSSYGSGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2090.2090.2.dta 43 1 IPI00334775.6 85 kDa protein 54 85104 3 3 3 3 271 4092 1 1 0 365.7268 729.4391 2 729.4385 0.0007 0 36.79 0.0054 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4419.4419.2.dta 43 1 IPI00334775.6 85 kDa protein 54 85104 3 3 3 3 1883 2170 1 1 1 381.1918 1140.5536 3 1140.5523 0.0012 0 24.36 0.043 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2267.2267.3.dta 43 1 IPI00334775.6 85 kDa protein 54 85104 3 3 3 3 4767 5092 1 1 1 924.4025 1846.7904 2 1846.7897 0.0007 0 38.76 0.00063 R NPDDITQEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5528.5528.2.dta 43 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 36 20112 2 2 2 2 271 4092 1 0 0 365.7268 729.4391 2 729.4385 0.0007 0 36.79 0.0054 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4419.4419.2.dta 43 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 36 20112 2 2 2 2 1883 2170 1 0 1 381.1918 1140.5536 3 1140.5523 0.0012 0 24.36 0.043 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2267.2267.3.dta 44 1 IPI00012007.6 Adenosylhomocysteinase 50 48255 2 2 2 2 877 3204 1 1 1 453.242 904.4694 2 904.4688 0.0006 0 53.49 9.90E-05 R ATDVMIAGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3421.3421.2.dta 44 1 IPI00012007.6 Adenosylhomocysteinase 50 48255 2 2 2 2 4938 4076 1 1 1 630.9995 1889.9765 3 1889.9782 -0.0017 1 18.97 0.044 K VAVVAGYGDVGKGCAQALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4402.4402.3.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 50 57357 5 5 5 5 73 2269 1 1 1 319.2119 636.4093 2 636.4071 0.0022 0 23.92 0.016 R VIHIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2371.2371.2.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 50 57357 5 5 5 5 5299 8170 1 1 1 680.3705 2038.0898 3 2038.0888 0.001 0 17.42 0.023 R VTPQSLFILFGVYGDVQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9310.9310.3.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 50 57357 5 5 5 5 5438 7093 1 1 1 704.7372 2111.1899 3 2111.1878 0.0021 1 37.92 0.00031 R KLPIDVTEGEVISLGLPFGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8022.8022.3.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 50 57357 5 5 5 5 5470 3368 1 1 1 715.337 2142.9891 3 2142.993 -0.0039 1 15.02 0.039 R EGQEDQGLTKDYGNSPLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3618.3618.3.dta 45 1 IPI00179964.5 Isoform 1 of Polypyrimidine tract-binding protein 1 50 57357 5 5 5 5 5770 7072 1 1 1 759.0977 2274.2713 3 2274.2695 0.0018 0 18.74 0.044 R IAIPGLAGAGNSVLLVSNLNPER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7998.7998.3.dta 45 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 45 35812 2 2 2 2 73 2269 1 0 1 319.2119 636.4093 2 636.4071 0.0022 0 23.92 0.016 R VIHIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2371.2371.2.dta 45 IPI00556157.1 Polypyrimidine tract-binding protein 1 isoform c variant (Fragment) 45 35812 2 2 2 2 5438 7093 1 0 1 704.7372 2111.1899 3 2111.1878 0.0021 1 37.92 0.00031 R KLPIDVTEGEVISLGLPFGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8022.8022.3.dta 45 IPI00413691.2 polypyrimidine tract-binding protein 1 isoform d 19 21899 2 2 2 2 5299 8170 1 0 1 680.3705 2038.0898 3 2038.0888 0.001 0 17.42 0.023 R VTPQSLFILFGVYGDVQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9310.9310.3.dta 45 IPI00413691.2 polypyrimidine tract-binding protein 1 isoform d 19 21899 2 2 2 2 5470 3368 1 0 1 715.337 2142.9891 3 2142.993 -0.0039 1 15.02 0.039 R EGQEDQGLTKDYGNSPLHR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3618.3618.3.dta 46 1 IPI00186290.6 Elongation factor 2 49 96246 3 3 3 3 316 2443 1 1 1 377.7084 753.4023 2 753.4021 0.0002 0 23.91 0.0057 K NPADLPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2556.2556.2.dta 46 1 IPI00186290.6 Elongation factor 2 49 96246 3 3 3 3 3209 8040 1 1 1 722.8871 1443.7596 2 1443.7609 -0.0013 1 29.37 0.021 K EGIPALDNFLDKL - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9165.9165.2.dta 46 1 IPI00186290.6 Elongation factor 2 49 96246 3 3 3 3 7998 8344 1 1 1 997.1893 2988.5462 3 2988.5453 0.0009 0 31.38 0.0011 R LMEPIYLVEIQCPEQVVGGIYGVLNR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9515.9515.3.dta 47 1 IPI00550069.3 Ribonuclease inhibitor 48 51766 1 1 1 1 2182 5466 1 1 1 605.351 1208.6875 2 1208.6877 -0.0002 0 48.13 0.00013 R VNPALAELNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5972.5972.2.dta 48 1 IPI00027497.5 Glucose-6-phosphate isomerase 47 63335 1 1 1 1 4374 8429 1 1 1 852.4808 1702.947 2 1702.944 0.003 0 47.42 3.60E-05 K ILLANFLAQTEALMR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9626.9626.2.dta 49 1 IPI00021187.4 Isoform 1 of RuvB-like 1 47 50538 1 1 1 1 2561 2683 1 1 1 650.8359 1299.6572 2 1299.6531 0.0041 0 47.29 3.70E-05 K QAASGLVGQENAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2818.2818.2.dta 50 1 IPI00376383.2 Centrosomal protein 110kDa 47 205901 1 1 1 1 1147 2296 1 0 1 488.2636 974.5127 2 974.5032 0.0095 1 47.15 0.00073 K SEVKDEIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2400.2400.2.dta 51 1 IPI00217223.1 Multifunctional protein ADE2 47 50389 3 3 3 3 125 7452 1 1 1 335.7034 669.3922 2 669.3922 0 1 22.04 0.021 K RNPGVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.847.847.2.dta 51 1 IPI00217223.1 Multifunctional protein ADE2 47 50389 3 3 3 3 1356 2010 1 1 1 508.759 1015.5035 2 1015.5047 -0.0012 0 40.38 0.0025 K DQITAGNAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2088.2088.2.dta 51 1 IPI00217223.1 Multifunctional protein ADE2 47 50389 3 3 3 3 4274 3352 1 1 1 562.3151 1683.9235 3 1683.9268 -0.0032 1 23.98 0.0056 K VLLQSKDQITAGNAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3600.3600.3.dta 52 1 IPI00297779.7 T-complex protein 1 subunit beta 47 57794 2 2 2 2 5306 6335 1 1 1 681.021 2040.0412 3 2040.0415 -0.0004 1 41.63 0.00012 K LGGSLADSYLDEGFLLDKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7066.7066.3.dta 52 1 IPI00297779.7 T-complex protein 1 subunit beta 47 57794 2 2 2 2 5411 6216 1 1 1 699.7123 2096.1152 3 2096.1154 -0.0002 0 19.65 0.014 R LALVTGGEIASTFDHPELVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6919.6919.3.dta 52 IPI00791487.1 14 kDa protein 42 14453 1 1 1 1 5306 6335 1 0 1 681.021 2040.0412 3 2040.0415 -0.0004 1 41.63 0.00012 K LGGSLADSYLDEGFLLDKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.7066.7066.3.dta 53 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 46 71082 2 2 2 2 875 1188 1 1 1 453.2343 904.4541 2 904.4549 -0.0007 1 22.82 0.048 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1202.1202.2.dta 53 1 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 46 71082 2 2 2 2 3365 4752 1 1 1 744.3561 1486.6976 2 1486.694 0.0036 0 41.94 0.00012 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5145.5145.2.dta 53 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 42 27004 1 1 1 1 3365 4752 1 0 1 744.3561 1486.6976 2 1486.694 0.0036 0 41.94 0.00012 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5145.5145.2.dta 53 IPI00647012.1 Heat shock 70kDa protein 1A 23 52200 1 1 1 1 875 1188 1 0 1 453.2343 904.4541 2 904.4549 -0.0007 1 22.82 0.048 R LRTACER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1202.1202.2.dta 54 1 IPI00029764.1 Splicing factor 3A subunit 3 45 59154 2 2 2 2 1843 1182 1 1 1 378.5317 1132.5733 3 1132.5737 -0.0005 0 41.87 0.0012 R HLTHENVQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1195.1195.3.dta 54 1 IPI00029764.1 Splicing factor 3A subunit 3 45 59154 2 2 2 2 7078 8285 1 1 1 881.1216 2640.3429 3 2640.3435 -0.0006 1 23.75 0.0097 R NKDIAFLEAQIYEYVEILGEQR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9446.9446.3.dta 55 1 IPI00440493.2 "ATP synthase subunit alpha, mitochondrial precursor" 45 59828 1 1 1 1 6020 8066 1 1 1 780.0623 2337.1651 3 2337.1601 0.005 0 44.52 6.70E-05 R EVAAFAQFGSDLDAATQQLLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9195.9195.3.dta 56 1 IPI00022977.1 Creatine kinase B-type 44 42902 3 3 3 3 2575 5817 1 1 1 652.3663 1302.718 2 1302.7183 -0.0003 0 36.47 0.0025 K VLTPELYAELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6428.6428.2.dta 56 1 IPI00022977.1 Creatine kinase B-type 44 42902 3 3 3 3 3591 7257 1 1 1 779.4029 1556.7912 2 1556.7909 0.0004 0 23.17 0.0067 R FCTGLTQIETLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8222.8222.2.dta 56 1 IPI00022977.1 Creatine kinase B-type 44 42902 3 3 3 3 4773 8068 1 1 1 616.9969 1847.9688 3 1847.9703 -0.0015 0 18.26 0.019 R LGFSEVELVQMVVDGVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9198.9198.3.dta 56 IPI00794730.1 15 kDa protein 36 15139 1 1 1 1 2575 5817 1 0 1 652.3663 1302.718 2 1302.7183 -0.0003 0 36.47 0.0025 K VLTPELYAELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6428.6428.2.dta 57 1 IPI00410693.3 Isoform 1 of Plasminogen activator inhibitor 1 RNA-binding protein 41 44995 1 1 1 1 2370 1606 1 1 1 628.323 1254.6314 2 1254.6317 -0.0002 0 41.14 0.00014 R RPDQQLQGEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1648.1648.2.dta 58 1 IPI00386208.1 Gastric-associated differentially-expressed protein YA61P 40 14858 1 1 1 1 3090 3928 1 1 1 710.8754 1419.7362 2 1419.7358 0.0004 0 40.25 0.001 R AAAYNIVPSSTGAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4244.4244.2.dta 59 1 IPI00022371.1 Histidine-rich glycoprotein precursor 38 60510 1 1 1 1 1796 7282 1 1 1 562.809 1123.6035 2 1123.6026 0.0009 0 38 0.0013 R DGYLFQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8253.8253.2.dta 60 1 IPI00643920.2 Transketolase 38 68519 1 1 1 1 5273 8433 1 1 1 675.0107 2022.0104 3 2022.0091 0.0013 0 37.82 0.00028 K NMAEQIIQEIYSQIQSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9630.9630.3.dta 61 1 IPI00031461.1 Rab GDP dissociation inhibitor beta 38 51087 1 1 1 1 6252 8193 1 1 1 795.4194 2383.2365 3 2383.2345 0.002 1 37.8 0.00061 K IYKVPSTEAEALASSLMGLFEK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9335.9335.3.dta 62 1 IPI00021435.3 26S protease regulatory subunit 7 36 49002 1 1 1 1 4568 7602 1 1 1 884.4413 1766.868 2 1766.8662 0.0019 0 36.39 0.00086 K ACLIFFDEIDAIGGAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8640.8640.2.dta 63 1 IPI00167687.1 "CDNA FLJ37712 fis, clone BRHIP2018369" 33 55422 1 1 1 1 198 3202 1 0 1 351.2314 700.4482 2 700.4483 -0.0001 0 33.18 0.0097 K LLLGSAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3419.3419.2.dta 64 1 IPI00176903.2 Isoform 1 of Polymerase I and transcript release factor 32 43450 1 1 1 1 1758 8410 1 1 1 558.7855 1115.5565 2 1115.5571 -0.0006 0 31.72 0.0011 K AHATTSNTVSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.960.960.2.dta 65 1 IPI00009104.7 RuvB-like 2 31 51296 1 1 1 1 2649 3277 1 1 1 660.818 1319.6214 2 1319.618 0.0034 0 30.65 0.0094 K FVQCPDGELQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3512.3512.2.dta 66 1 IPI00185374.4 26S proteasome non-ATPase regulatory subunit 12 30 53270 1 1 1 1 6678 33 1 1 1 845.7712 2534.2917 3 2534.2938 -0.0021 0 30.5 0.0014 R MAQLLDLSVDESEAFLSNLVVNK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.10040.10040.3.dta 67 1 IPI00827581.1 Variable immnoglobulin anti-estradiol heavy chain (Fragment) 30 14027 1 1 1 1 907 5042 1 1 1 456.7234 911.4322 2 911.4323 -0.0001 0 29.81 0.011 R YAMSWVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5472.5472.2.dta 68 1 IPI00018465.1 T-complex protein 1 subunit eta 29 59842 1 1 1 1 5644 7650 1 1 1 751.3818 2251.1235 3 2251.122 0.0015 0 29.19 0.0018 K SQDAEVGDGTTSVTLLAAEFLK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.8698.8698.3.dta 69 1 IPI00394994.1 nesprin-3 29 112802 1 1 1 1 820 2905 1 1 1 446.7217 891.4288 2 891.4298 -0.001 0 28.85 0.033 R TSTAEDLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3067.3067.2.dta 70 1 IPI00736788.2 Hypothetical protein DKFZp781G0119 29 78184 2 2 1 1 361 3102 1 1 1 384.2368 766.4591 2 766.4589 0.0003 0 23.14 0.011 R LPAPELK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3309.3309.2.dta 70 1 IPI00736788.2 Hypothetical protein DKFZp781G0119 29 78184 2 2 1 1 362 3442 1 1 1 384.2374 766.4603 2 766.4589 0.0014 0 21.64 0.016 R LPAPELK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3706.3706.2.dta 71 1 IPI00807391.1 SARDH protein (Fragment) 29 68268 1 1 1 1 294 4028 1 1 1 373.7154 745.4162 2 745.4123 0.004 0 28.77 0.035 R GLWSGVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4351.4351.2.dta 72 1 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 29 31328 2 2 2 2 1390 700 1 1 1 512.78 1023.5455 2 1023.5461 -0.0006 1 23.52 0.032 K VLDQKEHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1095.1095.2.dta 72 1 IPI00106509.2 Isoform 4 of Heterogeneous nuclear ribonucleoprotein A/B 29 31328 2 2 2 2 3412 2346 1 1 1 750.3467 1498.6789 2 1498.6801 -0.0011 0 25.71 0.016 K EVYQQQQYGSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2453.2453.2.dta 73 1 IPI00033034.1 Alpha-ketoglutarate dehydrogenase complex dihydrolipoyl succinyltransferase 29 48961 1 1 1 1 2075 1649 1 1 1 596.8373 1191.66 2 1191.6611 -0.0011 0 28.73 0.002 K AKPAEAPAAAAPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1693.1693.2.dta 74 1 IPI00745628.1 hypothetical protein 28 38367 1 1 1 1 2623 3842 1 1 1 657.8076 1313.6006 2 1313.5921 0.0084 0 28.01 0.015 K GMEEIYNLSSR K Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4151.4151.2.dta 75 1 IPI00301283.1 Isoform B of F-box/WD repeat protein 11 28 61772 1 1 1 1 684 2394 1 1 1 425.7176 849.4206 2 849.4266 -0.006 0 27.94 0.035 K TSLECLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2504.2504.2.dta 76 1 IPI00004671.1 Golgin subfamily B member 1 27 377273 1 1 1 1 1820 2007 1 1 1 565.332 1128.6494 2 1128.639 0.0104 1 26.69 0.028 K ELQELLKEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2085.2085.2.dta 77 1 IPI00013891.1 Isoform Long of Transformer-2 protein homolog 27 32726 1 1 1 1 977 1978 1 1 1 466.2093 930.4041 2 930.3978 0.0064 0 26.66 0.008 R SHSPMSNR R Oxidation (M) 0.00001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2054.2054.2.dta 78 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 27 112355 3 3 1 1 2129 969 1 1 1 601.8113 1201.608 2 1201.6125 -0.0045 0 15.76 0.04 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.11306.11306.2.dta 78 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 27 112355 3 3 1 1 2136 5106 1 1 1 601.8116 1201.6086 2 1201.6125 -0.0039 0 17.36 0.034 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5550.5550.2.dta 78 1 IPI00014235.2 Similar to RAB3 GTPase-activating protein 27 112355 3 3 1 1 2149 51 1 1 1 601.8119 1201.6093 2 1201.6125 -0.0032 0 26.17 0.013 K LSVSNMVHTAK K Oxidation (M) 0.00000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.10066.10066.2.dta 79 1 IPI00243302.7 similar to olfactory specific medium-chain acyl CoA synthetase 27 66402 1 1 1 1 445 2034 1 1 1 397.7205 793.4265 2 793.4334 -0.0069 1 26.61 0.04 K KSTAPYK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2114.2114.2.dta 80 1 IPI00290566.1 T-complex protein 1 subunit alpha 27 60819 1 1 1 1 8176 8151 1 1 1 1033.8876 3098.6409 3 3098.6421 -0.0012 1 26.53 0.0032 K VLCELADLQDKEVGDGTTSVVIIAAELLK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9290.9290.3.dta 81 1 IPI00180128.4 Isoform 2 of Basic leucine zipper and W2 domain-containing protein 1 26 40627 1 1 1 1 7861 8567 1 1 1 966.465 2896.3731 3 2896.3801 -0.007 0 26.26 0.0034 R FDPTQFQDCIIQGLTETGTDLEAVAK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9796.9796.3.dta 82 1 IPI00748705.1 Conserved hypothetical protein 25 28606 1 1 1 1 848 1614 1 1 1 450.2565 898.4984 2 898.4984 0 0 25.49 0.026 R EAARPSLR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1656.1656.2.dta 83 1 IPI00217561.1 Isoform Beta-1C of Integrin beta-1 precursor 25 95031 1 1 1 1 580 609 1 1 1 413.6973 825.38 2 825.3868 -0.0068 1 25.28 0.034 K KDSDSFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1083.1083.2.dta 84 1 IPI00022200.2 alpha 3 type VI collagen isoform 1 precursor 25 345167 1 1 1 1 683 4234 1 1 1 425.2445 848.4745 2 848.4756 -0.0011 0 24.78 0.048 K LVDFLSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4571.4571.2.dta 85 1 IPI00299000.5 Proliferation-associated protein 2G4 24 44101 1 1 1 1 5063 3562 1 1 1 643.0046 1925.9919 3 1925.9959 -0.004 0 24.43 0.0051 R LVKPGNQNTQVTEAWNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3847.3847.3.dta 86 1 IPI00384734.1 Butyrophilin 24 82036 1 1 1 1 483 3154 1 1 1 403.2159 804.4173 2 804.4164 0.001 0 24.01 0.023 K EMIGLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3365.3365.2.dta 87 1 IPI00009303.1 DNA-binding protein RFX5 24 65682 1 1 1 1 385 2106 1 1 1 387.7451 773.4757 2 773.4759 -0.0002 1 23.59 0.03 R LRGTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2199.2199.2.dta 88 1 IPI00550689.3 UPF0027 protein C22orf28 24 55688 1 1 1 1 5474 8476 1 1 1 716.3773 2146.1101 3 2146.1092 0.0009 1 23.59 0.049 R NLDFQDVLDKLADMGIAIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9686.9686.3.dta 89 1 IPI00006466.1 Zinc finger protein 623 23 63065 1 1 1 1 504 3187 1 1 1 404.7372 807.4598 2 807.4603 -0.0005 1 23 0.044 K AFIRSSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3401.3401.2.dta 90 1 IPI00012535.1 DnaJ homolog subfamily A member 1 23 45581 2 2 2 2 2229 1738 1 1 1 611.7413 1221.468 2 1221.4689 -0.0009 0 20.68 0.0086 K GAVECCPNCR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1800.1800.2.dta 90 1 IPI00012535.1 DnaJ homolog subfamily A member 1 23 45581 2 2 2 2 2354 1905 1 1 1 625.7832 1249.5519 2 1249.5543 -0.0025 1 15.08 0.038 K NVICDKCEGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1977.1977.2.dta 91 1 IPI00433279.2 schlafen family member 5 23 102530 1 1 1 1 511 72 1 1 1 404.7496 807.4846 2 807.4854 -0.0008 1 22.67 0.026 K KLVSFSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1009.1009.2.dta 92 1 IPI00427501.1 Isoform 1 of GH3 domain-containing protein precursor 23 58058 1 1 1 1 564 2675 1 1 1 411.7472 821.4798 2 821.4759 0.0039 0 22.52 0.045 R NHLPLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2810.2810.2.dta 93 1 IPI00012391.3 Isoform Long of Adenomatous polyposis coli protein 22 313622 1 1 1 1 4641 2082 1 1 1 601.6398 1801.8977 3 1801.8806 0.017 1 21.96 0.0087 K TPASKSPSEGQTATTSPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2171.2171.3.dta 94 1 IPI00550746.4 Nuclear migration protein nudC 21 38276 1 1 1 1 2165 2951 1 1 1 601.8159 1201.6172 2 1201.619 -0.0019 0 21.07 0.011 R LVSSDPEINTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3117.3117.2.dta 95 1 IPI00018452.1 Copine-1 21 59649 1 1 1 1 5601 8248 1 1 1 745.7391 2234.1954 3 2234.1947 0.0007 0 20.96 0.011 R EALAQTVLAEVPTQLVSYFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9401.9401.3.dta 96 1 IPI00155647.8 Isoform 2 of PDZ domain-containing protein 2 21 283075 1 1 1 1 1656 8633 1 0 1 362.8531 1085.5375 3 1085.5366 0.0009 0 20.82 0.038 R EGHPPHSLGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.988.988.3.dta 97 1 IPI00297902.4 T-box transcription factor TBX2 19 75247 1 1 1 1 1452 1407 1 1 1 521.2869 1040.5592 2 1040.5614 -0.0023 1 18.59 0.032 R ALSPGRESPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1436.1436.2.dta 98 1 IPI00027626.3 T-complex protein 1 subunit zeta 18 58444 1 1 1 1 4569 8197 1 1 1 884.5236 1767.0326 2 1767.0294 0.0031 0 18.48 0.024 R AQLGVQAFADALLIIPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9339.9339.2.dta 99 1 IPI00216008.4 Isoform Long of Glucose-6-phosphate 1-dehydrogenase 18 64299 1 1 1 1 4651 3719 1 1 1 904.3977 1806.7809 2 1806.7809 0 0 18.12 0.02 R NSYVAGQYDDAASYQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4017.4017.2.dta 100 1 IPI00640799.1 Phosducin-like 18 10549 1 1 1 1 6957 4330 1 1 1 653.8322 2611.2998 4 2611.2799 0.0198 0 17.81 0.027 - ICAPASSSVPAEAELAGEGISVNTGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4674.4674.4.dta 101 1 IPI00002520.1 "Serine hydroxymethyltransferase, mitochondrial precursor" 18 56414 1 1 1 1 2236 1708 1 1 1 408.5515 1222.6328 3 1222.6306 0.0022 0 17.72 0.022 K HADIVTTTTHK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1765.1765.3.dta 102 1 IPI00470781.4 Hypothetical protein LOC90379 18 67390 1 1 1 1 2323 4756 1 1 1 622.7893 1243.5641 2 1243.5542 0.0099 0 17.66 0.022 R NSGAGSGGGGPGGAGGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5150.5150.2.dta 103 1 IPI00376317.3 autoantigen RCD8 17 152992 1 1 1 1 5281 5020 1 1 1 676.6766 2027.0079 3 2027.0106 -0.0027 0 17.04 0.028 R LCTQLEGLQSTVTGHVER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5448.5448.3.dta 104 1 IPI00397622.3 Isoform 1 of Transmembrane and immunoglobulin domain-containing protein 1 precursor 17 29622 1 1 1 1 1020 420 1 1 1 470.2479 938.4812 2 938.4751 0.0061 1 16.96 0.026 K IMKLCMK D Oxidation (M) 0.0000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1057.1057.2.dta 105 1 IPI00063245.1 Isoform 2 of Far upstream element-binding protein 3 16 28645 1 1 1 1 3838 4865 1 1 1 540.5999 1618.7777 3 1618.7733 0.0044 1 16.46 0.029 R GGEQISRIQAESGCK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.5277.5277.3.dta 106 1 IPI00007068.1 actin-related protein 3-beta isoform 1 16 48090 1 1 1 1 3058 118 1 1 1 705.3928 1408.7711 2 1408.7714 -0.0003 0 16.33 0.032 R DITYFIQQLLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.10151.10151.2.dta 107 1 IPI00386418.4 Isoform 2 of Myelin expression factor 2 16 62176 1 1 1 1 3011 4406 1 1 1 698.8112 1395.6078 2 1395.6089 -0.0011 1 16.24 0.03 R FDSPESAEKACR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4760.4760.2.dta 108 1 IPI00171494.5 "dynein, cytoplasmic, heavy polypeptide 2" 16 496587 1 1 1 1 1605 1884 1 1 1 539.2642 1076.5138 2 1076.5098 0.004 0 15.96 0.035 R DIQSGLSDSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1955.1955.2.dta 109 1 IPI00746138.1 Similar to Homeobox-containing protein 16 13993 1 1 1 1 8676 6123 1 1 1 861.169 3440.6469 4 3440.6202 0.0268 1 15.96 0.04 R VQWRHLGSLQPPPPSSSDSCASASGVVGSTSMR H Oxidation (M) 0.000000000000000000000000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.6808.6808.4.dta 110 1 IPI00465142.2 Uncharacterized protein KIAA0528 16 111916 1 1 1 1 4331 2960 1 1 1 565.6094 1693.8065 3 1693.8094 -0.0029 1 15.75 0.034 K AMTVEKASPVGDGNFR N Oxidation (M) 0.0100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.3130.3130.3.dta 111 1 IPI00218631.1 Isoform 3 of Transcription factor SOX-6 16 89993 1 1 1 1 745 2412 1 1 1 434.7336 867.4527 2 867.445 0.0077 0 15.51 0.039 R ASSEPHIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2523.2523.2.dta 112 1 IPI00382710.1 Sorbin polypeptide 15 46401 1 1 1 1 4524 8166 1 1 1 585.6471 1753.9195 3 1753.9111 0.0083 1 14.98 0.039 R HLDVPQDSQRAITFK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.9307.9307.3.dta 113 1 IPI00073179.1 Vacuolar protein sorting-associated protein 33A 15 67967 1 1 1 1 4957 2133 1 1 1 633.6386 1897.8938 3 1897.8954 -0.0016 0 14.86 0.04 K LMNGTSWIEALMEKPF - 2 Oxidation (M) 0.0100000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2228.2228.3.dta 114 1 IPI00787396.1 "similar to Guanine nucleotide-binding protein G(t), alpha-3 subunit" 15 41531 1 1 1 1 7033 1018 1 1 1 874.7378 2621.1916 3 2621.1717 0.0198 1 14.82 0.041 R QLYAMANTPGRWWHDTSTGDGNK T Oxidation (M) 0.00001000000000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.11364.11364.3.dta 115 1 IPI00164458.6 "CDNA FLJ11591 fis, clone HEMBA1003760, moderately similar to HYPOXIA- INDUCIBLE FACTOR 1 ALPHA" 14 70883 1 1 1 1 3912 2270 1 1 1 408.4534 1629.7846 4 1629.7868 -0.0022 1 14.43 0.044 K AATWKVLNCSGHMR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2372.2372.4.dta 116 1 IPI00002134.4 26S proteasome non-ATPase regulatory subunit 5 14 56560 1 1 1 1 2692 2754 1 1 1 665.8057 1329.5969 2 1329.6023 -0.0054 0 14.32 0.049 R MTESWFSSLSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.2901.2901.2.dta 117 1 IPI00043270.1 "CDNA FLJ31609 fis, clone NT2RI2002852" 14 21457 1 1 1 1 1381 63 1 1 1 511.7521 1021.4897 2 1021.4862 0.0035 0 14.27 0.046 - MIISSNADR L Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.1008.1008.2.dta 118 1 IPI00247295.3 Isoform 4 of Nesprin-1 14 1011240 1 1 1 1 3484 4150 1 1 1 507.9511 1520.8316 3 1520.8272 0.0044 1 14.14 0.048 R VPVMDAQYKIITK T Oxidation (M) 0.0001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1603 AE-MF-2\orb_160916_AE-MF-2_#3-5.4482.4482.3.dta