Header -------------------------------------------------------- Search title orb_160921_AE-MF-2_#4-2.raw Timestamp 2016-09-28T01:11:16Z User lu-31 Email Report URI http://mascot.bioreg.kyushu-u.ac.jp/mascot/cgi/master_results.pl?file=D:/2016/20160928/F073881.dat Peak list data path D:\data\oda\160921_AE-MF-2\orb_160921_AE-MF-2_#4-2.raw Peak list format Mascot generic Search type MIS Mascot version 2.5.1 Database ipi_HUM_NEW Fasta file ipi_HUM_NEW_3.26.fasta Total sequences 67667 Total residues 28462731 Sequences after taxonomy filter 67667 Number of queries 7472 Fixed modifications -------------------------------------------------------- Identifier Name Delta Neutral loss 1 Carbamidomethyl (C) 57.021464 Variable modifications -------------------------------------------------------- Identifier Name Delta Neutral loss(es) 1 Oxidation (M) 15.994915 0 63.998285 Search Parameters -------------------------------------------------------- Taxonomy filter All entries Enzyme Trypsin Maximum Missed Cleavages 1 Fixed modifications Carbamidomethyl (C) Variable modifications Oxidation (M) Peptide Mass Tolerance 10 Peptide Mass Tolerance Units ppm Fragment Mass Tolerance 0.8 Fragment Mass Tolerance Units Da Mass values Monoisotopic Instrument type ESI-TRAP Format parameters -------------------------------------------------------- Significance threshold 0.05 Max. number of hits 0 Min. number of sig. unique sequences 1 Use MudPIT protein scoring 1 Ions score cut-off -1 Include same-set proteins 0 Include sub-set proteins 1 Include unassigned 0 Require bold red 0 Use homology threshold 1 Group protein families 1 Show duplicate peptides 1 Protein hits -------------------------------------------------------- prot_hit_num prot_family_member prot_acc prot_desc prot_score prot_mass prot_matches prot_matches_sig prot_sequences prot_sequences_sig pep_query pep_index pep_rank pep_isbold pep_isunique pep_exp_mz pep_exp_mr pep_exp_z pep_calc_mr pep_delta pep_miss pep_score pep_expect pep_res_before pep_seq pep_res_after pep_var_mod pep_var_mod_pos pep_summed_mod_pos pep_local_mod_pos pep_scan_title 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 987 2257 2 1 1 422.2378 842.461 2 842.461 0.0001 0 32.11 0.015 R ANELQLR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3491.3491.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 1075 2138 1 1 1 432.7318 863.449 2 863.4501 -0.0011 0 35.53 0.0066 K FAEQTLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3354.3354.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 1276 5064 1 1 1 451.2893 900.564 2 900.5644 -0.0004 0 48.23 7.10E-05 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6515.6515.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 1356 3376 1 1 1 458.2661 914.5177 2 914.5185 -0.0008 0 63.11 1.50E-05 K GLLSAEVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4742.4742.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 1639 2410 1 1 1 480.2612 958.5079 2 958.5083 -0.0004 0 29.15 0.033 R LQLEATER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3677.3677.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 1744 3585 1 1 1 488.2588 974.5031 2 974.5033 -0.0001 0 46.42 0.00058 K DLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4968.4968.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 1782 2034 1 1 1 492.7588 983.5031 2 983.5036 -0.0005 0 24.02 0.0069 R VPDVQDGVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3221.3221.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 1904 496 1 1 1 500.7743 999.534 2 999.5349 -0.0008 0 22.43 0.022 R TLKPEEQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1539.1539.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 1918 2032 1 1 1 501.7639 1001.5133 2 1001.5141 -0.0008 0 38.74 0.00038 R QAEVELASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3219.3219.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 1997 1740 1 1 1 508.2798 1014.5451 2 1014.5458 -0.0007 0 73.82 9.30E-07 R LSVAAQEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2900.2900.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2120 1785 1 1 1 516.2906 1030.5667 2 1030.5658 0.0009 0 61.72 1.50E-05 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2948.2948.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2510 3248 1 1 1 550.7881 1099.5617 2 1099.5622 -0.0004 0 66.08 5.30E-06 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4603.4603.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2515 767 1 1 1 551.2849 1100.5552 2 1100.5574 -0.0023 0 35.54 0.0031 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1834.1834.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2616 4446 1 1 1 559.7971 1117.5797 2 1117.5801 -0.0004 0 38.53 0.00069 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5888.5888.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2620 2485 1 1 1 560.276 1118.5375 2 1118.539 -0.0015 0 32.11 0.012 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3765.3765.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2683 3710 1 1 1 565.3018 1128.589 2 1128.5887 0.0002 0 42.47 0.0012 R NLVDNITGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5104.5104.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2756 1518 1 1 1 572.3032 1142.5919 2 1142.5931 -0.0012 0 27.84 0.0055 R LQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2660.2660.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2805 3412 1 1 1 576.2824 1150.5503 2 1150.5506 -0.0003 0 17.77 0.044 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4781.4781.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2916 3963 1 1 1 585.8218 1169.629 2 1169.6292 -0.0002 0 36.84 0.00045 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5377.5377.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 2948 2299 1 1 1 588.2714 1174.5282 2 1174.5288 -0.0007 0 30.25 0.0015 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3545.3545.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 3035 4815 1 1 1 595.8427 1189.6708 2 1189.6707 0.0001 0 74.58 4.60E-07 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6260.6260.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 3040 4892 1 1 1 596.3257 1190.6368 2 1190.6369 -0.0001 0 54.8 5.70E-05 R LPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6338.6338.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 3407 4408 1 1 1 621.7985 1241.5825 2 1241.5829 -0.0004 0 44.38 0.0006 K GWLYYEAGQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5848.5848.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 3412 2648 1 1 1 621.8426 1241.6706 2 1241.6728 -0.0022 0 49.72 4.30E-05 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3952.3952.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 3725 5130 1 1 1 642.8617 1283.7088 2 1283.7085 0.0004 0 28.61 0.0028 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6580.6580.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 3738 3670 1 1 1 644.3465 1286.6784 2 1286.683 -0.0046 0 65.91 2.50E-06 K AQVEQELTTLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5060.5060.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 3828 3353 1 1 1 650.319 1298.6235 2 1298.6255 -0.002 0 30.34 0.0014 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4717.4717.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 3991 4681 1 1 1 661.8314 1321.6483 2 1321.6514 -0.0031 0 52.91 1.90E-05 R SQVEEELFSVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6125.6125.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 4367 1114 1 1 1 463.236 1386.6862 3 1386.6851 0.0011 1 19.29 0.049 R ARSDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2212.2212.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 4797 4184 1 1 1 731.3709 1460.7273 2 1460.7293 -0.002 0 81.73 6.50E-08 R SQVMDEATALQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5615.5615.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 4940 5399 1 1 1 740.8855 1479.7564 2 1479.7569 -0.0005 0 45.16 0.00033 R TSSEDNLYLAVLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6852.6852.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5047 3230 1 1 1 755.8534 1509.6922 2 1509.6947 -0.0025 0 27.35 0.0027 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4583.4583.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5111 5963 1 1 1 764.8723 1527.73 2 1527.7318 -0.0018 0 35.01 0.00071 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7422.7422.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5112 5957 1 1 1 764.8732 1527.7319 2 1527.7318 0.0002 0 18.67 0.032 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7416.7416.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5158 4571 1 1 1 769.9296 1537.8447 2 1537.8464 -0.0017 0 80.75 3.60E-08 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6015.6015.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5212 4253 1 1 1 778.9168 1555.8191 2 1555.8205 -0.0015 0 93.99 1.50E-09 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5688.5688.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5223 3382 1 1 1 520.9543 1559.841 3 1559.842 -0.0009 1 20.75 0.03 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4748.4748.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5245 5272 1 1 1 783.9462 1565.8778 2 1565.8777 0.0001 0 64.58 8.80E-07 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6723.6723.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5256 5326 1 1 1 785.9061 1569.7976 2 1569.7998 -0.0023 0 15.7 0.034 R DDGTGQLLLPLSDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6778.6778.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5431 3198 1 1 1 531.6053 1591.7942 3 1591.7954 -0.0012 1 34.01 0.0074 R ARQEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4549.4549.3.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 5491 4276 1 1 1 807.4407 1612.8668 2 1612.8672 -0.0004 0 57.53 4.00E-06 R LLDAQLSTGGIVDPSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5711.5711.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 6264 2921 1 1 1 877.9322 1753.8498 2 1753.8483 0.0016 0 77.06 6.00E-08 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4249.4249.2.dta 1 1 IPI00398779.3 plectin 1 isoform 11 1057 517822 43 43 42 42 6465 5111 1 1 1 917.9496 1833.8846 2 1833.8857 -0.0011 0 28.95 0.0019 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6561.6561.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 987 2257 2 0 1 422.2378 842.461 2 842.461 0.0001 0 32.11 0.015 R ANELQLR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3491.3491.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 1075 2138 1 0 1 432.7318 863.449 2 863.4501 -0.0011 0 35.53 0.0066 K FAEQTLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3354.3354.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 1276 5064 1 0 1 451.2893 900.564 2 900.5644 -0.0004 0 48.23 7.10E-05 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6515.6515.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 1356 3376 1 0 1 458.2661 914.5177 2 914.5185 -0.0008 0 63.11 1.50E-05 K GLLSAEVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4742.4742.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 1639 2410 1 0 1 480.2612 958.5079 2 958.5083 -0.0004 0 29.15 0.033 R LQLEATER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3677.3677.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 1744 3585 1 0 1 488.2588 974.5031 2 974.5033 -0.0001 0 46.42 0.00058 K DLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4968.4968.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 1782 2034 1 0 1 492.7588 983.5031 2 983.5036 -0.0005 0 24.02 0.0069 R VPDVQDGVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3221.3221.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 1904 496 1 0 1 500.7743 999.534 2 999.5349 -0.0008 0 22.43 0.022 R TLKPEEQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1539.1539.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 1918 2032 1 0 1 501.7639 1001.5133 2 1001.5141 -0.0008 0 38.74 0.00038 R QAEVELASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3219.3219.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 1997 1740 1 0 1 508.2798 1014.5451 2 1014.5458 -0.0007 0 73.82 9.30E-07 R LSVAAQEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2900.2900.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2120 1785 1 0 1 516.2906 1030.5667 2 1030.5658 0.0009 0 61.72 1.50E-05 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2948.2948.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2510 3248 1 0 1 550.7881 1099.5617 2 1099.5622 -0.0004 0 66.08 5.30E-06 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4603.4603.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2515 767 1 0 1 551.2849 1100.5552 2 1100.5574 -0.0023 0 35.54 0.0031 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1834.1834.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2616 4446 1 0 1 559.7971 1117.5797 2 1117.5801 -0.0004 0 38.53 0.00069 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5888.5888.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2620 2485 1 0 1 560.276 1118.5375 2 1118.539 -0.0015 0 32.11 0.012 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3765.3765.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2683 3710 1 0 1 565.3018 1128.589 2 1128.5887 0.0002 0 42.47 0.0012 R NLVDNITGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5104.5104.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2756 1518 1 0 1 572.3032 1142.5919 2 1142.5931 -0.0012 0 27.84 0.0055 R LQAEEVAQQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2660.2660.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2805 3412 1 0 1 576.2824 1150.5503 2 1150.5506 -0.0003 0 17.77 0.044 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4781.4781.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2916 3963 1 0 1 585.8218 1169.629 2 1169.6292 -0.0002 0 36.84 0.00045 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5377.5377.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 2948 2299 1 0 1 588.2714 1174.5282 2 1174.5288 -0.0007 0 30.25 0.0015 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3545.3545.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 3035 4815 1 0 1 595.8427 1189.6708 2 1189.6707 0.0001 0 74.58 4.60E-07 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6260.6260.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 3040 4892 1 0 1 596.3257 1190.6368 2 1190.6369 -0.0001 0 54.8 5.70E-05 R LPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6338.6338.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 3407 4408 1 0 1 621.7985 1241.5825 2 1241.5829 -0.0004 0 44.38 0.0006 K GWLYYEAGQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5848.5848.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 3412 2648 1 0 1 621.8426 1241.6706 2 1241.6728 -0.0022 0 49.72 4.30E-05 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3952.3952.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 3725 5130 1 0 1 642.8617 1283.7088 2 1283.7085 0.0004 0 28.61 0.0028 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6580.6580.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 3738 3670 1 0 1 644.3465 1286.6784 2 1286.683 -0.0046 0 65.91 2.50E-06 K AQVEQELTTLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5060.5060.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 3828 3353 1 0 1 650.319 1298.6235 2 1298.6255 -0.002 0 30.34 0.0014 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4717.4717.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 3991 4681 1 0 1 661.8314 1321.6483 2 1321.6514 -0.0031 0 52.91 1.90E-05 R SQVEEELFSVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6125.6125.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 4367 1114 1 0 1 463.236 1386.6862 3 1386.6851 0.0011 1 19.29 0.049 R ARSDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2212.2212.3.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 4797 4184 1 0 1 731.3709 1460.7273 2 1460.7293 -0.002 0 81.73 6.50E-08 R SQVMDEATALQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5615.5615.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5047 3230 1 0 1 755.8534 1509.6922 2 1509.6947 -0.0025 0 27.35 0.0027 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4583.4583.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5111 5963 1 0 1 764.8723 1527.73 2 1527.7318 -0.0018 0 35.01 0.00071 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7422.7422.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5112 5957 1 0 1 764.8732 1527.7319 2 1527.7318 0.0002 0 18.67 0.032 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7416.7416.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5158 4571 1 0 1 769.9296 1537.8447 2 1537.8464 -0.0017 0 80.75 3.60E-08 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6015.6015.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5212 4253 1 0 1 778.9168 1555.8191 2 1555.8205 -0.0015 0 93.99 1.50E-09 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5688.5688.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5223 3382 1 0 1 520.9543 1559.841 3 1559.842 -0.0009 1 20.75 0.03 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4748.4748.3.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5245 5272 1 0 1 783.9462 1565.8778 2 1565.8777 0.0001 0 64.58 8.80E-07 R APVPASELLASGVLSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6723.6723.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5256 5326 1 0 1 785.9061 1569.7976 2 1569.7998 -0.0023 0 15.7 0.034 R DDGTGQLLLPLSDAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6778.6778.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5431 3198 1 0 1 531.6053 1591.7942 3 1591.7954 -0.0012 1 34.01 0.0074 R ARQEELYSELQAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4549.4549.3.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 5491 4276 1 0 1 807.4407 1612.8668 2 1612.8672 -0.0004 0 57.53 4.00E-06 R LLDAQLSTGGIVDPSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5711.5711.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 6264 2921 1 0 1 877.9322 1753.8498 2 1753.8483 0.0016 0 77.06 6.00E-08 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4249.4249.2.dta 1 IPI00186711.3 plectin 1 isoform 6 1034 533462 42 42 41 41 6465 5111 1 0 1 917.9496 1833.8846 2 1833.8857 -0.0011 0 28.95 0.0019 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6561.6561.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 987 2257 2 0 1 422.2378 842.461 2 842.461 0.0001 0 32.11 0.015 R ANELQLR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3491.3491.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 1075 2138 1 0 1 432.7318 863.449 2 863.4501 -0.0011 0 35.53 0.0066 K FAEQTLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3354.3354.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 1276 5064 1 0 1 451.2893 900.564 2 900.5644 -0.0004 0 48.23 7.10E-05 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6515.6515.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 1356 3376 1 0 1 458.2661 914.5177 2 914.5185 -0.0008 0 63.11 1.50E-05 K GLLSAEVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4742.4742.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 1639 2410 1 0 1 480.2612 958.5079 2 958.5083 -0.0004 0 29.15 0.033 R LQLEATER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3677.3677.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 1744 3585 1 0 1 488.2588 974.5031 2 974.5033 -0.0001 0 46.42 0.00058 K DLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4968.4968.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 1782 2034 1 0 1 492.7588 983.5031 2 983.5036 -0.0005 0 24.02 0.0069 R VPDVQDGVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3221.3221.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 1904 496 1 0 1 500.7743 999.534 2 999.5349 -0.0008 0 22.43 0.022 R TLKPEEQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1539.1539.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 1918 2032 1 0 1 501.7639 1001.5133 2 1001.5141 -0.0008 0 38.74 0.00038 R QAEVELASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3219.3219.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 1997 1740 1 0 1 508.2798 1014.5451 2 1014.5458 -0.0007 0 73.82 9.30E-07 R LSVAAQEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2900.2900.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 2120 1785 1 0 1 516.2906 1030.5667 2 1030.5658 0.0009 0 61.72 1.50E-05 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2948.2948.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 2510 3248 1 0 1 550.7881 1099.5617 2 1099.5622 -0.0004 0 66.08 5.30E-06 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4603.4603.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 2515 767 1 0 1 551.2849 1100.5552 2 1100.5574 -0.0023 0 35.54 0.0031 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1834.1834.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 2616 4446 1 0 1 559.7971 1117.5797 2 1117.5801 -0.0004 0 38.53 0.00069 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5888.5888.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 2620 2485 1 0 1 560.276 1118.5375 2 1118.539 -0.0015 0 32.11 0.012 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3765.3765.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 2683 3710 1 0 1 565.3018 1128.589 2 1128.5887 0.0002 0 42.47 0.0012 R NLVDNITGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5104.5104.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 2805 3412 1 0 1 576.2824 1150.5503 2 1150.5506 -0.0003 0 17.77 0.044 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4781.4781.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 2916 3963 1 0 1 585.8218 1169.629 2 1169.6292 -0.0002 0 36.84 0.00045 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5377.5377.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 2948 2299 1 0 1 588.2714 1174.5282 2 1174.5288 -0.0007 0 30.25 0.0015 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3545.3545.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 3035 4815 1 0 1 595.8427 1189.6708 2 1189.6707 0.0001 0 74.58 4.60E-07 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6260.6260.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 3040 4892 1 0 1 596.3257 1190.6368 2 1190.6369 -0.0001 0 54.8 5.70E-05 R LPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6338.6338.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 3407 4408 1 0 1 621.7985 1241.5825 2 1241.5829 -0.0004 0 44.38 0.0006 K GWLYYEAGQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5848.5848.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 3412 2648 1 0 1 621.8426 1241.6706 2 1241.6728 -0.0022 0 49.72 4.30E-05 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3952.3952.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 3725 5130 1 0 1 642.8617 1283.7088 2 1283.7085 0.0004 0 28.61 0.0028 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6580.6580.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 3738 3670 1 0 1 644.3465 1286.6784 2 1286.683 -0.0046 0 65.91 2.50E-06 K AQVEQELTTLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5060.5060.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 3828 3353 1 0 1 650.319 1298.6235 2 1298.6255 -0.002 0 30.34 0.0014 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4717.4717.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 3991 4681 1 0 1 661.8314 1321.6483 2 1321.6514 -0.0031 0 52.91 1.90E-05 R SQVEEELFSVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6125.6125.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 4367 1114 1 0 1 463.236 1386.6862 3 1386.6851 0.0011 1 19.29 0.049 R ARSDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2212.2212.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 4797 4184 1 0 1 731.3709 1460.7273 2 1460.7293 -0.002 0 81.73 6.50E-08 R SQVMDEATALQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5615.5615.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 5047 3230 1 0 1 755.8534 1509.6922 2 1509.6947 -0.0025 0 27.35 0.0027 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4583.4583.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 5111 5963 1 0 1 764.8723 1527.73 2 1527.7318 -0.0018 0 35.01 0.00071 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7422.7422.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 5112 5957 1 0 1 764.8732 1527.7319 2 1527.7318 0.0002 0 18.67 0.032 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7416.7416.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 5158 4571 1 0 1 769.9296 1537.8447 2 1537.8464 -0.0017 0 80.75 3.60E-08 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6015.6015.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 5212 4253 1 0 1 778.9168 1555.8191 2 1555.8205 -0.0015 0 93.99 1.50E-09 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5688.5688.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 5223 3382 1 0 1 520.9543 1559.841 3 1559.842 -0.0009 1 20.75 0.03 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4748.4748.3.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 5491 4276 1 0 1 807.4407 1612.8668 2 1612.8672 -0.0004 0 57.53 4.00E-06 R LLDAQLSTGGIVDPSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5711.5711.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 6264 2921 1 0 1 877.9322 1753.8498 2 1753.8483 0.0016 0 77.06 6.00E-08 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4249.4249.2.dta 1 IPI00014898.1 Isoform 1 of Plectin-1 966 533408 38 38 37 37 6465 5111 1 0 1 917.9496 1833.8846 2 1833.8857 -0.0011 0 28.95 0.0019 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6561.6561.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 1075 2138 1 0 1 432.7318 863.449 2 863.4501 -0.0011 0 35.53 0.0066 K FAEQTLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3354.3354.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 1276 5064 1 0 1 451.2893 900.564 2 900.5644 -0.0004 0 48.23 7.10E-05 R SSIAGLLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6515.6515.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 1356 3376 1 0 1 458.2661 914.5177 2 914.5185 -0.0008 0 63.11 1.50E-05 K GLLSAEVAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4742.4742.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 1639 2410 1 0 1 480.2612 958.5079 2 958.5083 -0.0004 0 29.15 0.033 R LQLEATER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3677.3677.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 1744 3585 1 0 1 488.2588 974.5031 2 974.5033 -0.0001 0 46.42 0.00058 K DLSELGSVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4968.4968.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 1904 496 1 0 1 500.7743 999.534 2 999.5349 -0.0008 0 22.43 0.022 R TLKPEEQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1539.1539.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 1918 2032 1 0 1 501.7639 1001.5133 2 1001.5141 -0.0008 0 38.74 0.00038 R QAEVELASR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3219.3219.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 1997 1740 1 0 1 508.2798 1014.5451 2 1014.5458 -0.0007 0 73.82 9.30E-07 R LSVAAQEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2900.2900.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 2120 1785 1 0 1 516.2906 1030.5667 2 1030.5658 0.0009 0 61.72 1.50E-05 R LLEAAAQSTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2948.2948.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 2510 3248 1 0 1 550.7881 1099.5617 2 1099.5622 -0.0004 0 66.08 5.30E-06 R GGAEGELQALR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4603.4603.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 2515 767 1 0 1 551.2849 1100.5552 2 1100.5574 -0.0023 0 35.54 0.0031 R QLAEGTAQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1834.1834.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 2616 4446 1 0 1 559.7971 1117.5797 2 1117.5801 -0.0004 0 38.53 0.00069 K QITMEELVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5888.5888.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 2620 2485 1 0 1 560.276 1118.5375 2 1118.539 -0.0015 0 32.11 0.012 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3765.3765.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 2683 3710 1 0 1 565.3018 1128.589 2 1128.5887 0.0002 0 42.47 0.0012 R NLVDNITGQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5104.5104.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 2805 3412 1 0 1 576.2824 1150.5503 2 1150.5506 -0.0003 0 17.77 0.044 R QYDIDDAIAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4781.4781.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 2916 3963 1 0 1 585.8218 1169.629 2 1169.6292 -0.0002 0 36.84 0.00045 K ELIPTEEALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5377.5377.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 2948 2299 1 0 1 588.2714 1174.5282 2 1174.5288 -0.0007 0 30.25 0.0015 R CVEDPETGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3545.3545.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 3035 4815 1 0 1 595.8427 1189.6708 2 1189.6707 0.0001 0 74.58 4.60E-07 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6260.6260.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 3040 4892 1 0 1 596.3257 1190.6368 2 1190.6369 -0.0001 0 54.8 5.70E-05 R LPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6338.6338.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 3407 4408 1 0 1 621.7985 1241.5825 2 1241.5829 -0.0004 0 44.38 0.0006 K GWLYYEAGQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5848.5848.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 3412 2648 1 0 1 621.8426 1241.6706 2 1241.6728 -0.0022 0 49.72 4.30E-05 R QVQVALETAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3952.3952.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 3725 5130 1 0 1 642.8617 1283.7088 2 1283.7085 0.0004 0 28.61 0.0028 R SLVPAAELLESR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6580.6580.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 3738 3670 1 0 1 644.3465 1286.6784 2 1286.683 -0.0046 0 65.91 2.50E-06 K AQVEQELTTLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5060.5060.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 3828 3353 1 0 1 650.319 1298.6235 2 1298.6255 -0.002 0 30.34 0.0014 R QQGLASYDYVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4717.4717.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 3991 4681 1 0 1 661.8314 1321.6483 2 1321.6514 -0.0031 0 52.91 1.90E-05 R SQVEEELFSVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6125.6125.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 4367 1114 1 0 1 463.236 1386.6862 3 1386.6851 0.0011 1 19.29 0.049 R ARSDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2212.2212.3.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 4797 4184 1 0 1 731.3709 1460.7273 2 1460.7293 -0.002 0 81.73 6.50E-08 R SQVMDEATALQLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5615.5615.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 5047 3230 1 0 1 755.8534 1509.6922 2 1509.6947 -0.0025 0 27.35 0.0027 R YASGSSASLGGPESAVA - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4583.4583.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 5111 5963 1 0 1 764.8723 1527.73 2 1527.7318 -0.0018 0 35.01 0.00071 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7422.7422.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 5112 5957 1 0 1 764.8732 1527.7319 2 1527.7318 0.0002 0 18.67 0.032 R ESADPLGAWLQDAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7416.7416.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 5158 4571 1 0 1 769.9296 1537.8447 2 1537.8464 -0.0017 0 80.75 3.60E-08 R LLDAQLATGGIVDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6015.6015.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 5212 4253 1 0 1 778.9168 1555.8191 2 1555.8205 -0.0015 0 93.99 1.50E-09 R LQEAGILSAEELQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5688.5688.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 5223 3382 1 0 1 520.9543 1559.841 3 1559.842 -0.0009 1 20.75 0.03 R VIDRELYQQLQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4748.4748.3.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 5491 4276 1 0 1 807.4407 1612.8668 2 1612.8672 -0.0004 0 57.53 4.00E-06 R LLDAQLSTGGIVDPSK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5711.5711.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 6264 2921 1 0 1 877.9322 1753.8498 2 1753.8483 0.0016 0 77.06 6.00E-08 R SSSVGSSSSYPISPAVSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4249.4249.2.dta 1 IPI00215943.1 Isoform 3 of Plectin-1 950 519629 36 36 35 35 6465 5111 1 0 1 917.9496 1833.8846 2 1833.8857 -0.0011 0 28.95 0.0019 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6561.6561.2.dta 1 IPI00740690.1 similar to Plectin-1 143 144727 8 8 8 8 987 2257 2 0 1 422.2378 842.461 2 842.461 0.0001 0 32.11 0.015 R ANELQLR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3491.3491.2.dta 1 IPI00740690.1 similar to Plectin-1 143 144727 8 8 8 8 1782 2034 1 0 1 492.7588 983.5031 2 983.5036 -0.0005 0 24.02 0.0069 R VPDVQDGVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3221.3221.2.dta 1 IPI00740690.1 similar to Plectin-1 143 144727 8 8 8 8 1904 496 1 0 1 500.7743 999.534 2 999.5349 -0.0008 0 22.43 0.022 R TLKPEEQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1539.1539.2.dta 1 IPI00740690.1 similar to Plectin-1 143 144727 8 8 8 8 2620 2485 1 0 1 560.276 1118.5375 2 1118.539 -0.0015 0 32.11 0.012 R LQLEACETR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3765.3765.2.dta 1 IPI00740690.1 similar to Plectin-1 143 144727 8 8 8 8 3035 4815 1 0 1 595.8427 1189.6708 2 1189.6707 0.0001 0 74.58 4.60E-07 R LLFNDVQTLK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6260.6260.2.dta 1 IPI00740690.1 similar to Plectin-1 143 144727 8 8 8 8 3040 4892 1 0 1 596.3257 1190.6368 2 1190.6369 -0.0001 0 54.8 5.70E-05 R LPLLAVCDYK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6338.6338.2.dta 1 IPI00740690.1 similar to Plectin-1 143 144727 8 8 8 8 4367 1114 1 0 1 463.236 1386.6862 3 1386.6851 0.0011 1 19.29 0.049 R ARSDEGQLSPATR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2212.2212.3.dta 1 IPI00740690.1 similar to Plectin-1 143 144727 8 8 8 8 6465 5111 1 0 1 917.9496 1833.8846 2 1833.8857 -0.0011 0 28.95 0.0019 R QTNLENLDQAFSVAER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6561.6561.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 261 1385 1 1 1 344.7034 687.3923 2 687.3915 0.0008 0 31.11 0.031 R LLEASR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2515.2515.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 581 637 1 1 1 387.2296 772.4446 2 772.4443 0.0003 0 24.96 0.048 K VTQQGLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1693.1693.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 766 162 1 1 1 407.7029 813.3912 2 813.3916 -0.0003 0 18.27 0.019 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1178.1178.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 1623 3413 1 1 1 479.2894 956.5642 2 956.5655 -0.0013 0 63.95 6.10E-06 K GLVQALQTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4782.4782.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 1661 2800 1 1 1 481.2684 960.5222 2 960.524 -0.0018 0 71.79 1.90E-06 K TGTVSLEVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4117.4117.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 1876 5383 1 1 1 498.3285 994.6424 2 994.6426 -0.0003 0 24.88 0.0039 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6835.6835.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 2152 2889 1 1 1 519.7645 1037.5145 2 1037.5142 0.0003 0 45.45 0.00018 K YSGTLNLDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4214.4214.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 2189 2501 1 1 1 522.2955 1042.5764 2 1042.5771 -0.0007 0 53.93 3.30E-05 K AQVADVVVSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3782.3782.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 2321 1830 1 1 1 535.2666 1068.5187 2 1068.52 -0.0013 0 57.31 4.20E-06 R DPSQQELPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3000.3000.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 2597 5166 1 1 1 558.3372 1114.6598 2 1114.6598 0 0 67.87 1.40E-06 R SEGVVAVLLTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6616.6616.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 2758 342 1 1 1 572.3091 1142.6036 2 1142.6044 -0.0008 1 29.38 0.029 R ASGRTPEAVQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1372.1372.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3033 3109 1 1 1 595.8242 1189.6339 2 1189.6343 -0.0004 0 46.4 0.00018 R SDEAVKPFGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4452.4452.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3063 1729 1 1 1 597.8261 1193.6377 2 1193.6404 -0.0028 1 40.89 0.00015 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2888.2888.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3065 1721 1 1 1 398.8878 1193.6415 3 1193.6404 0.0011 1 16.39 0.031 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2880.2880.3.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3181 2149 1 1 1 604.785 1207.5555 2 1207.5577 -0.0022 0 36.07 0.00041 R LGMLSPEGTCK A Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3366.3366.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3481 4580 1 1 1 626.3107 1250.6068 2 1250.6084 -0.0016 0 38.05 0.0004 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6023.6023.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3482 4572 1 1 1 417.8769 1250.6088 3 1250.6084 0.0003 0 32.78 0.00084 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6016.6016.3.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3593 3794 1 1 1 632.3733 1262.732 2 1262.7347 -0.0026 0 64.98 8.10E-07 R LQVVDQPLPVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5194.5194.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3768 3450 1 1 1 645.7904 1289.5663 2 1289.5677 -0.0014 0 35.44 0.00047 K VYQWDDPDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4822.4822.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3827 2880 1 1 1 649.8405 1297.6665 2 1297.6626 0.0038 0 63.43 1.10E-06 K VGDPQELNGITR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4204.4204.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 3856 3842 1 1 1 651.8395 1301.6644 2 1301.6649 -0.0005 0 53.77 9.80E-05 R AALQEELQLCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5246.5246.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 4362 5090 1 1 1 693.8772 1385.7398 2 1385.7402 -0.0003 0 90.14 2.40E-08 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6540.6540.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 4499 4329 1 1 1 704.8657 1407.7168 2 1407.718 -0.0013 0 28.82 0.0024 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5767.5767.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 4580 4714 1 1 1 713.8876 1425.7606 2 1425.765 -0.0044 0 47.41 8.10E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6159.6159.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 4690 4026 1 1 1 721.8865 1441.7584 2 1441.7599 -0.0015 0 53.91 2.90E-05 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5445.5445.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 4844 4207 1 1 1 735.3535 1468.6925 2 1468.6947 -0.0022 0 79.81 1.70E-07 R FPQLDSTSFANSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5639.5639.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 4994 2655 1 1 1 499.2789 1494.815 3 1494.8154 -0.0004 1 27.13 0.0029 R RQQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3960.3960.3.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 5490 3270 1 1 1 807.4131 1612.8116 2 1612.8169 -0.0053 0 65.37 7.40E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4627.4627.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 5580 5117 1 1 1 811.9719 1621.9292 2 1621.9291 0.0001 0 44.79 0.00011 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6568.6568.2.dta 2 1 IPI00645907.3 fatty acid synthase 834 275877 30 30 27 27 6271 3452 1 1 1 586.6569 1756.9488 3 1756.9505 -0.0018 1 39.06 0.00022 R ALCATRQEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4824.4824.3.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 261 1385 1 0 1 344.7034 687.3923 2 687.3915 0.0008 0 31.11 0.031 R LLEASR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2515.2515.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 766 162 1 0 1 407.7029 813.3912 2 813.3916 -0.0003 0 18.27 0.019 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1178.1178.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 1661 2800 1 0 1 481.2684 960.5222 2 960.524 -0.0018 0 71.79 1.90E-06 K TGTVSLEVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4117.4117.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 1876 5383 1 0 1 498.3285 994.6424 2 994.6426 -0.0003 0 24.88 0.0039 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6835.6835.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 2152 2889 1 0 1 519.7645 1037.5145 2 1037.5142 0.0003 0 45.45 0.00018 K YSGTLNLDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4214.4214.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 2189 2501 1 0 1 522.2955 1042.5764 2 1042.5771 -0.0007 0 53.93 3.30E-05 K AQVADVVVSR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3782.3782.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 2321 1830 1 0 1 535.2666 1068.5187 2 1068.52 -0.0013 0 57.31 4.20E-06 R DPSQQELPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3000.3000.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 2597 5166 1 0 1 558.3372 1114.6598 2 1114.6598 0 0 67.87 1.40E-06 R SEGVVAVLLTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6616.6616.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 2758 342 1 0 1 572.3091 1142.6036 2 1142.6044 -0.0008 1 29.38 0.029 R ASGRTPEAVQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1372.1372.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3033 3109 1 0 1 595.8242 1189.6339 2 1189.6343 -0.0004 0 46.4 0.00018 R SDEAVKPFGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4452.4452.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3063 1729 1 0 1 597.8261 1193.6377 2 1193.6404 -0.0028 1 40.89 0.00015 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2888.2888.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3065 1721 1 0 1 398.8878 1193.6415 3 1193.6404 0.0011 1 16.39 0.031 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2880.2880.3.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3181 2149 1 0 1 604.785 1207.5555 2 1207.5577 -0.0022 0 36.07 0.00041 R LGMLSPEGTCK A Oxidation (M) 0.00100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3366.3366.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3481 4580 1 0 1 626.3107 1250.6068 2 1250.6084 -0.0016 0 38.05 0.0004 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6023.6023.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3482 4572 1 0 1 417.8769 1250.6088 3 1250.6084 0.0003 0 32.78 0.00084 R FDASFFGVHPK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6016.6016.3.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3593 3794 1 0 1 632.3733 1262.732 2 1262.7347 -0.0026 0 64.98 8.10E-07 R LQVVDQPLPVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5194.5194.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3768 3450 1 0 1 645.7904 1289.5663 2 1289.5677 -0.0014 0 35.44 0.00047 K VYQWDDPDPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4822.4822.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3827 2880 1 0 1 649.8405 1297.6665 2 1297.6626 0.0038 0 63.43 1.10E-06 K VGDPQELNGITR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4204.4204.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 3856 3842 1 0 1 651.8395 1301.6644 2 1301.6649 -0.0005 0 53.77 9.80E-05 R AALQEELQLCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5246.5246.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 4362 5090 1 0 1 693.8772 1385.7398 2 1385.7402 -0.0003 0 90.14 2.40E-08 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6540.6540.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 4499 4329 1 0 1 704.8657 1407.7168 2 1407.718 -0.0013 0 28.82 0.0024 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5767.5767.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 4580 4714 1 0 1 713.8876 1425.7606 2 1425.765 -0.0044 0 47.41 8.10E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6159.6159.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 4690 4026 1 0 1 721.8865 1441.7584 2 1441.7599 -0.0015 0 53.91 2.90E-05 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5445.5445.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 4844 4207 1 0 1 735.3535 1468.6925 2 1468.6947 -0.0022 0 79.81 1.70E-07 R FPQLDSTSFANSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5639.5639.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 4994 2655 1 0 1 499.2789 1494.815 3 1494.8154 -0.0004 1 27.13 0.0029 R RQQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3960.3960.3.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 5490 3270 1 0 1 807.4131 1612.8116 2 1612.8169 -0.0053 0 65.37 7.40E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4627.4627.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 5580 5117 1 0 1 811.9719 1621.9292 2 1621.9291 0.0001 0 44.79 0.00011 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6568.6568.2.dta 2 IPI00026781.2 Fatty acid synthase 793 275850 28 28 25 25 6271 3452 1 0 1 586.6569 1756.9488 3 1756.9505 -0.0018 1 39.06 0.00022 R ALCATRQEPLLIGSTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4824.4824.3.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 581 637 1 0 1 387.2296 772.4446 2 772.4443 0.0003 0 24.96 0.048 K VTQQGLK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1693.1693.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 766 162 1 0 1 407.7029 813.3912 2 813.3916 -0.0003 0 18.27 0.019 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1178.1178.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 1623 3413 1 0 1 479.2894 956.5642 2 956.5655 -0.0013 0 63.95 6.10E-06 K GLVQALQTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4782.4782.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 1876 5383 1 0 1 498.3285 994.6424 2 994.6426 -0.0003 0 24.88 0.0039 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6835.6835.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 2321 1830 1 0 1 535.2666 1068.5187 2 1068.52 -0.0013 0 57.31 4.20E-06 R DPSQQELPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3000.3000.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 3063 1729 1 0 1 597.8261 1193.6377 2 1193.6404 -0.0028 1 40.89 0.00015 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2888.2888.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 3065 1721 1 0 1 398.8878 1193.6415 3 1193.6404 0.0011 1 16.39 0.031 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2880.2880.3.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 3856 3842 1 0 1 651.8395 1301.6644 2 1301.6649 -0.0005 0 53.77 9.80E-05 R AALQEELQLCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5246.5246.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 4362 5090 1 0 1 693.8772 1385.7398 2 1385.7402 -0.0003 0 90.14 2.40E-08 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6540.6540.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 4499 4329 1 0 1 704.8657 1407.7168 2 1407.718 -0.0013 0 28.82 0.0024 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5767.5767.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 4580 4714 1 0 1 713.8876 1425.7606 2 1425.765 -0.0044 0 47.41 8.10E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6159.6159.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 4690 4026 1 0 1 721.8865 1441.7584 2 1441.7599 -0.0015 0 53.91 2.90E-05 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5445.5445.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 4844 4207 1 0 1 735.3535 1468.6925 2 1468.6947 -0.0022 0 79.81 1.70E-07 R FPQLDSTSFANSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5639.5639.2.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 4994 2655 1 0 1 499.2789 1494.815 3 1494.8154 -0.0004 1 27.13 0.0029 R RQQEQQVPILEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3960.3960.3.dta 2 IPI00793768.1 Protein 429 133622 15 15 13 13 5490 3270 1 0 1 807.4131 1612.8116 2 1612.8169 -0.0053 0 65.37 7.40E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4627.4627.2.dta 2 IPI00795589.1 73 kDa protein 204 73882 7 7 6 6 1876 5383 1 0 1 498.3285 994.6424 2 994.6426 -0.0003 0 24.88 0.0039 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6835.6835.2.dta 2 IPI00795589.1 73 kDa protein 204 73882 7 7 6 6 2152 2889 1 0 1 519.7645 1037.5145 2 1037.5142 0.0003 0 45.45 0.00018 K YSGTLNLDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4214.4214.2.dta 2 IPI00795589.1 73 kDa protein 204 73882 7 7 6 6 4499 4329 1 0 1 704.8657 1407.7168 2 1407.718 -0.0013 0 28.82 0.0024 R LSIPTYGLQCTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5767.5767.2.dta 2 IPI00795589.1 73 kDa protein 204 73882 7 7 6 6 4580 4714 1 0 1 713.8876 1425.7606 2 1425.765 -0.0044 0 47.41 8.10E-05 R SLLVNPEGPTLMR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6159.6159.2.dta 2 IPI00795589.1 73 kDa protein 204 73882 7 7 6 6 4690 4026 1 0 1 721.8865 1441.7584 2 1441.7599 -0.0015 0 53.91 2.90E-05 R SLLVNPEGPTLMR L Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5445.5445.2.dta 2 IPI00795589.1 73 kDa protein 204 73882 7 7 6 6 5490 3270 1 0 1 807.4131 1612.8116 2 1612.8169 -0.0053 0 65.37 7.40E-07 K EDGLAQQQTQLNLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4627.4627.2.dta 2 IPI00795589.1 73 kDa protein 204 73882 7 7 6 6 5580 5117 1 0 1 811.9719 1621.9292 2 1621.9291 0.0001 0 44.79 0.00011 K VVVQVLAEEPEAVLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6568.6568.2.dta 2 IPI00792768.1 27 kDa protein 195 27705 6 6 5 5 766 162 1 0 1 407.7029 813.3912 2 813.3916 -0.0003 0 18.27 0.019 R CLATHGR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1178.1178.2.dta 2 IPI00792768.1 27 kDa protein 195 27705 6 6 5 5 2152 2889 1 0 1 519.7645 1037.5145 2 1037.5142 0.0003 0 45.45 0.00018 K YSGTLNLDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4214.4214.2.dta 2 IPI00792768.1 27 kDa protein 195 27705 6 6 5 5 3063 1729 1 0 1 597.8261 1193.6377 2 1193.6404 -0.0028 1 40.89 0.00015 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2888.2888.2.dta 2 IPI00792768.1 27 kDa protein 195 27705 6 6 5 5 3065 1721 1 0 1 398.8878 1193.6415 3 1193.6404 0.0011 1 16.39 0.031 R VFTTVGSAEKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2880.2880.3.dta 2 IPI00792768.1 27 kDa protein 195 27705 6 6 5 5 4362 5090 1 0 1 693.8772 1385.7398 2 1385.7402 -0.0003 0 90.14 2.40E-08 K GVDLVLNSLAEEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6540.6540.2.dta 2 IPI00792768.1 27 kDa protein 195 27705 6 6 5 5 4844 4207 1 0 1 735.3535 1468.6925 2 1468.6947 -0.0022 0 79.81 1.70E-07 R FPQLDSTSFANSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5639.5639.2.dta 2 IPI00795588.1 Protein 25 25373 1 1 1 1 1876 5383 1 0 1 498.3285 994.6424 2 994.6426 -0.0003 0 24.88 0.0039 R VLEALLPLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6835.6835.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 1895 4735 1 1 1 500.2518 998.489 2 998.4893 -0.0003 1 27.87 0.0092 R HGDSVRNSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.618.618.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 2129 2353 1 1 1 517.2608 1032.5071 2 1032.5087 -0.0017 0 47.75 0.00011 R TLLEGEESR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3613.3613.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 2471 417 1 1 1 546.7543 1091.4941 2 1091.4956 -0.0015 0 111.87 7.90E-11 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1453.1453.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 2472 575 1 1 1 546.7546 1091.4947 2 1091.4956 -0.0009 0 46.55 0.00027 R GSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1625.1625.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 2950 447 1 1 1 588.3005 1174.5864 2 1174.5942 -0.0078 1 27.02 0.0074 R VDQLKSDQSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1486.1486.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 2971 3304 1 1 1 590.304 1178.5935 2 1178.5931 0.0004 0 51.34 0.00017 K YEELQITAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4664.4664.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 3857 2704 1 1 1 651.8528 1301.691 2 1301.6939 -0.0029 1 24.97 0.0069 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4013.4013.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 3858 2695 1 1 1 434.9049 1301.6929 3 1301.6939 -0.001 1 24.02 0.037 R NSKIEISELNR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4004.4004.3.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 3859 6260 1 1 1 651.8602 1301.7059 2 1301.7078 -0.0019 0 33.11 0.00079 R SLDLDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7735.7735.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 4087 1568 1 1 1 670.8373 1339.66 2 1339.6619 -0.0019 1 66.4 1.90E-06 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2714.2714.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 4088 1571 1 1 1 447.5612 1339.6619 3 1339.6619 0 1 34.01 0.00065 K SKAEAESLYQSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2717.2717.3.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 4340 4981 1 1 1 692.3481 1382.6816 2 1382.683 -0.0014 0 53.92 8.60E-05 K SLNNQFASFIDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6429.6429.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 4407 2651 1 1 1 465.248 1392.7222 3 1392.7249 -0.0026 1 39.93 0.00068 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3956.3956.3.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 4408 2657 1 1 1 697.3686 1392.7226 2 1392.7249 -0.0022 1 72.44 2.60E-07 R TNAENEFVTIKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3963.3963.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 4914 3090 1 1 0 738.3975 1474.7805 2 1474.778 0.0025 0 79.41 2.20E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4432.4432.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 5816 3583 1 1 1 829.3975 1656.7804 2 1656.7856 -0.0052 0 61.41 3.90E-06 R SGGGFSSGSAGIINYQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4966.4966.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 6146 3679 1 1 1 858.928 1715.8415 2 1715.8438 -0.0023 0 81.71 2.20E-08 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5070.5070.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 6147 3683 1 1 1 572.9558 1715.8456 3 1715.8438 0.0018 0 33.62 0.00077 K QISNLQQSISDAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5074.5074.3.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 6298 3288 1 1 1 883.3702 1764.7259 2 1764.7275 -0.0016 0 64.11 9.50E-07 R FSSCGGGGGSFGAGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4646.4646.2.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 6901 287 1 1 1 693.9763 2078.9069 3 2078.9075 -0.0005 1 40.37 0.00039 R GGSGGGGGGSSGGRGSGGGSSGGSIGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1312.1312.3.dta 3 1 IPI00220327.3 "Keratin, type II cytoskeletal 1" 682 66149 21 21 16 16 7111 1542 1 1 1 795.3215 2382.9426 3 2382.9447 -0.0021 0 53.04 5.00E-06 R GGGGGGYGSGGSSYGSGGGSYGSGGGGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2686.2686.3.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 2147 3341 1 0 1 519.2665 1036.5184 2 1036.5189 -0.0005 0 66.06 4.00E-06 R YLDGLTAER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4704.4704.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 2540 2006 1 0 0 554.2718 1106.5291 2 1106.5356 -0.0065 0 56.97 2.50E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3191.3191.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 3081 1053 1 0 1 599.2777 1196.5409 2 1196.5422 -0.0013 0 55.45 6.30E-06 K GGSISGGGYGSGGGK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2144.2144.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 3184 3682 1 0 1 604.8126 1207.6106 2 1207.6085 0.0021 0 29.9 0.0016 R TAAENDFVTLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5073.5073.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 3494 2133 1 0 1 627.807 1253.5995 2 1253.6001 -0.0006 0 102.33 1.00E-09 R GFSSGSAVVSGGSR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3349.3349.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 3975 2230 1 0 1 660.7938 1319.5731 2 1319.5756 -0.0025 0 88.61 4.90E-09 R HGGGGGGFGGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3459.3459.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 3976 2225 1 0 1 440.8659 1319.5759 3 1319.5756 0.0003 0 51.34 5.40E-05 R HGGGGGGFGGGGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3454.3454.3.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 4394 1284 1 0 1 464.5647 1390.6723 3 1390.6728 -0.0005 1 34.06 0.0019 R SKEEAEALYHSK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2405.2405.3.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 4914 3090 1 0 0 738.3975 1474.7805 2 1474.778 0.0025 0 79.41 2.20E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4432.4432.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 5415 619 1 0 1 794.8451 1587.6756 2 1587.6761 -0.0005 0 68.9 5.80E-07 R GGSSSGGGYGSGGGGSSSVK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1673.1673.2.dta 3 2 IPI00021304.1 "Keratin, type II cytoskeletal 2 epidermal" 499 66110 15 15 13 13 7252 1642 1 0 1 834.361 2500.0612 3 2500.06 0.0013 1 22.15 0.02 K AAFGGSGGRGSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2794.2794.3.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 143 171 1 0 1 322.229 642.4435 2 642.4428 0.0006 1 33.59 0.0012 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1188.1188.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 156 6948 1 0 1 323.6982 645.3819 2 645.381 0.0009 1 29.41 0.033 K KIETR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.884.884.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 1346 662 1 0 1 456.2146 910.4146 2 910.4145 0.0002 0 20.78 0.012 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1720.1720.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 1906 3322 1 0 1 500.7872 999.5599 2 999.56 -0.0002 0 42.02 0.00098 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4683.4683.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 2686 4046 1 0 1 565.3138 1128.6131 2 1128.6138 -0.0007 0 93.56 1.10E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5467.5467.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 2940 2901 1 0 1 587.3228 1172.6311 2 1172.6289 0.0022 0 41.04 0.00086 K LVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4227.4227.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 3979 5671 1 0 1 660.839 1319.6634 2 1319.6642 -0.0008 0 48.92 4.00E-05 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7128.7128.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 4095 2537 1 0 1 671.3799 1340.7452 2 1340.7412 0.004 1 59.63 9.90E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3824.3824.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 4106 4391 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 76.45 9.20E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5831.5831.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 4107 4396 1 0 1 448.8966 1343.6679 3 1343.6681 -0.0002 0 35.91 0.0021 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5836.5836.3.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 4533 5827 1 0 1 710.3768 1418.7391 2 1418.7405 -0.0014 0 22.18 0.0083 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7286.7286.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 4860 3014 1 0 1 737.3922 1472.7698 2 1472.7722 -0.0025 1 55.15 5.30E-05 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4349.4349.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 4861 3056 1 0 1 737.395 1472.7755 2 1472.7722 0.0033 1 41.36 0.00033 R DGKLVSESSDVLPK - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4395.4395.2.dta 3 3 IPI00554648.3 "Keratin, type II cytoskeletal 8" 388 53671 17 17 14 14 5000 3513 1 0 1 499.5935 1495.7586 3 1495.7592 -0.0006 1 16.03 0.031 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4890.4890.3.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 2540 2006 1 0 0 554.2718 1106.5291 2 1106.5356 -0.0065 0 56.97 2.50E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3191.3191.2.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 4158 2844 1 0 1 675.8673 1349.7201 2 1349.7191 0.001 1 26.56 0.0047 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4165.4165.2.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 4495 5629 1 0 1 704.3586 1406.7027 2 1406.7041 -0.0014 0 52.7 1.50E-05 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7085.7085.2.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 4567 2568 1 0 1 712.8185 1423.6225 2 1423.6263 -0.0038 0 81.48 4.30E-08 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3862.3862.2.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 4712 3105 1 0 1 724.3918 1446.7691 2 1446.7678 0.0013 0 78.14 1.30E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4448.4448.2.dta 3 4 IPI00299145.9 "Keratin, type II cytoskeletal 6E" 300 60273 11 11 10 10 5444 3292 1 0 1 799.8826 1597.7506 2 1597.7519 -0.0013 0 44.94 0.00022 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4651.4651.2.dta 3 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 174 62637 8 8 7 7 1083 950 1 0 1 433.1991 864.3837 2 864.3839 -0.0002 0 69.74 4.50E-07 R SGGGGGGGFGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2032.2032.2.dta 3 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 174 62637 8 8 7 7 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 174 62637 8 8 7 7 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 174 62637 8 8 7 7 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 174 62637 8 8 7 7 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 174 62637 8 8 7 7 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 174 62637 8 8 7 7 3058 1778 1 0 1 597.7901 1193.5656 2 1193.5676 -0.002 0 25.55 0.004 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2940.2940.2.dta 3 5 IPI00009867.2 "Keratin, type II cytoskeletal 5" 174 62637 8 8 7 7 4504 3079 1 0 1 705.8439 1409.6733 2 1409.6722 0.0011 0 51.35 1.50E-05 R VSLAGACGVGGYGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4420.4420.2.dta 3 6 IPI00306959.10 "Keratin, type II cytoskeletal 7" 124 51443 6 6 4 4 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 6 IPI00306959.10 "Keratin, type II cytoskeletal 7" 124 51443 6 6 4 4 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 6 IPI00306959.10 "Keratin, type II cytoskeletal 7" 124 51443 6 6 4 4 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 6 IPI00306959.10 "Keratin, type II cytoskeletal 7" 124 51443 6 6 4 4 4351 2762 1 0 1 693.3726 1384.7307 2 1384.731 -0.0003 1 34.82 0.00054 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4076.4076.2.dta 3 6 IPI00306959.10 "Keratin, type II cytoskeletal 7" 124 51443 6 6 4 4 4352 2773 1 0 1 462.5844 1384.7314 3 1384.731 0.0004 1 18.8 0.038 R AKQEELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4088.4088.3.dta 3 6 IPI00306959.10 "Keratin, type II cytoskeletal 7" 124 51443 6 6 4 4 4528 5424 1 0 1 709.8663 1417.7181 2 1417.7201 -0.002 0 68.83 9.50E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6878.6878.2.dta 3 7 IPI00418471.6 Vimentin 107 53676 3 3 3 3 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 7 IPI00418471.6 Vimentin 107 53676 3 3 3 3 4584 3027 1 0 1 714.8596 1427.7047 2 1427.7045 0.0002 0 85.44 9.70E-09 R SLYASSPGGVYATR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4364.4364.2.dta 3 7 IPI00418471.6 Vimentin 107 53676 3 3 3 3 6321 3018 1 0 1 592.9591 1775.8555 3 1775.855 0.0005 1 24.96 0.011 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4354.4354.3.dta 3 IPI00816709.1 Keratin 6C 264 60245 8 8 8 8 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 IPI00816709.1 Keratin 6C 264 60245 8 8 8 8 2540 2006 1 0 0 554.2718 1106.5291 2 1106.5356 -0.0065 0 56.97 2.50E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3191.3191.2.dta 3 IPI00816709.1 Keratin 6C 264 60245 8 8 8 8 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 IPI00816709.1 Keratin 6C 264 60245 8 8 8 8 4158 2844 1 0 1 675.8673 1349.7201 2 1349.7191 0.001 1 26.56 0.0047 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4165.4165.2.dta 3 IPI00816709.1 Keratin 6C 264 60245 8 8 8 8 4495 5629 1 0 1 704.3586 1406.7027 2 1406.7041 -0.0014 0 52.7 1.50E-05 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7085.7085.2.dta 3 IPI00816709.1 Keratin 6C 264 60245 8 8 8 8 4567 2568 1 0 1 712.8185 1423.6225 2 1423.6263 -0.0038 0 81.48 4.30E-08 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3862.3862.2.dta 3 IPI00816709.1 Keratin 6C 264 60245 8 8 8 8 4712 3105 1 0 1 724.3918 1446.7691 2 1446.7678 0.0013 0 78.14 1.30E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4448.4448.2.dta 3 IPI00816709.1 Keratin 6C 264 60245 8 8 8 8 5444 3292 1 0 1 799.8826 1597.7506 2 1597.7519 -0.0013 0 44.94 0.00022 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4651.4651.2.dta 3 IPI00793917.1 27 kDa protein 255 26765 7 7 6 6 1906 3322 1 0 1 500.7872 999.5599 2 999.56 -0.0002 0 42.02 0.00098 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4683.4683.2.dta 3 IPI00793917.1 27 kDa protein 255 26765 7 7 6 6 2686 4046 1 0 1 565.3138 1128.6131 2 1128.6138 -0.0007 0 93.56 1.10E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5467.5467.2.dta 3 IPI00793917.1 27 kDa protein 255 26765 7 7 6 6 3979 5671 1 0 1 660.839 1319.6634 2 1319.6642 -0.0008 0 48.92 4.00E-05 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7128.7128.2.dta 3 IPI00793917.1 27 kDa protein 255 26765 7 7 6 6 4095 2537 1 0 1 671.3799 1340.7452 2 1340.7412 0.004 1 59.63 9.90E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3824.3824.2.dta 3 IPI00793917.1 27 kDa protein 255 26765 7 7 6 6 4106 4391 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 76.45 9.20E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5831.5831.2.dta 3 IPI00793917.1 27 kDa protein 255 26765 7 7 6 6 4107 4396 1 0 1 448.8966 1343.6679 3 1343.6681 -0.0002 0 35.91 0.0021 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5836.5836.3.dta 3 IPI00793917.1 27 kDa protein 255 26765 7 7 6 6 4533 5827 1 0 1 710.3768 1418.7391 2 1418.7405 -0.0014 0 22.18 0.0083 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7286.7286.2.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 2540 2006 1 0 0 554.2718 1106.5291 2 1106.5356 -0.0065 0 56.97 2.50E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3191.3191.2.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 4158 2844 1 0 1 675.8673 1349.7201 2 1349.7191 0.001 1 26.56 0.0047 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4165.4165.2.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 4495 5629 1 0 1 704.3586 1406.7027 2 1406.7041 -0.0014 0 52.7 1.50E-05 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7085.7085.2.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 4567 2568 1 0 1 712.8185 1423.6225 2 1423.6263 -0.0038 0 81.48 4.30E-08 R GSGGLGGACGGAGFGSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3862.3862.2.dta 3 IPI00293665.7 "Keratin, type II cytoskeletal 6B" 243 60247 10 10 9 9 5444 3292 1 0 1 799.8826 1597.7506 2 1597.7519 -0.0013 0 44.94 0.00022 R ISIGGGSCAISGGYGSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4651.4651.2.dta 3 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 227 47891 7 7 6 6 143 171 1 0 1 322.229 642.4435 2 642.4428 0.0006 1 33.59 0.0012 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1188.1188.2.dta 3 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 227 47891 7 7 6 6 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 227 47891 7 7 6 6 2686 4046 1 0 1 565.3138 1128.6131 2 1128.6138 -0.0007 0 93.56 1.10E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5467.5467.2.dta 3 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 227 47891 7 7 6 6 3979 5671 1 0 1 660.839 1319.6634 2 1319.6642 -0.0008 0 48.92 4.00E-05 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7128.7128.2.dta 3 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 227 47891 7 7 6 6 4106 4391 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 76.45 9.20E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5831.5831.2.dta 3 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 227 47891 7 7 6 6 4107 4396 1 0 1 448.8966 1343.6679 3 1343.6681 -0.0002 0 35.91 0.0021 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5836.5836.3.dta 3 IPI00787323.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 2" 227 47891 7 7 6 6 4533 5827 1 0 1 710.3768 1418.7391 2 1418.7405 -0.0014 0 22.18 0.0083 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7286.7286.2.dta 3 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 215 30826 6 6 5 5 143 171 1 0 1 322.229 642.4435 2 642.4428 0.0006 1 33.59 0.0012 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1188.1188.2.dta 3 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 215 30826 6 6 5 5 2686 4046 1 0 1 565.3138 1128.6131 2 1128.6138 -0.0007 0 93.56 1.10E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5467.5467.2.dta 3 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 215 30826 6 6 5 5 3979 5671 1 0 1 660.839 1319.6634 2 1319.6642 -0.0008 0 48.92 4.00E-05 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7128.7128.2.dta 3 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 215 30826 6 6 5 5 4106 4391 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 76.45 9.20E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5831.5831.2.dta 3 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 215 30826 6 6 5 5 4107 4396 1 0 1 448.8966 1343.6679 3 1343.6681 -0.0002 0 35.91 0.0021 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5836.5836.3.dta 3 IPI00787392.1 "similar to Keratin, type II cytoskeletal 8 (Cytokeratin-8) (CK-8) (Keratin-8) (K8) isoform 1" 215 30826 6 6 5 5 4533 5827 1 0 1 710.3768 1418.7391 2 1418.7405 -0.0014 0 22.18 0.0083 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7286.7286.2.dta 3 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 191 42557 7 7 7 7 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 191 42557 7 7 7 7 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 191 42557 7 7 7 7 2540 2006 1 0 0 554.2718 1106.5291 2 1106.5356 -0.0065 0 56.97 2.50E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3191.3191.2.dta 3 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 191 42557 7 7 7 7 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 191 42557 7 7 7 7 4158 2844 1 0 1 675.8673 1349.7201 2 1349.7191 0.001 1 26.56 0.0047 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4165.4165.2.dta 3 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 191 42557 7 7 7 7 4495 5629 1 0 1 704.3586 1406.7027 2 1406.7041 -0.0014 0 52.7 1.50E-05 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7085.7085.2.dta 3 IPI00386438.2 "Keratin, type II cytoskeletal 6D (Fragment)" 191 42557 7 7 7 7 4712 3105 1 0 1 724.3918 1446.7691 2 1446.7678 0.0013 0 78.14 1.30E-07 R AIGGGLSSVGGGSSTIK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4448.4448.2.dta 3 IPI00795725.1 17 kDa protein 187 16798 6 6 5 5 1906 3322 1 0 1 500.7872 999.5599 2 999.56 -0.0002 0 42.02 0.00098 R LQAEIEGLK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4683.4683.2.dta 3 IPI00795725.1 17 kDa protein 187 16798 6 6 5 5 3979 5671 1 0 1 660.839 1319.6634 2 1319.6642 -0.0008 0 48.92 4.00E-05 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7128.7128.2.dta 3 IPI00795725.1 17 kDa protein 187 16798 6 6 5 5 4095 2537 1 0 1 671.3799 1340.7452 2 1340.7412 0.004 1 59.63 9.90E-06 R LQAEIEGLKGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3824.3824.2.dta 3 IPI00795725.1 17 kDa protein 187 16798 6 6 5 5 4106 4391 1 0 1 672.8411 1343.6676 2 1343.6681 -0.0005 0 76.45 9.20E-08 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5831.5831.2.dta 3 IPI00795725.1 17 kDa protein 187 16798 6 6 5 5 4107 4396 1 0 1 448.8966 1343.6679 3 1343.6681 -0.0002 0 35.91 0.0021 R ASLEAAIADAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5836.5836.3.dta 3 IPI00795725.1 17 kDa protein 187 16798 6 6 5 5 4533 5827 1 0 1 710.3768 1418.7391 2 1418.7405 -0.0014 0 22.18 0.0083 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7286.7286.2.dta 3 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 106 23165 2 2 2 2 143 171 1 0 1 322.229 642.4435 2 642.4428 0.0006 1 33.59 0.0012 R AVVVKK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1188.1188.2.dta 3 IPI00215804.4 "similar to Keratin, type II cytoskeletal 8" 106 23165 2 2 2 2 2686 4046 1 0 1 565.3138 1128.6131 2 1128.6138 -0.0007 0 93.56 1.10E-08 K LSELEAALQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5467.5467.2.dta 3 IPI00376379.3 Keratin 77 100 62050 3 3 2 2 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00376379.3 Keratin 77 100 62050 3 3 2 2 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00376379.3 Keratin 77 100 62050 3 3 2 2 4914 3090 1 0 0 738.3975 1474.7805 2 1474.778 0.0025 0 79.41 2.20E-07 R FLEQQNQVLQTK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4432.4432.2.dta 3 IPI00796330.1 18 kDa protein 99 18135 3 3 3 3 2540 2006 1 0 0 554.2718 1106.5291 2 1106.5356 -0.0065 0 56.97 2.50E-05 K AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3191.3191.2.dta 3 IPI00796330.1 18 kDa protein 99 18135 3 3 3 3 4158 2844 1 0 1 675.8673 1349.7201 2 1349.7191 0.001 1 26.56 0.0047 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4165.4165.2.dta 3 IPI00796330.1 18 kDa protein 99 18135 3 3 3 3 4495 5629 1 0 1 704.3586 1406.7027 2 1406.7041 -0.0014 0 52.7 1.50E-05 K ADTLTDEINFLR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7085.7085.2.dta 3 IPI00792642.1 25 kDa protein 96 24809 6 6 5 5 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00792642.1 25 kDa protein 96 24809 6 6 5 5 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00792642.1 25 kDa protein 96 24809 6 6 5 5 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00792642.1 25 kDa protein 96 24809 6 6 5 5 3979 5671 1 0 1 660.839 1319.6634 2 1319.6642 -0.0008 0 48.92 4.00E-05 R SLDMDSIIAEVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7128.7128.2.dta 3 IPI00792642.1 25 kDa protein 96 24809 6 6 5 5 4533 5827 1 0 1 710.3768 1418.7391 2 1418.7405 -0.0014 0 22.18 0.0083 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7286.7286.2.dta 3 IPI00792642.1 25 kDa protein 96 24809 6 6 5 5 5000 3513 1 0 1 499.5935 1495.7586 3 1495.7592 -0.0006 1 16.03 0.031 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4890.4890.3.dta 3 IPI00005859.2 Keratin-75 78 59809 5 5 4 4 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00005859.2 Keratin-75 78 59809 5 5 4 4 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 IPI00005859.2 Keratin-75 78 59809 5 5 4 4 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00005859.2 Keratin-75 78 59809 5 5 4 4 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00005859.2 Keratin-75 78 59809 5 5 4 4 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 IPI00792167.1 9 kDa protein 69 8852 1 1 1 1 4528 5424 1 0 1 709.8663 1417.7181 2 1417.7201 -0.002 0 68.83 9.50E-07 K VDALNDEINFLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6878.6878.2.dta 3 IPI00290857.2 "Keratin, type II cytoskeletal 3" 66 64636 4 4 3 3 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00290857.2 "Keratin, type II cytoskeletal 3" 66 64636 4 4 3 3 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00290857.2 "Keratin, type II cytoskeletal 3" 66 64636 4 4 3 3 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00290857.2 "Keratin, type II cytoskeletal 3" 66 64636 4 4 3 3 4158 2844 1 0 1 675.8673 1349.7201 2 1349.7191 0.001 1 26.56 0.0047 R TAAENEFVTLKK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4165.4165.2.dta 3 IPI00174775.2 Keratin 6 irs3 66 59457 4 4 3 3 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 IPI00174775.2 Keratin 6 irs3 66 59457 4 4 3 3 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00174775.2 Keratin 6 irs3 66 59457 4 4 3 3 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00174775.2 Keratin 6 irs3 66 59457 4 4 3 3 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 IPI00791912.1 22 kDa protein 63 22195 5 5 4 4 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00791912.1 22 kDa protein 63 22195 5 5 4 4 1346 662 1 0 1 456.2146 910.4146 2 910.4145 0.0002 0 20.78 0.012 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1720.1720.2.dta 3 IPI00791912.1 22 kDa protein 63 22195 5 5 4 4 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00791912.1 22 kDa protein 63 22195 5 5 4 4 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00791912.1 22 kDa protein 63 22195 5 5 4 4 5000 3513 1 0 1 499.5935 1495.7586 3 1495.7592 -0.0006 1 16.03 0.031 R TEMENEFVLIKK - Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4890.4890.3.dta 3 IPI00791341.1 20 kDa protein 62 19686 4 4 3 3 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00791341.1 20 kDa protein 62 19686 4 4 3 3 1346 662 1 0 1 456.2146 910.4146 2 910.4145 0.0002 0 20.78 0.012 R SYTSGPGSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1720.1720.2.dta 3 IPI00791341.1 20 kDa protein 62 19686 4 4 3 3 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00791341.1 20 kDa protein 62 19686 4 4 3 3 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00166205.2 Keratin-78 58 57728 3 3 3 3 18 341 2 0 1 301.1747 600.3348 2 600.3343 0.0005 0 36.16 0.0048 K QNLAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1371.1371.2.dta 3 IPI00166205.2 Keratin-78 58 57728 3 3 3 3 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00166205.2 Keratin-78 58 57728 3 3 3 3 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 R LLEGEECR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 IPI00241841.8 keratin 6L 58 58085 3 3 2 2 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00241841.8 keratin 6L 58 58085 3 3 2 2 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00241841.8 keratin 6L 58 58085 3 3 2 2 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00290078.5 keratin 4 57 64442 1 1 1 1 2540 2006 1 0 0 554.2718 1106.5291 2 1106.5356 -0.0065 0 56.97 2.50E-05 R AQYEEIAQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3191.3191.2.dta 3 IPI00795197.1 24 kDa protein 51 24107 3 3 3 3 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 IPI00795197.1 24 kDa protein 51 24107 3 3 3 3 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 IPI00795197.1 24 kDa protein 51 24107 3 3 3 3 3058 1778 1 0 1 597.7901 1193.5656 2 1193.5676 -0.002 0 25.55 0.004 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2940.2940.2.dta 3 IPI00061200.3 Keratin-71 44 57769 2 2 1 1 2424 3666 1 0 0 361.5378 1081.5915 3 1081.592 -0.0005 1 23.29 0.013 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5056.5056.3.dta 3 IPI00061200.3 Keratin-71 44 57769 2 2 1 1 2425 3680 1 0 0 541.8035 1081.5925 2 1081.592 0.0005 1 42.11 0.001 K FASFIDKVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5071.5071.2.dta 3 IPI00217437.4 Tau-tubulin kinase 41 185741 2 2 2 2 156 6948 1 0 1 323.6982 645.3819 2 645.381 0.0009 1 29.41 0.033 K KIETR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.884.884.2.dta 3 IPI00217437.4 Tau-tubulin kinase 41 185741 2 2 2 2 1314 1494 1 0 0 453.7375 905.4605 2 905.4607 -0.0001 0 38.11 0.0049 R FLEQQNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2634.2634.2.dta 3 IPI00021751.5 Neurofilament triplet H protein 40 112640 2 2 2 2 1936 1726 1 0 0 503.237 1004.4594 2 1004.4597 -0.0002 0 28.5 0.0021 K LLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2885.2885.2.dta 3 IPI00021751.5 Neurofilament triplet H protein 40 112640 2 2 2 2 2700 1406 1 0 0 567.283 1132.5515 2 1132.5546 -0.0031 1 27.86 0.0076 R KLLEGEECR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2537.2537.2.dta 3 IPI00791554.1 17 kDa protein 38 17100 2 2 1 1 4351 2762 1 0 1 693.3726 1384.7307 2 1384.731 -0.0003 1 34.82 0.00054 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4076.4076.2.dta 3 IPI00791554.1 17 kDa protein 38 17100 2 2 1 1 4352 2773 1 0 1 462.5844 1384.7314 3 1384.731 0.0004 1 18.8 0.038 R AKQEELEAALQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4088.4088.3.dta 3 IPI00793849.1 Protein 26 22010 1 1 1 1 3058 1778 1 0 1 597.7901 1193.5656 2 1193.5676 -0.002 0 25.55 0.004 K YEELQQTAGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2940.2940.2.dta 3 IPI00552689.1 Vimentin 25 20138 1 1 1 1 6321 3018 1 0 1 592.9591 1775.8555 3 1775.855 0.0005 1 24.96 0.011 K FADLSEAANRNNDALR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4354.4354.3.dta 3 IPI00793202.1 14 kDa protein 24 14435 2 2 2 2 4533 5827 1 0 1 710.3768 1418.7391 2 1418.7405 -0.0014 0 22.18 0.0083 R LEGLTDEINFLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7286.7286.2.dta 3 IPI00793202.1 14 kDa protein 24 14435 2 2 2 2 5000 3513 1 0 1 499.5935 1495.7586 3 1495.7592 -0.0006 1 16.03 0.031 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4890.4890.3.dta 3 IPI00791653.1 8 kDa protein 22 7516 1 1 1 1 7252 1642 1 0 1 834.361 2500.0612 3 2500.06 0.0013 1 22.15 0.02 K AAFGGSGGRGSSSGGGYSSGSSSYGSGGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2794.2794.3.dta 3 IPI00748057.2 "Similar to Keratin, type II cytoskeletal 8" 16 11491 1 1 1 1 5000 3513 1 0 1 499.5935 1495.7586 3 1495.7592 -0.0006 1 16.03 0.031 R TEMENEFVLIKK D Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4890.4890.3.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 289 923 1 1 1 348.2139 694.4132 2 694.4126 0.0007 0 28.02 0.0069 R NALIHK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2003.2003.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 383 2296 1 1 1 362.7215 723.4284 2 723.4279 0.0005 0 41.4 0.00031 K LPIEPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3541.3541.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 1504 2457 1 1 1 470.7468 939.4791 2 939.4814 -0.0023 0 45.32 0.00053 R LNQYFQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3729.3729.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 1792 761 1 1 1 493.7582 985.5019 2 985.4981 0.0037 0 32.36 0.0015 R YGDGPRPPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1827.1827.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 2363 2345 1 1 1 538.2804 1074.5462 2 1074.5458 0.0004 0 43.39 0.00011 K LAQFEPSQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3605.3605.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 2828 4065 1 1 1 579.3311 1156.6476 2 1156.6492 -0.0017 0 42.21 0.00011 K VFDPVPVGVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5487.5487.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 2832 5062 1 1 1 579.7736 1157.5326 2 1157.5328 -0.0002 0 40.02 0.0013 K NFLYAWCGK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6513.6513.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 2952 2979 1 1 1 588.3061 1174.5976 2 1174.5982 -0.0006 0 46.11 0.00015 R DVVQAYPEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4312.4312.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 3005 680 1 1 1 593.7833 1185.552 2 1185.5527 -0.0007 0 36.13 0.0015 K YTQVGPDHNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1739.1739.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 3006 667 1 1 1 396.1917 1185.5533 3 1185.5527 0.0006 0 18.97 0.017 K YTQVGPDHNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1725.1725.3.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 3008 2235 1 1 1 593.7974 1185.5803 2 1185.5778 0.0025 1 49 0.00018 R GANLKDYYSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3465.3465.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 3086 1880 1 1 1 599.3148 1196.6151 2 1196.6189 -0.0039 1 52.99 8.60E-05 R LNQYFQKEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3054.3054.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 3672 3638 1 1 1 638.8433 1275.6721 2 1275.6744 -0.0023 0 48.39 5.10E-05 R AAMEALVVEVTK Q Oxidation (M) 0.001000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5025.5025.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 3733 3386 1 1 1 643.3788 1284.7431 2 1284.7442 -0.0011 1 54.99 8.80E-06 R KVFDPVPVGVTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4752.4752.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 3754 3999 1 1 1 644.8556 1287.6966 2 1287.6969 -0.0002 0 70.93 3.40E-07 K LAAQSCALSLVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5416.5416.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 3955 6213 1 1 1 659.3299 1316.6452 2 1316.6441 0.0011 0 14.61 0.043 K YPSPFFVFGEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7686.7686.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 4195 2435 1 1 1 679.3478 1356.681 2 1356.682 -0.001 0 58.49 3.10E-05 R AAECNIVVTQPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3704.3704.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 5021 3151 1 1 1 501.9352 1502.7836 3 1502.7841 -0.0005 0 54.29 8.90E-06 R GISHVIVDEIHER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4498.4498.3.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 5390 4477 1 1 1 790.4236 1578.8327 2 1578.8365 -0.0038 0 58.74 3.30E-06 K QPAIISQLDPVNER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5918.5918.2.dta 4 1 IPI00742905.1 ATP-dependent RNA helicase A 543 147921 20 20 19 19 6221 4861 1 1 1 871.4321 1740.8496 2 1740.853 -0.0034 0 73.82 5.20E-07 R ELDALDANDELTPLGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6306.6306.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 1979 1066 1 1 1 507.2899 1012.5653 2 1012.5665 -0.0012 1 32.72 0.0072 K VKAEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2158.2158.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 1980 1065 1 1 1 338.5297 1012.5673 3 1012.5665 0.0008 1 46.82 0.00023 K VKAEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2157.2157.3.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 2108 2023 1 1 1 515.7296 1029.4446 2 1029.4437 0.0008 0 41.25 0.00028 K SSFTVDCSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3209.3209.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 2391 411 1 1 1 540.2827 1078.5509 2 1078.552 -0.0011 0 55.9 1.40E-05 R VNVGAGSHPNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1447.1447.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 2452 3161 1 1 1 544.7863 1087.558 2 1087.5583 -0.0004 0 61.68 1.50E-05 R TPCEEILVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4509.4509.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 2556 1035 1 1 1 554.8088 1107.603 2 1107.6037 -0.0007 0 36.57 0.00037 R ALTQTGGPHVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2124.2124.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 3287 4000 1 1 1 613.8293 1225.644 2 1225.6455 -0.0015 0 61.79 1.00E-05 R AWGPGLEGGVVGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5417.5417.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 4520 4418 1 1 1 708.377 1414.7395 2 1414.7416 -0.0021 0 69.06 3.30E-07 R IANLQTDLSDGLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5858.5858.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 4594 2742 1 1 1 715.3618 1428.709 2 1428.711 -0.002 0 77.87 5.00E-08 K AFGPGLQGGSAGSPAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4055.4055.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 4622 3438 1 1 1 717.863 1433.7115 2 1433.7151 -0.0035 0 57.12 6.30E-06 R ANLPQSFQVDTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4809.4809.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 4733 2513 1 1 1 725.3554 1448.6963 2 1448.697 -0.0007 0 22.28 0.0081 R AYGPGIEPTGNMVK K Oxidation (M) 0.00000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3797.3797.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 5128 5005 1 1 1 767.4113 1532.8081 2 1532.8086 -0.0005 0 23.13 0.012 K SPFSVAVSPSLDLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6452.6452.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 5759 2908 1 1 1 549.6299 1645.868 3 1645.8675 0.0005 0 28.32 0.0022 K TGVAVNKPAEFTVDAK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4235.4235.3.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 5792 2526 1 1 1 826.9348 1651.855 2 1651.8529 0.002 0 55.93 5.10E-05 K VTAQGPGLEPSGNIANK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3812.3812.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 6290 3145 1 1 1 882.4303 1762.846 2 1762.8486 -0.0025 0 33.08 0.00079 R VANPSGNLTETYVQDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4491.4491.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 6336 3947 1 1 1 892.9456 1783.8767 2 1783.8775 -0.0008 0 62.26 2.30E-06 R VQVQDNEGCPVEALVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5359.5359.2.dta 5 1 IPI00302592.2 "filamin A, alpha" 497 282581 17 17 16 16 6344 825 1 1 1 597.2806 1788.8199 3 1788.8213 -0.0014 0 31.58 0.0011 K ATCAPQHGAPGPGPADASK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1897.1897.3.dta 5 IPI00553169.3 "Filamin A, alpha" 150 28176 4 4 3 3 1979 1066 1 0 1 507.2899 1012.5653 2 1012.5665 -0.0012 1 32.72 0.0072 K VKAEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2158.2158.2.dta 5 IPI00553169.3 "Filamin A, alpha" 150 28176 4 4 3 3 1980 1065 1 0 1 338.5297 1012.5673 3 1012.5665 0.0008 1 46.82 0.00023 K VKAEGPGLSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2157.2157.3.dta 5 IPI00553169.3 "Filamin A, alpha" 150 28176 4 4 3 3 2391 411 1 0 1 540.2827 1078.5509 2 1078.552 -0.0011 0 55.9 1.40E-05 R VNVGAGSHPNK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1447.1447.2.dta 5 IPI00553169.3 "Filamin A, alpha" 150 28176 4 4 3 3 4594 2742 1 0 1 715.3618 1428.709 2 1428.711 -0.002 0 77.87 5.00E-08 K AFGPGLQGGSAGSPAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4055.4055.2.dta 5 IPI00552416.3 "Filamin A, alpha" 57 52192 1 1 1 1 4622 3438 1 0 1 717.863 1433.7115 2 1433.7151 -0.0035 0 57.12 6.30E-06 R ANLPQSFQVDTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4809.4809.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 685 3520 1 1 1 399.7578 797.5011 2 797.5011 0.0001 0 30.48 0.0036 K LTLLNPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4898.4898.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 933 1084 1 1 1 421.1849 840.3552 2 840.3548 0.0004 0 16.2 0.03 R NCGSFTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2177.2177.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 2281 4218 1 1 1 531.2817 1060.5488 2 1060.5488 0 0 29.38 0.0068 K AIVWGMQTR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5651.5651.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 2818 2508 1 1 1 578.2711 1154.5277 2 1154.5278 -0.0001 0 51.6 1.50E-05 K VDATADYICK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3792.3792.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 3433 1604 1 1 1 623.817 1245.6194 2 1245.6214 -0.0021 1 29.27 0.02 R RGGPNYQEGLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2753.2753.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 3434 1613 1 1 1 416.2148 1245.6225 3 1245.6214 0.0011 1 31.24 0.0022 R RGGPNYQEGLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2763.2763.3.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 4258 2525 1 1 1 684.3756 1366.7367 2 1366.7357 0.0009 0 30.61 0.0015 K LYRPGSVAYVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3811.3811.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 4589 3454 1 1 1 714.9006 1427.7866 2 1427.7885 -0.0019 1 65.99 8.10E-07 K NQALKEAGVFVPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4826.4826.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 4936 2950 1 1 1 740.4053 1478.7961 2 1478.798 -0.0019 1 43.52 8.30E-05 K AISEQTGKELLYK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4280.4280.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 4974 4449 1 1 1 746.3607 1490.7069 2 1490.7147 -0.0078 0 89.08 1.90E-08 R SGGMSNELNNIISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5890.5890.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 5020 5199 1 1 1 752.3932 1502.7719 2 1502.7763 -0.0043 0 65.91 2.70E-06 K IGNTGGMLDNILASK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6649.6649.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 5038 3712 1 1 1 754.3612 1506.7079 2 1506.7096 -0.0018 0 75.69 3.50E-07 R SGGMSNELNNIISR T Oxidation (M) 0.00010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5106.5106.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 5076 4162 1 1 1 760.3919 1518.7693 2 1518.7712 -0.0019 0 76.49 7.80E-08 K IGNTGGMLDNILASK L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5592.5592.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 5247 5821 1 1 1 784.3939 1566.7732 2 1566.7752 -0.002 0 32.28 0.00094 K AFDSGIIPMEFVNK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7280.7280.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 5250 5909 1 1 1 784.4558 1566.8971 2 1566.8981 -0.001 0 50.57 3.10E-05 R TIAIIAEGIPEALTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7369.7369.2.dta 6 1 IPI00021290.5 ATP-citrate synthase 472 121674 16 16 13 13 6061 4771 1 1 1 849.3985 1696.7824 2 1696.7831 -0.0007 0 30.39 0.0014 R EAYPEEAYIADLDAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6216.6216.2.dta 6 IPI00794404.1 23 kDa protein 287 23080 6 6 4 4 4258 2525 1 0 1 684.3756 1366.7367 2 1366.7357 0.0009 0 30.61 0.0015 K LYRPGSVAYVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3811.3811.2.dta 6 IPI00794404.1 23 kDa protein 287 23080 6 6 4 4 4974 4449 1 0 1 746.3607 1490.7069 2 1490.7147 -0.0078 0 89.08 1.90E-08 R SGGMSNELNNIISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5890.5890.2.dta 6 IPI00794404.1 23 kDa protein 287 23080 6 6 4 4 5020 5199 1 0 1 752.3932 1502.7719 2 1502.7763 -0.0043 0 65.91 2.70E-06 K IGNTGGMLDNILASK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6649.6649.2.dta 6 IPI00794404.1 23 kDa protein 287 23080 6 6 4 4 5038 3712 1 0 1 754.3612 1506.7079 2 1506.7096 -0.0018 0 75.69 3.50E-07 R SGGMSNELNNIISR T Oxidation (M) 0.00010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5106.5106.2.dta 6 IPI00794404.1 23 kDa protein 287 23080 6 6 4 4 5076 4162 1 0 1 760.3919 1518.7693 2 1518.7712 -0.0019 0 76.49 7.80E-08 K IGNTGGMLDNILASK L Oxidation (M) 0.000000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5592.5592.2.dta 6 IPI00794404.1 23 kDa protein 287 23080 6 6 4 4 5250 5909 1 0 1 784.4558 1566.8971 2 1566.8981 -0.001 0 50.57 3.10E-05 R TIAIIAEGIPEALTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7369.7369.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 270 248 1 1 0 346.1547 690.2948 2 690.2942 0.0007 0 18.51 0.034 R CPVCR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1270.1270.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 1415 4229 1 1 1 464.7766 927.5387 2 927.5389 -0.0002 0 53.86 4.60E-05 K GAIENLLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5663.5663.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 2921 1935 1 1 1 586.3068 1170.599 2 1170.5993 -0.0003 0 63.22 2.30E-06 K TAQGLSPVDQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3114.3114.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 3195 4039 1 1 1 605.8483 1209.682 2 1209.683 -0.001 0 93.8 3.90E-09 K TPGQINLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5459.5459.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 3640 5609 1 1 1 636.8612 1271.7079 2 1271.7085 -0.0006 0 41.76 0.00012 K SLLQQLENVTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7065.7065.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 4177 5273 1 1 1 677.3552 1352.6959 2 1352.6976 -0.0017 0 46.08 5.00E-05 R QIDLVDNYFVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6724.6724.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 4241 1984 1 1 1 683.3198 1364.6251 2 1364.6208 0.0043 0 81.11 2.80E-08 R FNEADSEVAQAGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3167.3167.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 4955 3294 1 1 1 743.4037 1484.7928 2 1484.7947 -0.0019 0 96.25 1.60E-09 K LLQQQNDITGLSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4653.4653.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 5169 4642 1 1 1 772.8715 1543.7285 2 1543.7307 -0.0022 0 76.37 3.10E-07 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6086.6086.2.dta 7 1 IPI00221114.1 Isoform Beta of Transcription intermediary factor 1-gamma 464 122619 10 10 9 9 5170 4903 1 1 1 772.8721 1543.7297 2 1543.7307 -0.001 0 70.82 1.10E-06 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6348.6348.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 2001 4459 1 0 1 508.3234 1014.6323 2 1014.6325 -0.0002 0 47.45 3.70E-05 K VIIDTLITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5900.5900.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 2378 1350 1 0 1 539.2749 1076.5353 2 1076.5363 -0.001 0 54.64 5.80E-05 K FTGNQIQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2477.2477.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 2437 1599 1 0 1 543.3006 1084.5866 2 1084.5876 -0.001 0 39.23 0.002 R IIEVNQNQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2748.2748.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 2451 1153 1 0 1 544.7231 1087.4317 2 1087.4314 0.0003 0 28.02 0.0021 K LYCETCDK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2263.2263.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 3649 4945 1 0 1 637.3655 1272.7164 2 1272.719 -0.0026 0 37.34 0.0022 K FPTQISLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6392.6392.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 3784 1630 1 0 1 646.8137 1291.6129 2 1291.6143 -0.0015 0 43.07 0.00016 K DTTEVPSSTVEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2781.2781.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 4420 870 1 0 1 698.2757 1394.5368 2 1394.5377 -0.0009 0 47.7 3.10E-05 R CPVCSQECAER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1946.1946.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 4783 2631 1 0 1 730.3816 1458.7486 2 1458.75 -0.0014 0 58.91 1.00E-05 K LMQQQQEVAGLSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3931.3931.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 5115 420 1 0 1 510.5809 1528.7208 3 1528.7239 -0.0031 0 16.69 0.032 R LQHMQQQVMAQR Q 2 Oxidation (M) 0.000100001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1456.1456.3.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 5169 4642 1 0 1 772.8715 1543.7285 2 1543.7307 -0.0022 0 76.37 3.10E-07 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6086.6086.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 5170 4903 1 0 1 772.8721 1543.7297 2 1543.7307 -0.001 0 70.82 1.10E-06 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6348.6348.2.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 6878 3841 1 0 1 681.3343 2040.981 3 2040.9833 -0.0023 0 15.57 0.042 R LNLLDTCAVCHQNIQSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5244.5244.3.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 7061 2749 1 0 1 780.0584 2337.1534 3 2337.1561 -0.0026 0 18.84 0.017 K QNPVVEQNSQPPSGLSSNQLSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4062.4062.3.dta 7 2 IPI00005184.1 Isoform Long of Transcription intermediary factor 1-alpha 335 118696 14 14 13 13 7250 2406 1 0 1 833.7283 2498.163 3 2498.1633 -0.0003 0 22.77 0.0073 K AVAAAAAASAAASGGPSAAPSGENEAESR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3672.3672.3.dta 7 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 401 124610 9 9 8 8 270 248 1 0 0 346.1547 690.2948 2 690.2942 0.0007 0 18.51 0.034 R CPVCR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1270.1270.2.dta 7 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 401 124610 9 9 8 8 1415 4229 1 0 1 464.7766 927.5387 2 927.5389 -0.0002 0 53.86 4.60E-05 K GAIENLLAK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5663.5663.2.dta 7 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 401 124610 9 9 8 8 2921 1935 1 0 1 586.3068 1170.599 2 1170.5993 -0.0003 0 63.22 2.30E-06 K TAQGLSPVDQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3114.3114.2.dta 7 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 401 124610 9 9 8 8 3195 4039 1 0 1 605.8483 1209.682 2 1209.683 -0.001 0 93.8 3.90E-09 K TPGQINLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5459.5459.2.dta 7 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 401 124610 9 9 8 8 3640 5609 1 0 1 636.8612 1271.7079 2 1271.7085 -0.0006 0 41.76 0.00012 K SLLQQLENVTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7065.7065.2.dta 7 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 401 124610 9 9 8 8 4177 5273 1 0 1 677.3552 1352.6959 2 1352.6976 -0.0017 0 46.08 5.00E-05 R QIDLVDNYFVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6724.6724.2.dta 7 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 401 124610 9 9 8 8 4955 3294 1 0 1 743.4037 1484.7928 2 1484.7947 -0.0019 0 96.25 1.60E-09 K LLQQQNDITGLSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4653.4653.2.dta 7 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 401 124610 9 9 8 8 5169 4642 1 0 1 772.8715 1543.7285 2 1543.7307 -0.0022 0 76.37 3.10E-07 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6086.6086.2.dta 7 IPI00010252.3 Isoform Alpha of Transcription intermediary factor 1-gamma 401 124610 9 9 8 8 5170 4903 1 0 1 772.8721 1543.7297 2 1543.7307 -0.001 0 70.82 1.10E-06 R YQFLEEAFQNQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6348.6348.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 2001 4459 1 0 1 508.3234 1014.6323 2 1014.6325 -0.0002 0 47.45 3.70E-05 K VIIDTLITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5900.5900.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 2378 1350 1 0 1 539.2749 1076.5353 2 1076.5363 -0.001 0 54.64 5.80E-05 K FTGNQIQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2477.2477.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 2437 1599 1 0 1 543.3006 1084.5866 2 1084.5876 -0.001 0 39.23 0.002 R IIEVNQNQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2748.2748.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 2451 1153 1 0 1 544.7231 1087.4317 2 1087.4314 0.0003 0 28.02 0.0021 K LYCETCDK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2263.2263.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 3649 4945 1 0 1 637.3655 1272.7164 2 1272.719 -0.0026 0 37.34 0.0022 K FPTQISLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6392.6392.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 3784 1630 1 0 1 646.8137 1291.6129 2 1291.6143 -0.0015 0 43.07 0.00016 K DTTEVPSSTVEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2781.2781.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 4420 870 1 0 1 698.2757 1394.5368 2 1394.5377 -0.0009 0 47.7 3.10E-05 R CPVCSQECAER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1946.1946.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 4783 2631 1 0 1 730.3816 1458.7486 2 1458.75 -0.0014 0 58.91 1.00E-05 K LMQQQQEVAGLSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3931.3931.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 5169 4642 1 0 1 772.8715 1543.7285 2 1543.7307 -0.0022 0 76.37 3.10E-07 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6086.6086.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 5170 4903 1 0 1 772.8721 1543.7297 2 1543.7307 -0.001 0 70.82 1.10E-06 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6348.6348.2.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 6878 3841 1 0 1 681.3343 2040.981 3 2040.9833 -0.0023 0 15.57 0.042 R LNLLDTCAVCHQNIQSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5244.5244.3.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 7061 2749 1 0 1 780.0584 2337.1534 3 2337.1561 -0.0026 0 18.84 0.017 K QNPVVEQNSQPPSGLSSNQLSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4062.4062.3.dta 7 IPI00184317.2 Isoform Short of Transcription intermediary factor 1-alpha 333 114885 13 13 12 12 7250 2406 1 0 1 833.7283 2498.163 3 2498.1633 -0.0003 0 22.77 0.0073 K AVAAAAAASAAASGGPSAAPSGENEAESR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3672.3672.3.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 2001 4459 1 0 1 508.3234 1014.6323 2 1014.6325 -0.0002 0 47.45 3.70E-05 K VIIDTLITK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5900.5900.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 2378 1350 1 0 1 539.2749 1076.5353 2 1076.5363 -0.001 0 54.64 5.80E-05 K FTGNQIQNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2477.2477.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 2437 1599 1 0 1 543.3006 1084.5866 2 1084.5876 -0.001 0 39.23 0.002 R IIEVNQNQK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2748.2748.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 2451 1153 1 0 1 544.7231 1087.4317 2 1087.4314 0.0003 0 28.02 0.0021 K LYCETCDK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2263.2263.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 3649 4945 1 0 1 637.3655 1272.7164 2 1272.719 -0.0026 0 37.34 0.0022 K FPTQISLAQLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6392.6392.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 3784 1630 1 0 1 646.8137 1291.6129 2 1291.6143 -0.0015 0 43.07 0.00016 K DTTEVPSSTVEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2781.2781.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 4420 870 1 0 1 698.2757 1394.5368 2 1394.5377 -0.0009 0 47.7 3.10E-05 R CPVCSQECAER H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1946.1946.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 4783 2631 1 0 1 730.3816 1458.7486 2 1458.75 -0.0014 0 58.91 1.00E-05 K LMQQQQEVAGLSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3931.3931.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 5169 4642 1 0 1 772.8715 1543.7285 2 1543.7307 -0.0022 0 76.37 3.10E-07 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6086.6086.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 5170 4903 1 0 1 772.8721 1543.7297 2 1543.7307 -0.001 0 70.82 1.10E-06 R YQFIEEAFQNQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6348.6348.2.dta 7 IPI00444332.1 "CDNA FLJ45687 fis, clone FCBBF3020030, highly similar to Transcription intermediary factor 1-alpha" 323 63509 11 11 10 10 7061 2749 1 0 1 780.0584 2337.1534 3 2337.1561 -0.0026 0 18.84 0.017 K QNPVVEQNSQPPSGLSSNQLSK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4062.4062.3.dta 7 IPI00021885.1 Isoform 1 of Fibrinogen alpha chain precursor 54 95656 1 1 1 1 1415 4229 1 0 1 464.7766 927.5387 2 927.5389 -0.0002 0 53.86 4.60E-05 K QLEQVIAK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5663.5663.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 217 1412 1 1 1 337.6956 673.3766 2 673.3759 0.0007 0 31.68 0.047 R EVASLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2544.2544.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 869 1695 1 1 1 417.7505 833.4865 2 833.4858 0.0007 0 28.41 0.012 K VTSVSTLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2852.2852.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 1426 733 1 1 1 465.7724 929.5302 2 929.5294 0.0008 1 21.07 0.041 R EVASLRQK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1797.1797.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 1672 1195 1 1 1 481.7973 961.58 2 961.5808 -0.0008 1 44.78 6.30E-05 R KVTSVSTLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2309.2309.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 2093 4191 1 1 1 514.7531 1027.4916 2 1027.4909 0.0006 0 30.95 0.0013 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5623.5623.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 2193 3157 1 1 1 522.7503 1043.4861 2 1043.4858 0.0002 0 46.79 4.10E-05 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4504.4504.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 2240 2482 1 1 1 527.7563 1053.4981 2 1053.4992 -0.001 0 41.45 0.00029 K HENEALWR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3762.3762.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 2276 4360 1 1 1 530.8072 1059.5998 2 1059.5998 0 0 58.9 1.70E-05 K LLTDVQLMK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5799.5799.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 2358 2383 1 1 1 538.2588 1074.5031 2 1074.5029 0.0003 0 25.49 0.02 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3646.3646.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 2465 1303 1 1 1 546.2558 1090.497 2 1090.4978 -0.0008 0 62.55 1.50E-06 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2426.2426.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 2922 3667 1 1 1 586.3196 1170.6246 2 1170.6244 0.0002 0 59.13 2.40E-05 R GQEQLLENIK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5057.5057.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 4488 2206 1 1 1 469.5956 1405.7651 3 1405.7664 -0.0013 1 29.82 0.011 K VTSVSTLKSEDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3433.3433.3.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 4489 2211 1 1 1 703.8923 1405.77 2 1405.7664 0.0036 1 55.82 1.70E-05 K VTSVSTLKSEDIK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3439.3439.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 5225 2199 1 1 1 520.9663 1559.8771 3 1559.8784 -0.0013 0 23.36 0.0064 K VVHIEQGGLVKPER D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3426.3426.3.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 5233 3988 1 1 1 782.8456 1563.6767 2 1563.6776 -0.0009 0 59.61 2.60E-06 R DDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5404.5404.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 5234 3986 1 1 1 522.2333 1563.6782 3 1563.6776 0.0005 0 17.31 0.024 R DDTEFQHPCFLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5402.5402.3.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 5495 3550 1 1 1 807.9014 1613.7882 2 1613.7897 -0.0015 0 91.92 2.90E-09 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4930.4930.2.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 5496 3561 1 1 1 538.9372 1613.7898 3 1613.7897 0.0001 0 42.2 0.00016 R ESEPAPASVTALTDAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4942.4942.3.dta 8 1 IPI00024071.1 Isoform Long of Heat shock factor protein 1 457 57510 19 19 14 14 6062 3658 1 1 1 566.6163 1696.827 3 1696.8276 -0.0007 0 35.12 0.0026 K IPLMLNDSGSAHSMPK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5047.5047.3.dta 8 IPI00012878.1 Heat shock factor protein 2 116 60482 4 4 2 2 2093 4191 1 0 1 514.7531 1027.4916 2 1027.4909 0.0006 0 30.95 0.0013 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5623.5623.2.dta 8 IPI00012878.1 Heat shock factor protein 2 116 60482 4 4 2 2 2193 3157 1 0 1 522.7503 1043.4861 2 1043.4858 0.0002 0 46.79 4.10E-05 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4504.4504.2.dta 8 IPI00012878.1 Heat shock factor protein 2 116 60482 4 4 2 2 2358 2383 1 0 1 538.2588 1074.5031 2 1074.5029 0.0003 0 25.49 0.02 K HNNMASFVR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3646.3646.2.dta 8 IPI00012878.1 Heat shock factor protein 2 116 60482 4 4 2 2 2465 1303 1 0 1 546.2558 1090.497 2 1090.4978 -0.0008 0 62.55 1.50E-06 K HNNMASFVR Q Oxidation (M) 0.000100000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2426.2426.2.dta 8 IPI00008456.1 Isoform HSF4B of Heat shock factor protein 4 63 53362 2 2 1 1 2093 4191 1 0 1 514.7531 1027.4916 2 1027.4909 0.0006 0 30.95 0.0013 R QLNMYGFR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5623.5623.2.dta 8 IPI00008456.1 Isoform HSF4B of Heat shock factor protein 4 63 53362 2 2 1 1 2193 3157 1 0 1 522.7503 1043.4861 2 1043.4858 0.0002 0 46.79 4.10E-05 R QLNMYGFR K Oxidation (M) 0.00010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4504.4504.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 62 1819 1 1 0 308.6927 615.3709 2 615.3704 0.0006 0 37.23 0.014 K SQLLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2988.2988.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 999 3854 1 1 1 423.2584 844.5023 2 844.5018 0.0005 0 49.9 0.00019 R TLETLIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5259.5259.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 1055 946 1 1 1 430.2446 858.4746 2 858.4745 0.0001 0 31.46 0.017 K CSLVRPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2028.2028.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 1380 2201 1 1 1 461.2609 920.5072 2 920.508 -0.0008 0 42.72 0.00029 R VQVVGTYR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3428.3428.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 1444 5961 1 1 1 466.7814 931.5483 2 931.5491 -0.0008 0 38.11 0.00087 K VALLDVFR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7420.7420.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 1539 2113 1 1 1 473.2247 944.4348 2 944.4352 -0.0004 0 55.36 2.50E-05 K GGYTSGTFR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3323.3323.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 1763 2552 1 1 1 490.2538 978.4931 2 978.4957 -0.0026 0 45.03 0.00011 R YVLCTAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3842.3842.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 2019 2955 1 1 1 509.2913 1016.568 2 1016.5688 -0.0009 0 38.34 0.0032 R TVLIACNVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4286.4286.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 2135 853 1 1 1 345.5181 1033.5324 3 1033.5305 0.0019 0 32.51 0.0022 K HDNLLHGTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1927.1927.3.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 2243 4317 1 1 1 528.3143 1054.614 2 1054.6135 0.0005 0 50.52 6.70E-05 R LIVNVNDLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5754.5754.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 2727 2534 1 1 1 569.2814 1136.5482 2 1136.5462 0.002 0 44.32 0.00045 R ELISDNQYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3820.3820.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 2879 3938 1 1 1 582.8168 1163.619 2 1163.6186 0.0004 1 55.44 5.20E-05 R SKDIFDQLAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5350.5350.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 3028 427 1 1 1 595.8022 1189.5898 2 1189.5914 -0.0016 1 19.95 0.023 R SVHYCPATKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1464.1464.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 3029 423 1 1 1 397.538 1189.5921 3 1189.5914 0.0007 1 33.87 0.0024 R SVHYCPATKK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1460.1460.3.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 4301 3643 1 1 1 689.3493 1376.6841 2 1376.6871 -0.003 0 87.73 3.50E-08 R CSVLAAANPVYGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5031.5031.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 4305 3426 1 1 1 689.827 1377.6395 2 1377.6412 -0.0017 0 33.75 0.00068 K DAQPSFSAEDIAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4796.4796.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 4400 2372 1 1 1 464.9122 1391.7147 3 1391.7157 -0.001 1 33.14 0.00088 K VRELISDNQYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3634.3634.3.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 4703 4908 1 1 1 723.3707 1444.7268 2 1444.7297 -0.0029 0 51.85 0.0001 R SVDVILDDDLVDK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6354.6354.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 4842 110 1 1 1 490.5598 1468.6576 3 1468.6576 0 1 23.2 0.0067 R LRSQDSMSSDTAR T Oxidation (M) 0.0000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1121.1121.3.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 5098 5756 1 1 1 762.9348 1523.8551 2 1523.8559 -0.0008 0 43.59 8.20E-05 R GDINILLIGDPSVAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7215.7215.2.dta 9 1 IPI00013214.1 DNA replication licensing factor MCM3 455 91551 21 21 20 20 6757 3155 1 1 1 645.9796 1934.9168 3 1934.9182 -0.0013 0 21.19 0.011 R GSSGVGLTAAVTTDQETGER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4502.4502.3.dta 9 IPI00385434.2 MCM3 minichromosome maintenance deficient 3 68 37995 3 3 3 3 999 3854 1 0 1 423.2584 844.5023 2 844.5018 0.0005 0 49.9 0.00019 R TLETLIR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5259.5259.2.dta 9 IPI00385434.2 MCM3 minichromosome maintenance deficient 3 68 37995 3 3 3 3 2135 853 1 0 1 345.5181 1033.5324 3 1033.5305 0.0019 0 32.51 0.0022 K HDNLLHGTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1927.1927.3.dta 9 IPI00385434.2 MCM3 minichromosome maintenance deficient 3 68 37995 3 3 3 3 4842 110 1 0 1 490.5598 1468.6576 3 1468.6576 0 1 23.2 0.0067 R LRSQDSMSSDTAR T Oxidation (M) 0.0000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1121.1121.3.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 191 1242 1 1 1 335.2005 668.3864 2 668.3857 0.0007 0 44.34 0.00022 R APGPLSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2360.2360.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 295 51 1 1 1 349.2036 696.3926 2 696.3919 0.0008 0 31.57 0.0055 K HATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1057.1057.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 344 1241 1 1 1 355.1801 708.3456 2 708.3442 0.0013 0 34.49 0.0064 K SAEAFGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2359.2359.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 1214 1229 1 1 1 443.753 885.4915 2 885.492 -0.0005 0 48.51 0.00024 R VLVNDAQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2346.2346.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 1554 5143 1 1 1 474.2744 946.5343 2 946.5343 0 0 30.4 0.0045 K MAILQIMK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6593.6593.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 1642 86 1 1 1 480.2669 958.5193 2 958.5196 -0.0003 1 40.29 0.0015 R QVSDVQKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1095.1095.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 1643 89 1 1 1 320.5139 958.5198 3 958.5196 0.0002 1 22.61 0.02 R QVSDVQKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1098.1098.3.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 1679 4249 1 1 1 482.2715 962.5284 2 962.5293 -0.0009 0 26.41 0.029 K MAILQIMK E Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5683.5683.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 2234 270 1 1 1 526.801 1051.5875 2 1051.5886 -0.0011 1 24.66 0.04 R LRPEREPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1294.1294.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 2567 506 1 1 1 555.8163 1109.6181 2 1109.6193 -0.0012 1 41.1 0.0012 R LGDKHATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1550.1550.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 2624 3065 1 1 1 561.2658 1120.5171 2 1120.5183 -0.0012 0 58.19 2.30E-05 R SGEGEVSGLMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4405.4405.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 3004 5126 1 1 1 593.7815 1185.5484 2 1185.5488 -0.0004 0 31.43 0.0059 K DIVENYFMR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6577.6577.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 3098 4316 1 1 1 600.3403 1198.6661 2 1198.667 -0.0009 0 70.29 1.50E-06 K ADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5753.5753.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 4323 1442 1 1 1 690.8285 1379.6424 2 1379.6463 -0.0039 1 22.12 0.0084 R SRSGEGEVSGLMR K Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2577.2577.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 4324 1436 1 1 1 460.8889 1379.6449 3 1379.6463 -0.0014 1 26.89 0.0064 R SRSGEGEVSGLMR K Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2571.2571.3.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 6338 4049 1 1 1 893.4875 1784.9605 2 1784.9632 -0.0027 1 50.98 1.70E-05 K LTEDKADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5470.5470.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 6394 2108 1 1 1 907.4703 1812.9261 2 1812.933 -0.0069 1 48.63 2.80E-05 R VLVNDAQKVTEGQQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3315.3315.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 6395 2094 1 1 1 605.317 1812.9292 3 1812.933 -0.0038 1 64.43 1.10E-06 R VLVNDAQKVTEGQQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3295.3295.3.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 6579 4341 1 1 1 939.4532 1876.8919 2 1876.8955 -0.0036 0 41.46 0.00028 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5779.5779.2.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 6580 4402 1 1 1 626.6387 1876.8944 3 1876.8955 -0.0012 0 33.93 0.003 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5841.5841.3.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 6854 2269 1 1 1 673.6848 2018.0326 3 2018.0367 -0.0041 0 49.33 3.30E-05 K IVAERPGTNSTGPAPMAPPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3505.3505.3.dta 10 1 IPI00438229.2 Isoform 1 of Transcription intermediary factor 1-beta 448 90261 22 22 16 16 6872 1656 1 1 1 679.0171 2034.0294 3 2034.0316 -0.0022 0 32.58 0.0019 K IVAERPGTNSTGPAPMAPPR A Oxidation (M) 0.00000000000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2809.2809.3.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 191 1242 1 0 1 335.2005 668.3864 2 668.3857 0.0007 0 44.34 0.00022 R APGPLSK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2360.2360.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 295 51 1 0 1 349.2036 696.3926 2 696.3919 0.0008 0 31.57 0.0055 K HATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1057.1057.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 344 1241 1 0 1 355.1801 708.3456 2 708.3442 0.0013 0 34.49 0.0064 K SAEAFGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2359.2359.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 1214 1229 1 0 1 443.753 885.4915 2 885.492 -0.0005 0 48.51 0.00024 R VLVNDAQK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2346.2346.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 1554 5143 1 0 1 474.2744 946.5343 2 946.5343 0 0 30.4 0.0045 K MAILQIMK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6593.6593.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 1642 86 1 0 1 480.2669 958.5193 2 958.5196 -0.0003 1 40.29 0.0015 R QVSDVQKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1095.1095.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 1643 89 1 0 1 320.5139 958.5198 3 958.5196 0.0002 1 22.61 0.02 R QVSDVQKR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1098.1098.3.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 1679 4249 1 0 1 482.2715 962.5284 2 962.5293 -0.0009 0 26.41 0.029 K MAILQIMK E Oxidation (M) 0.10000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5683.5683.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 2234 270 1 0 1 526.801 1051.5875 2 1051.5886 -0.0011 1 24.66 0.04 R LRPEREPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1294.1294.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 2567 506 1 0 1 555.8163 1109.6181 2 1109.6193 -0.0012 1 41.1 0.0012 R LGDKHATLQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1550.1550.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 2624 3065 1 0 1 561.2658 1120.5171 2 1120.5183 -0.0012 0 58.19 2.30E-05 R SGEGEVSGLMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4405.4405.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 3098 4316 1 0 1 600.3403 1198.6661 2 1198.667 -0.0009 0 70.29 1.50E-06 K ADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5753.5753.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 4323 1442 1 0 1 690.8285 1379.6424 2 1379.6463 -0.0039 1 22.12 0.0084 R SRSGEGEVSGLMR K Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2577.2577.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 4324 1436 1 0 1 460.8889 1379.6449 3 1379.6463 -0.0014 1 26.89 0.0064 R SRSGEGEVSGLMR K Oxidation (M) 0.0000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2571.2571.3.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 6338 4049 1 0 1 893.4875 1784.9605 2 1784.9632 -0.0027 1 50.98 1.70E-05 K LTEDKADVQSIIGLQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5470.5470.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 6394 2108 1 0 1 907.4703 1812.9261 2 1812.933 -0.0069 1 48.63 2.80E-05 R VLVNDAQKVTEGQQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3315.3315.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 6395 2094 1 0 1 605.317 1812.9292 3 1812.933 -0.0038 1 64.43 1.10E-06 R VLVNDAQKVTEGQQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3295.3295.3.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 6579 4341 1 0 1 939.4532 1876.8919 2 1876.8955 -0.0036 0 41.46 0.00028 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5779.5779.2.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 6580 4402 1 0 1 626.6387 1876.8944 3 1876.8955 -0.0012 0 33.93 0.003 K LSPPYSSPQEFAQDVGR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5841.5841.3.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 6854 2269 1 0 1 673.6848 2018.0326 3 2018.0367 -0.0041 0 49.33 3.30E-05 K IVAERPGTNSTGPAPMAPPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3505.3505.3.dta 10 IPI00438230.3 Isoform 2 of Transcription intermediary factor 1-beta 438 80621 21 21 15 15 6872 1656 1 0 1 679.0171 2034.0294 3 2034.0316 -0.0022 0 32.58 0.0019 K IVAERPGTNSTGPAPMAPPR A Oxidation (M) 0.00000000000000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2809.2809.3.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 2107 4166 1 1 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 2145 2455 1 1 0 518.769 1035.5234 2 1035.525 -0.0016 1 20.38 0.037 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3727.3727.2.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 2532 882 1 1 0 553.7664 1105.5183 2 1105.5186 -0.0003 0 71.37 1.50E-06 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1959.1959.2.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 2535 2384 1 1 0 553.7843 1105.5541 2 1105.555 -0.0009 0 83.64 1.10E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3647.3647.2.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 2634 2581 1 1 0 561.7914 1121.5683 2 1121.5717 -0.0033 0 49.11 0.00011 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3876.3876.2.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 2932 5525 1 1 1 586.7665 1171.5184 2 1171.5186 -0.0002 0 38.34 0.00025 K DAEEWFFTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6981.6981.2.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 3686 2004 1 1 0 639.7944 1277.5742 2 1277.5783 -0.0041 0 92.53 7.00E-09 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3189.3189.2.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 4219 1947 1 1 0 681.3474 1360.6803 2 1360.6834 -0.0031 0 91.3 1.60E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3127.3127.2.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 4572 2527 1 1 1 713.353 1424.6915 2 1424.6896 0.0019 0 67.73 4.50E-07 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3813.3813.2.dta 11 1 IPI00384444.5 "Keratin, type I cytoskeletal 14" 404 51875 10 10 10 10 7022 2961 1 1 1 770.3589 2308.055 3 2308.0567 -0.0017 0 31.52 0.0011 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4292.4292.3.dta 11 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 353 51578 9 9 9 9 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 353 51578 9 9 9 9 2145 2455 1 0 0 518.769 1035.5234 2 1035.525 -0.0016 1 20.38 0.037 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3727.3727.2.dta 11 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 353 51578 9 9 9 9 2495 5178 1 0 1 548.7693 1095.524 2 1095.5237 0.0004 0 49.12 0.00019 R DAETWFLSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6629.6629.2.dta 11 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 353 51578 9 9 9 9 2532 882 1 0 0 553.7664 1105.5183 2 1105.5186 -0.0003 0 71.37 1.50E-06 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1959.1959.2.dta 11 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 353 51578 9 9 9 9 2535 2384 1 0 0 553.7843 1105.5541 2 1105.555 -0.0009 0 83.64 1.10E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3647.3647.2.dta 11 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 353 51578 9 9 9 9 2634 2581 1 0 0 561.7914 1121.5683 2 1121.5717 -0.0033 0 49.11 0.00011 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3876.3876.2.dta 11 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 353 51578 9 9 9 9 3566 1437 1 0 1 630.7874 1259.5603 2 1259.563 -0.0027 0 45.36 5.60E-05 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2572.2572.2.dta 11 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 353 51578 9 9 9 9 3686 2004 1 0 0 639.7944 1277.5742 2 1277.5783 -0.0041 0 92.53 7.00E-09 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3189.3189.2.dta 11 2 IPI00217963.3 "Keratin, type I cytoskeletal 16" 353 51578 9 9 9 9 4071 2570 1 0 1 669.8339 1337.6533 2 1337.6575 -0.0043 0 70.89 6.50E-07 R APSTYGGGLSVSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3864.3864.2.dta 11 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 302 59711 5 5 5 5 2532 882 1 0 0 553.7664 1105.5183 2 1105.5186 -0.0003 0 71.37 1.50E-06 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1959.1959.2.dta 11 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 302 59711 5 5 5 5 2884 2510 1 0 1 583.2961 1164.5776 2 1164.5775 0.0001 0 39.59 0.00032 R LENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3794.3794.2.dta 11 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 302 59711 5 5 5 5 3585 2290 1 0 1 631.801 1261.5874 2 1261.5899 -0.0025 0 76.78 3.40E-07 R SLLEGEGSSGGGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3533.3533.2.dta 11 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 302 59711 5 5 5 5 4330 2769 1 0 1 691.3261 1380.6377 2 1380.6408 -0.0032 0 80.52 2.80E-08 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4084.4084.2.dta 11 3 IPI00009865.1 "Keratin, type I cytoskeletal 10" 302 59711 5 5 5 5 5182 1620 1 0 1 775.3416 1548.6687 2 1548.67 -0.0013 0 118.12 8.30E-12 R SGGGGGGGGCGGGGGVSSLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2770.2770.2.dta 11 4 IPI00479145.2 "Keratin, type I cytoskeletal 19" 254 44065 8 8 8 8 521 899 1 0 1 381.7089 761.4032 2 761.4032 0 0 28.87 0.019 R GVSVSSAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1977.1977.2.dta 11 4 IPI00479145.2 "Keratin, type I cytoskeletal 19" 254 44065 8 8 8 8 1016 3776 1 0 1 425.7323 849.4501 2 849.4497 0.0004 0 44.28 0.00027 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5174.5174.2.dta 11 4 IPI00479145.2 "Keratin, type I cytoskeletal 19" 254 44065 8 8 8 8 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 4 IPI00479145.2 "Keratin, type I cytoskeletal 19" 254 44065 8 8 8 8 2170 3507 1 0 0 521.3063 1040.5981 2 1040.5978 0.0003 0 63.31 4.50E-06 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4884.4884.2.dta 11 4 IPI00479145.2 "Keratin, type I cytoskeletal 19" 254 44065 8 8 8 8 2634 2581 1 0 0 561.7914 1121.5683 2 1121.5717 -0.0033 0 49.11 0.00011 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3876.3876.2.dta 11 4 IPI00479145.2 "Keratin, type I cytoskeletal 19" 254 44065 8 8 8 8 3265 2047 1 0 0 611.8238 1221.633 2 1221.6353 -0.0023 1 19.94 0.028 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3235.3235.2.dta 11 4 IPI00479145.2 "Keratin, type I cytoskeletal 19" 254 44065 8 8 8 8 3419 3043 1 0 1 622.3292 1242.6439 2 1242.6455 -0.0016 0 55.14 1.30E-05 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4381.4381.2.dta 11 4 IPI00479145.2 "Keratin, type I cytoskeletal 19" 254 44065 8 8 8 8 5195 3275 1 0 1 777.879 1553.7434 2 1553.7434 0 0 93.84 5.40E-09 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4632.4632.2.dta 11 5 IPI00554788.4 49 kDa protein 180 48793 6 6 6 6 1400 430 2 0 1 462.768 923.5214 2 923.5188 0.0026 1 34.56 0.0048 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1467.1467.2.dta 11 5 IPI00554788.4 49 kDa protein 180 48793 6 6 6 6 1743 2134 1 0 1 488.2299 974.4452 2 974.4458 -0.0005 0 29.6 0.015 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3350.3350.2.dta 11 5 IPI00554788.4 49 kDa protein 180 48793 6 6 6 6 2170 3507 1 0 0 521.3063 1040.5981 2 1040.5978 0.0003 0 63.31 4.50E-06 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4884.4884.2.dta 11 5 IPI00554788.4 49 kDa protein 180 48793 6 6 6 6 3970 3172 1 0 1 660.3394 1318.6643 2 1318.6629 0.0013 0 64.23 2.00E-06 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4521.4521.2.dta 11 5 IPI00554788.4 49 kDa protein 180 48793 6 6 6 6 4534 4804 1 0 1 710.3771 1418.7397 2 1418.7405 -0.0008 0 73.07 5.80E-07 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6249.6249.2.dta 11 5 IPI00554788.4 49 kDa protein 180 48793 6 6 6 6 5024 1451 1 0 1 752.8948 1503.775 2 1503.7781 -0.0031 1 28.36 0.015 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2587.2587.2.dta 11 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 165 48361 7 7 7 7 1891 6590 1 0 1 499.7535 997.4924 2 997.4941 -0.0017 0 22.63 0.026 R EQVHQTTR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.815.815.2.dta 11 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 165 48361 7 7 7 7 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 165 48361 7 7 7 7 2145 2455 1 0 0 518.769 1035.5234 2 1035.525 -0.0016 1 20.38 0.037 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3727.3727.2.dta 11 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 165 48361 7 7 7 7 2634 2581 1 0 0 561.7914 1121.5683 2 1121.5717 -0.0033 0 49.11 0.00011 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3876.3876.2.dta 11 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 165 48361 7 7 7 7 2762 5667 1 0 1 572.7502 1143.4858 2 1143.4873 -0.0015 0 32.49 0.0009 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7124.7124.2.dta 11 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 165 48361 7 7 7 7 3265 2047 1 0 0 611.8238 1221.633 2 1221.6353 -0.0023 1 19.94 0.028 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3235.3235.2.dta 11 6 IPI00450768.7 "Keratin, type I cytoskeletal 17" 165 48361 7 7 7 7 4219 1947 1 0 0 681.3474 1360.6803 2 1360.6834 -0.0031 0 91.3 1.60E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3127.3127.2.dta 11 IPI00789750.1 27 kDa protein 294 26775 6 6 6 6 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00789750.1 27 kDa protein 294 26775 6 6 6 6 2532 882 1 0 0 553.7664 1105.5183 2 1105.5186 -0.0003 0 71.37 1.50E-06 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1959.1959.2.dta 11 IPI00789750.1 27 kDa protein 294 26775 6 6 6 6 2535 2384 1 0 0 553.7843 1105.5541 2 1105.555 -0.0009 0 83.64 1.10E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3647.3647.2.dta 11 IPI00789750.1 27 kDa protein 294 26775 6 6 6 6 2932 5525 1 0 1 586.7665 1171.5184 2 1171.5186 -0.0002 0 38.34 0.00025 K DAEEWFFTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6981.6981.2.dta 11 IPI00789750.1 27 kDa protein 294 26775 6 6 6 6 3686 2004 1 0 0 639.7944 1277.5742 2 1277.5783 -0.0041 0 92.53 7.00E-09 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3189.3189.2.dta 11 IPI00789750.1 27 kDa protein 294 26775 6 6 6 6 4572 2527 1 0 1 713.353 1424.6915 2 1424.6896 0.0019 0 67.73 4.50E-07 R APSTYGGGLSVSSSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3813.3813.2.dta 11 IPI00794644.1 21 kDa protein 191 20831 6 6 6 6 521 899 1 0 1 381.7089 761.4032 2 761.4032 0 0 28.87 0.019 R GVSVSSAR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1977.1977.2.dta 11 IPI00794644.1 21 kDa protein 191 20831 6 6 6 6 1016 3776 1 0 1 425.7323 849.4501 2 849.4497 0.0004 0 44.28 0.00027 R FGPGVAFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5174.5174.2.dta 11 IPI00794644.1 21 kDa protein 191 20831 6 6 6 6 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00794644.1 21 kDa protein 191 20831 6 6 6 6 2170 3507 1 0 0 521.3063 1040.5981 2 1040.5978 0.0003 0 63.31 4.50E-06 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4884.4884.2.dta 11 IPI00794644.1 21 kDa protein 191 20831 6 6 6 6 3265 2047 1 0 0 611.8238 1221.633 2 1221.6353 -0.0023 1 19.94 0.028 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3235.3235.2.dta 11 IPI00794644.1 21 kDa protein 191 20831 6 6 6 6 5195 3275 1 0 1 777.879 1553.7434 2 1553.7434 0 0 93.84 5.40E-09 R QSSATSSFGGLGGGSVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4632.4632.2.dta 11 IPI00792454.1 30 kDa protein 181 30075 5 5 5 5 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00792454.1 30 kDa protein 181 30075 5 5 5 5 2634 2581 1 0 0 561.7914 1121.5683 2 1121.5717 -0.0033 0 49.11 0.00011 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3876.3876.2.dta 11 IPI00792454.1 30 kDa protein 181 30075 5 5 5 5 2932 5525 1 0 1 586.7665 1171.5184 2 1171.5186 -0.0002 0 38.34 0.00025 K DAEEWFFTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6981.6981.2.dta 11 IPI00792454.1 30 kDa protein 181 30075 5 5 5 5 4219 1947 1 0 0 681.3474 1360.6803 2 1360.6834 -0.0031 0 91.3 1.60E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3127.3127.2.dta 11 IPI00792454.1 30 kDa protein 181 30075 5 5 5 5 7022 2961 1 0 1 770.3589 2308.055 3 2308.0567 -0.0017 0 31.52 0.0011 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4292.4292.3.dta 11 IPI00383111.2 57 kDa protein 151 56699 3 3 3 3 2532 882 1 0 0 553.7664 1105.5183 2 1105.5186 -0.0003 0 71.37 1.50E-06 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1959.1959.2.dta 11 IPI00383111.2 57 kDa protein 151 56699 3 3 3 3 2884 2510 1 0 1 583.2961 1164.5776 2 1164.5775 0.0001 0 39.59 0.00032 R LENEIQTYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3794.3794.2.dta 11 IPI00383111.2 57 kDa protein 151 56699 3 3 3 3 4330 2769 1 0 1 691.3261 1380.6377 2 1380.6408 -0.0032 0 80.52 2.80E-08 R ALEESNYELEGK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4084.4084.2.dta 11 IPI00791348.1 20 kDa protein 151 19811 2 2 2 2 2535 2384 1 0 0 553.7843 1105.5541 2 1105.555 -0.0009 0 83.64 1.10E-07 R ISSVLAGGSCR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3647.3647.2.dta 11 IPI00791348.1 20 kDa protein 151 19811 2 2 2 2 3686 2004 1 0 0 639.7944 1277.5742 2 1277.5783 -0.0041 0 92.53 7.00E-09 K GSCGIGGGIGGGSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3189.3189.2.dta 11 IPI00791852.1 42 kDa protein 134 41729 5 5 5 5 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00791852.1 42 kDa protein 134 41729 5 5 5 5 2145 2455 1 0 0 518.769 1035.5234 2 1035.525 -0.0016 1 20.38 0.037 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3727.3727.2.dta 11 IPI00791852.1 42 kDa protein 134 41729 5 5 5 5 2762 5667 1 0 1 572.7502 1143.4858 2 1143.4873 -0.0015 0 32.49 0.0009 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7124.7124.2.dta 11 IPI00791852.1 42 kDa protein 134 41729 5 5 5 5 3265 2047 1 0 0 611.8238 1221.633 2 1221.6353 -0.0023 1 19.94 0.028 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3235.3235.2.dta 11 IPI00791852.1 42 kDa protein 134 41729 5 5 5 5 4219 1947 1 0 0 681.3474 1360.6803 2 1360.6834 -0.0031 0 91.3 1.60E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3127.3127.2.dta 11 IPI00180956.6 49 kDa protein 132 49001 4 4 4 4 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00180956.6 49 kDa protein 132 49001 4 4 4 4 2145 2455 1 0 0 518.769 1035.5234 2 1035.525 -0.0016 1 20.38 0.037 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3727.3727.2.dta 11 IPI00180956.6 49 kDa protein 132 49001 4 4 4 4 2762 5667 1 0 1 572.7502 1143.4858 2 1143.4873 -0.0015 0 32.49 0.0009 K DAEDWFFSK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7124.7124.2.dta 11 IPI00180956.6 49 kDa protein 132 49001 4 4 4 4 4219 1947 1 0 0 681.3474 1360.6803 2 1360.6834 -0.0031 0 91.3 1.60E-08 R EVATNSELVQSGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3127.3127.2.dta 11 IPI00184195.2 19 kDa protein 128 18696 4 4 4 4 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00184195.2 19 kDa protein 128 18696 4 4 4 4 2170 3507 1 0 0 521.3063 1040.5981 2 1040.5978 0.0003 0 63.31 4.50E-06 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4884.4884.2.dta 11 IPI00184195.2 19 kDa protein 128 18696 4 4 4 4 3265 2047 1 0 0 611.8238 1221.633 2 1221.6353 -0.0023 1 19.94 0.028 R TKFETEQALR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3235.3235.2.dta 11 IPI00184195.2 19 kDa protein 128 18696 4 4 4 4 3419 3043 1 0 1 622.3292 1242.6439 2 1242.6455 -0.0016 0 55.14 1.30E-05 R ALEAANGELEVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4381.4381.2.dta 11 IPI00794267.1 18 kDa protein 124 18099 4 4 4 4 1400 430 2 0 1 462.768 923.5214 2 923.5188 0.0026 1 34.56 0.0048 K IREHLEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1467.1467.2.dta 11 IPI00794267.1 18 kDa protein 124 18099 4 4 4 4 1743 2134 1 0 1 488.2299 974.4452 2 974.4458 -0.0005 0 29.6 0.015 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3350.3350.2.dta 11 IPI00794267.1 18 kDa protein 124 18099 4 4 4 4 2170 3507 1 0 0 521.3063 1040.5981 2 1040.5978 0.0003 0 63.31 4.50E-06 R IVLQIDNAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4884.4884.2.dta 11 IPI00794267.1 18 kDa protein 124 18099 4 4 4 4 3970 3172 1 0 1 660.3394 1318.6643 2 1318.6629 0.0013 0 64.23 2.00E-06 R AQIFANTVDNAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4521.4521.2.dta 11 IPI00795353.1 11 kDa protein 78 10894 2 2 2 2 4534 4804 1 0 1 710.3771 1418.7397 2 1418.7405 -0.0008 0 73.07 5.80E-07 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6249.6249.2.dta 11 IPI00795353.1 11 kDa protein 78 10894 2 2 2 2 5024 1451 1 0 1 752.8948 1503.775 2 1503.7781 -0.0031 1 28.36 0.015 R IVDGKVVSETNDTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2587.2587.2.dta 11 IPI00290077.1 "Keratin, type I cytoskeletal 15" 78 49365 2 2 2 2 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00290077.1 "Keratin, type I cytoskeletal 15" 78 49365 2 2 2 2 2634 2581 1 0 0 561.7914 1121.5683 2 1121.5717 -0.0033 0 49.11 0.00011 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3876.3876.2.dta 11 IPI00794731.1 15 kDa protein 76 15182 2 2 2 2 2634 2581 1 0 0 561.7914 1121.5683 2 1121.5717 -0.0033 0 49.11 0.00011 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3876.3876.2.dta 11 IPI00794731.1 15 kDa protein 76 15182 2 2 2 2 3566 1437 1 0 1 630.7874 1259.5603 2 1259.563 -0.0027 0 45.36 5.60E-05 R EVFTSSSSSSSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2572.2572.2.dta 11 IPI00791156.1 31 kDa protein 74 30866 4 4 4 4 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00791156.1 31 kDa protein 74 30866 4 4 4 4 2145 2455 1 0 0 518.769 1035.5234 2 1035.525 -0.0016 1 20.38 0.037 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3727.3727.2.dta 11 IPI00791156.1 31 kDa protein 74 30866 4 4 4 4 2932 5525 1 0 1 586.7665 1171.5184 2 1171.5186 -0.0002 0 38.34 0.00025 K DAEEWFFTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6981.6981.2.dta 11 IPI00791156.1 31 kDa protein 74 30866 4 4 4 4 3265 2047 1 0 0 611.8238 1221.633 2 1221.6353 -0.0023 1 19.94 0.028 R TKFETEQALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3235.3235.2.dta 11 IPI00794807.1 15 kDa protein 73 15435 1 1 1 1 4534 4804 1 0 1 710.3771 1418.7397 2 1418.7405 -0.0008 0 73.07 5.80E-07 R QAQEYEALLNIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6249.6249.2.dta 11 IPI00328103.2 Keratin-27 71 50419 1 1 1 1 2532 882 1 0 0 553.7664 1105.5183 2 1105.5186 -0.0003 0 71.37 1.50E-06 K VTMQNLNDR L Oxidation (M) 0.001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1959.1959.2.dta 11 IPI00654614.1 Epidermal type I keratin (Fragment) 63 17892 2 2 2 2 2634 2581 1 0 0 561.7914 1121.5683 2 1121.5717 -0.0033 0 49.11 0.00011 R LEQEIATYR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3876.3876.2.dta 11 IPI00654614.1 Epidermal type I keratin (Fragment) 63 17892 2 2 2 2 7022 2961 1 0 1 770.3589 2308.055 3 2308.0567 -0.0017 0 31.52 0.0011 R LLEGEDAHLSSSQFSSGSQSSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4292.4292.3.dta 11 IPI00788699.1 25 kDa protein 52 25020 1 1 1 1 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00789536.1 MGC102966 protein 50 15752 2 2 2 2 2107 4166 1 0 0 515.3007 1028.5868 2 1028.5866 0.0002 0 51.97 0.00011 R VLDELTLAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5597.5597.2.dta 11 IPI00789536.1 MGC102966 protein 50 15752 2 2 2 2 2145 2455 1 0 0 518.769 1035.5234 2 1035.525 -0.0016 1 20.38 0.037 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3727.3727.2.dta 11 IPI00009866.6 "Isoform 1 of Keratin, type I cytoskeletal 13" 49 49898 1 1 1 1 2634 2581 1 0 0 561.7914 1121.5683 2 1121.5717 -0.0033 0 49.11 0.00011 R LEQEIATYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3876.3876.2.dta 11 IPI00748465.1 44 kDa protein 30 44811 1 1 1 1 1743 2134 1 0 1 488.2299 974.4452 2 974.4458 -0.0005 0 29.6 0.015 R STFSTNYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3350.3350.2.dta 11 IPI00790298.1 20 kDa protein 20 19591 1 1 1 1 2145 2455 1 0 0 518.769 1035.5234 2 1035.525 -0.0016 1 20.38 0.037 K IRDWYQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3727.3727.2.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 1267 1766 1 1 1 450.756 899.4974 2 899.4978 -0.0003 0 52.1 9.70E-05 R FVVGSHVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2927.2927.2.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 1268 1761 1 1 1 300.84 899.4983 3 899.4978 0.0005 0 25.86 0.0068 R FVVGSHVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2922.2922.3.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 2041 5658 1 1 1 511.2783 1020.5421 2 1020.5426 -0.0006 0 47.45 0.00032 R FDILCVVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7114.7114.2.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 2086 1276 1 1 1 343.2015 1026.5826 3 1026.5822 0.0004 1 28.59 0.012 R IRIQESPGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2396.2396.3.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 2713 3837 1 1 1 378.8964 1133.6674 3 1133.6669 0.0005 0 34.69 0.0011 R QLHLNQLIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5240.5240.3.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 2936 5750 1 1 1 586.8371 1171.6596 2 1171.6601 -0.0005 0 46.96 0.00031 R GLALALFGGEPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7209.7209.2.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 3655 3173 1 1 1 637.8268 1273.6391 2 1273.6402 -0.001 0 59.35 8.40E-06 K VAVGELTDEDVK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4522.4522.2.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 3840 3239 1 1 1 650.3438 1298.6731 2 1298.6765 -0.0034 0 69.53 2.10E-06 R CTVIAAANPIGGR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4593.4593.2.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 4058 2806 1 1 1 667.856 1333.6974 2 1333.699 -0.0016 0 56.14 7.10E-06 K QLVAEQVTYQR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4124.4124.2.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 4926 4584 1 1 1 739.8774 1477.7402 2 1477.7412 -0.001 0 76.82 6.30E-08 R ESLVVNYEDLAAR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6028.6028.2.dta 12 1 IPI00184330.5 DNA replication licensing factor MCM2 345 102516 11 11 10 10 5116 4367 1 1 1 765.384 1528.7534 2 1528.7556 -0.0022 0 57.79 1.10E-05 R GDINVLLCGDPGTAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5807.5807.2.dta 12 IPI00795155.1 13 kDa protein 81 12883 3 3 2 2 1267 1766 1 0 1 450.756 899.4974 2 899.4978 -0.0003 0 52.1 9.70E-05 R FVVGSHVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2927.2927.2.dta 12 IPI00795155.1 13 kDa protein 81 12883 3 3 2 2 1268 1761 1 0 1 300.84 899.4983 3 899.4978 0.0005 0 25.86 0.0068 R FVVGSHVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2922.2922.3.dta 12 IPI00795155.1 13 kDa protein 81 12883 3 3 2 2 2041 5658 1 0 1 511.2783 1020.5421 2 1020.5426 -0.0006 0 47.45 0.00032 R FDILCVVR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7114.7114.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 18 341 1 0 1 301.1747 600.3348 2 600.3343 0.0005 0 53.88 8.20E-05 R AGNLAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1371.1371.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 306 4156 1 1 1 351.2086 700.4026 2 700.402 0.0006 0 36.28 0.0095 R LNLWR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5586.5586.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 411 2937 1 1 1 365.235 728.4554 2 728.4545 0.0009 0 36.41 0.0064 K GLATVIR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4266.4266.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 1622 3377 1 1 1 479.2772 956.5398 2 956.5403 -0.0005 0 27.6 0.013 R QINLSNIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4743.4743.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 2025 2905 1 1 1 509.7754 1017.5362 2 1017.5342 0.002 0 69.25 2.50E-06 K SLLSAEEAAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4231.4231.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 2215 5654 1 1 1 524.8004 1047.5863 2 1047.5865 -0.0003 0 35.59 0.0037 K QFLPFLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7110.7110.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 2334 3989 1 1 1 536.2482 1070.4819 2 1070.4821 -0.0002 0 34.42 0.0027 K FVDGEWYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5405.5405.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 2797 3758 1 1 1 575.3168 1148.619 2 1148.619 0 0 39.46 0.0027 R LGTLSPAFSTR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5155.5155.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 3323 836 1 1 1 616.8274 1231.6402 2 1231.6408 -0.0006 1 45.92 0.00012 R VADISGDTQKAK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1909.1909.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 4057 2708 1 1 1 667.831 1333.6474 2 1333.6514 -0.0039 0 38.06 0.0037 R DYVAPTANLDQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4018.4018.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 4448 4658 1 1 1 700.402 1398.7894 2 1398.7905 -0.0011 0 75.06 3.60E-07 K VMQVLNADAIVVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6101.6101.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 4523 3991 1 1 1 708.3995 1414.7844 2 1414.7854 -0.001 0 52.24 5.80E-05 K VMQVLNADAIVVK L Oxidation (M) 0.0100000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5407.5407.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 4593 4874 1 1 1 715.3505 1428.6864 2 1428.6885 -0.0021 0 89.63 1.70E-08 R SEAVVEYVFSGSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6319.6319.2.dta 13 1 IPI00140420.4 Staphylococcal nuclease domain-containing protein 1 345 102618 14 14 13 13 6852 1654 1 1 1 672.972 2015.8943 3 2015.8966 -0.0023 1 17.39 0.042 R ANNPEQNRLSECEEQAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2807.2807.3.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 403 4412 1 1 1 364.7493 727.484 2 727.4843 -0.0003 0 19.81 0.023 R LILELK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5851.5851.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 1712 2451 1 1 0 485.2768 968.539 2 968.5403 -0.0013 0 40.4 0.00086 R GGGQIIPTAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3723.3723.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 2134 2705 1 1 1 517.7713 1033.5281 2 1033.5291 -0.0011 0 51.57 3.70E-05 K GLSEDVSISK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4015.4015.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 2482 368 1 1 1 547.3268 1092.6391 2 1092.6404 -0.0012 1 21.6 0.05 R LIKHAVQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1400.1400.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 2483 364 1 1 1 365.2209 1092.641 3 1092.6404 0.0007 1 20.89 0.04 R LIKHAVQER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1396.1396.3.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 2487 895 1 1 1 547.7682 1093.5219 2 1093.5226 -0.0007 1 32.32 0.0017 K CFAETPNKK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1973.1973.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 2488 894 1 1 1 365.5153 1093.5239 3 1093.5226 0.0013 1 27.01 0.014 K CFAETPNKK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1972.1972.3.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 2633 5460 1 1 1 561.7822 1121.5499 2 1121.5505 -0.0006 0 46.54 0.00033 K YDWDLLAAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6915.6915.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 2767 4010 1 1 1 572.8174 1143.6203 2 1143.6209 -0.0006 0 51.18 3.00E-05 K ITMIAEPLEK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5428.5428.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 2851 3107 1 1 1 580.8148 1159.6151 2 1159.6158 -0.0007 0 39.66 0.0015 K ITMIAEPLEK G Oxidation (M) 0.0010000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4450.4450.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 3485 5508 1 1 1 626.8212 1251.6278 2 1251.6288 -0.001 0 13.89 0.05 R LWGDIYFNPK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6963.6963.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 3511 3784 1 1 1 628.8577 1255.7009 2 1255.7024 -0.0015 0 64.57 3.50E-06 K STPVTVVLPDTK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5183.5183.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 4403 3856 1 1 1 696.8893 1391.764 2 1391.766 -0.002 0 69.65 1.20E-06 K IAVEPVNPSELPK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5261.5261.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 4405 5043 1 1 1 697.3461 1392.6777 2 1392.6786 -0.0009 0 53.18 0.0001 K DSIVQGFQWGTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6493.6493.2.dta 14 1 IPI00003519.1 116 kDa U5 small nuclear ribonucleoprotein component 328 110336 15 15 12 12 4791 3544 1 1 1 730.9138 1459.8131 2 1459.8147 -0.0016 0 59.15 4.30E-06 K ILDAVVAQEPLHR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4924.4924.2.dta 14 2 IPI00186290.6 Elongation factor 2 239 96246 8 8 8 8 469 1526 1 0 1 377.7085 753.4024 2 753.4021 0.0003 0 50.07 8.80E-05 K NPADLPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2668.2668.2.dta 14 2 IPI00186290.6 Elongation factor 2 239 96246 8 8 8 8 1224 3363 1 0 1 445.7584 889.5022 2 889.5022 0 0 33.74 0.0018 K FSVSPVVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4728.4728.2.dta 14 2 IPI00186290.6 Elongation factor 2 239 96246 8 8 8 8 1712 2451 1 0 0 485.2768 968.539 2 968.5403 -0.0013 0 40.4 0.00086 R GGGQIIPTAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3723.3723.2.dta 14 2 IPI00186290.6 Elongation factor 2 239 96246 8 8 8 8 1978 1405 1 0 1 507.2534 1012.4922 2 1012.4938 -0.0015 0 38.11 0.0025 K GEGQLGPAER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2536.2536.2.dta 14 2 IPI00186290.6 Elongation factor 2 239 96246 8 8 8 8 2548 4278 1 0 1 554.3242 1106.6338 2 1106.6336 0.0002 0 61.14 3.20E-06 R VFSGLVSTGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5714.5714.2.dta 14 2 IPI00186290.6 Elongation factor 2 239 96246 8 8 8 8 2640 3327 1 0 1 562.2867 1122.5588 2 1122.5591 -0.0003 0 62.69 5.10E-06 K STLTDSLVCK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4689.4689.2.dta 14 2 IPI00186290.6 Elongation factor 2 239 96246 8 8 8 8 4163 2116 1 0 1 451.2571 1350.7495 3 1350.7507 -0.0012 1 32.32 0.0014 R VAVEAKNPADLPK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3326.3326.3.dta 14 2 IPI00186290.6 Elongation factor 2 239 96246 8 8 8 8 4308 4134 1 0 1 689.8605 1377.7064 2 1377.7075 -0.0011 0 68.86 1.90E-06 R CLYASVLTAQPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5562.5562.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 116 2334 1 1 1 318.1815 634.3484 2 634.3472 0.0012 0 33.27 0.013 R IMLSR A Oxidation (M) 0.01000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3592.3592.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 1859 1520 1 1 1 498.2426 994.4707 2 994.4719 -0.0012 0 35 0.0044 R LETYENAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2662.2662.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 2014 2639 1 1 1 509.2639 1016.5132 2 1016.5138 -0.0007 0 48.8 0.00034 R AAELETDIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3941.3941.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 2264 4882 1 1 1 529.7958 1057.577 2 1057.5767 0.0003 0 42.13 0.0014 R ESLEALLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6327.6327.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 2536 2747 1 1 1 553.7936 1105.5726 2 1105.5768 -0.0042 0 38.27 0.0022 K IQQQFSDLK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4060.4060.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 2610 5771 1 1 1 559.3071 1116.5997 2 1116.6001 -0.0004 0 26.88 0.014 K AEVLWLMGAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7231.7231.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 2625 1727 1 1 1 374.5404 1120.5994 3 1120.5989 0.0005 0 23.27 0.0066 K ALEHVPNSVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2886.2886.3.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 2915 5093 1 1 1 585.8166 1169.6186 2 1169.6193 -0.0007 0 41.74 0.00012 K NPGLWLESVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6543.6543.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 2949 4294 1 1 1 588.2881 1174.5617 2 1174.5618 -0.0001 0 54.35 2.70E-05 K SEDVWLEAAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5730.5730.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 3659 2954 1 1 1 638.302 1274.5895 2 1274.5925 -0.003 0 58.83 1.40E-05 R AAQDLCEEALR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4284.4284.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 4027 2764 1 1 1 664.8207 1327.6269 2 1327.6255 0.0014 0 46.78 4.10E-05 K AAVELEEPEDAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4078.4078.2.dta 15 1 IPI00305068.5 Pre-mRNA-processing factor 6 325 107656 12 12 12 12 6234 2711 1 1 1 873.4481 1744.8816 2 1744.8843 -0.0028 0 117.14 4.50E-11 R LSQVSDSVSGQTVVDPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4021.4021.2.dta 15 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 106 47302 4 4 4 4 2264 4882 1 0 1 529.7958 1057.577 2 1057.5767 0.0003 0 42.13 0.0014 R ESLEALLQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6327.6327.2.dta 15 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 106 47302 4 4 4 4 2610 5771 1 0 1 559.3071 1116.5997 2 1116.6001 -0.0004 0 26.88 0.014 K AEVLWLMGAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7231.7231.2.dta 15 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 106 47302 4 4 4 4 2915 5093 1 0 1 585.8166 1169.6186 2 1169.6193 -0.0007 0 41.74 0.00012 K NPGLWLESVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6543.6543.2.dta 15 IPI00739440.1 similar to U5 snRNP-associated 102 kDa protein 106 47302 4 4 4 4 3659 2954 1 0 1 638.302 1274.5895 2 1274.5925 -0.003 0 58.83 1.40E-05 R AAQDLCEEALR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4284.4284.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 1002 1193 1 1 1 423.727 845.4394 2 845.4395 -0.0001 1 40.53 0.0023 R NVGWKDK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2307.2307.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 1088 757 1 1 1 433.7272 865.4399 2 865.4406 -0.0008 0 30.21 0.0044 K TGPGEHLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1823.1823.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 2070 3179 1 1 1 513.3029 1024.5913 2 1024.5917 -0.0004 0 14.49 0.044 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4528.4528.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 2071 3039 1 1 1 513.303 1024.5914 2 1024.5917 -0.0003 0 55.43 1.90E-05 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4377.4377.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 2241 1575 1 1 1 528.2051 1054.3956 2 1054.3961 -0.0005 0 46.01 2.50E-05 R CDSNPCFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2722.2722.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 3197 1132 1 1 1 606.2546 1210.4946 2 1210.4972 -0.0026 1 38.6 0.00032 R RCDSNPCFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2238.2238.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 3371 2524 1 1 1 618.3413 1234.6681 2 1234.667 0.0011 1 19.24 0.047 R QQVKETSFLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3810.3810.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 3372 2531 1 1 1 412.5648 1234.6726 3 1234.667 0.0056 1 44.3 0.00035 R QQVKETSFLR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3817.3817.3.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 5810 4519 1 1 1 828.3936 1654.7726 2 1654.774 -0.0014 0 69.87 2.80E-07 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5962.5962.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 5811 4531 1 1 1 552.5987 1654.7743 3 1654.774 0.0003 0 33.63 0.0007 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5975.5975.3.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 6585 5131 1 1 1 939.946 1877.8775 2 1877.8829 -0.0054 0 40.88 0.00015 R IDVCPENAEVTLTDFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6581.6581.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 6810 3973 1 1 1 660.9534 1979.8383 3 1979.8418 -0.0036 0 54.83 1.20E-05 K DVDIDSYPDEELPCSAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5387.5387.3.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 6811 3998 1 1 1 990.9272 1979.8399 2 1979.8418 -0.0019 0 37.95 0.0006 K DVDIDSYPDEELPCSAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5415.5415.2.dta 16 1 IPI00328550.3 Thrombospondin-4 precursor 319 108482 14 14 9 9 6812 3857 1 1 1 990.9289 1979.8432 2 1979.8418 0.0014 0 26.52 0.0091 K DVDIDSYPDEELPCSAR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5262.5262.2.dta 16 IPI00028030.3 Cartilage oligomeric matrix protein precursor 94 85402 4 4 3 3 1002 1193 1 0 1 423.727 845.4394 2 845.4395 -0.0001 1 40.53 0.0023 R NVGWKDK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2307.2307.2.dta 16 IPI00028030.3 Cartilage oligomeric matrix protein precursor 94 85402 4 4 3 3 2070 3179 1 0 1 513.3029 1024.5913 2 1024.5917 -0.0004 0 14.49 0.044 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4528.4528.2.dta 16 IPI00028030.3 Cartilage oligomeric matrix protein precursor 94 85402 4 4 3 3 2071 3039 1 0 1 513.303 1024.5914 2 1024.5917 -0.0003 0 55.43 1.90E-05 R AVAEPGIQLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4377.4377.2.dta 16 IPI00028030.3 Cartilage oligomeric matrix protein precursor 94 85402 4 4 3 3 6585 5131 1 0 1 939.946 1877.8775 2 1877.8829 -0.0054 0 40.88 0.00015 K IDVCPENAEVTLTDFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6581.6581.2.dta 16 IPI00329535.2 Thrombospondin-3 precursor 88 106872 2 2 1 1 5810 4519 1 0 1 828.3936 1654.7726 2 1654.774 -0.0014 0 69.87 2.80E-07 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5962.5962.2.dta 16 IPI00329535.2 Thrombospondin-3 precursor 88 106872 2 2 1 1 5811 4531 1 0 1 552.5987 1654.7743 3 1654.774 0.0003 0 33.63 0.0007 K QTEQTYWQATPFR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5975.5975.3.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 133 1852 1 1 1 321.2027 640.3909 2 640.3908 0.0001 0 23.33 0.046 K QLPGVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3024.3024.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 147 2967 2 1 1 322.7209 643.4272 2 643.4268 0.0003 0 28.62 0.0087 K ILTLGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4299.4299.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 516 7416 1 1 1 381.2296 760.4447 2 760.4443 0.0005 1 53.44 7.30E-05 K SGAALSKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.969.969.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 605 5179 1 1 1 390.2117 778.4088 2 778.4086 0.0002 0 38.43 0.0023 K HASHISK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.663.663.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 786 53 1 1 1 409.7402 817.4659 2 817.4657 0.0002 1 32.9 0.0079 R GKSGAALSK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1059.1059.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 838 1435 1 1 1 415.2421 828.4697 2 828.4705 -0.0008 0 28.07 0.014 K LTVNPGTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2570.2570.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 853 1054 1 1 1 416.6955 831.3764 2 831.3763 0.0002 0 26.08 0.021 K GTNSYYK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2145.2145.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 1624 1012 1 1 1 479.2898 956.565 2 956.5655 -0.0005 1 28.11 0.024 K KLTVNPGTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2099.2099.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 2313 2638 1 1 1 533.7955 1065.5764 2 1065.5818 -0.0055 0 28.67 0.0062 K AEPVEVVAPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3940.3940.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 4302 5489 1 1 1 689.377 1376.7395 2 1376.7412 -0.0017 0 84.65 6.30E-08 R TTNFAGILSQGLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6943.6943.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 4447 3093 1 1 1 700.3632 1398.7119 2 1398.7103 0.0016 0 52.18 1.30E-05 K QQVPSGESAILDR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4435.4435.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 5586 4765 1 1 1 812.9056 1623.7967 2 1623.7992 -0.0025 0 82.39 5.50E-08 R VVSEDFLQDVSASTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6210.6210.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 6207 4143 1 1 1 869.3739 1736.7333 2 1736.7352 -0.002 0 59.84 3.80E-06 K SDAYYCTGDVTAWTK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5572.5572.2.dta 17 1 IPI00449049.5 Poly [ADP-ribose] polymerase 1 314 113811 14 14 14 14 6429 2488 1 1 1 609.273 1824.7972 3 1824.8014 -0.0042 1 25.28 0.0046 R GGSDDSSKDPIDVNYEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3768.3768.3.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 1371 402 1 1 1 460.2227 918.4309 2 918.4308 0.0002 0 58.72 2.30E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1437.1437.2.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 2099 3979 1 1 1 514.7901 1027.5656 2 1027.5662 -0.0005 0 78.01 2.60E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5394.5394.2.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 2185 2434 1 1 1 522.2772 1042.5399 2 1042.5407 -0.0008 0 39.65 0.00025 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3703.3703.2.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 4210 1816 1 1 1 680.3467 1358.6788 2 1358.679 -0.0002 0 50.56 1.80E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2985.2985.2.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 4230 2650 1 1 1 682.3112 1362.6078 2 1362.6099 -0.0021 0 61.78 1.60E-06 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3955.3955.2.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 4975 3490 1 1 1 746.3759 1490.7372 2 1490.7399 -0.0027 0 36.7 0.00036 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4865.4865.2.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 5039 2823 1 1 1 754.3672 1506.7198 2 1506.7348 -0.015 0 37.36 0.00065 R TALINSTGEEVAMR K Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4142.4142.2.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 5066 7168 1 1 1 759.861 1517.7074 2 1517.707 0.0003 0 16.49 0.028 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.932.932.2.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 5243 3425 1 1 1 783.878 1565.7414 2 1565.7434 -0.002 0 73.15 7.10E-07 R SVGGSGGGSFGDNLVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4795.4795.2.dta 18 1 IPI00021405.3 Isoform A of Lamin-A/C 308 74380 10 10 9 9 6258 2947 1 1 1 584.9586 1751.854 3 1751.855 -0.001 0 20.61 0.012 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4277.4277.3.dta 18 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 268 70903 8 8 8 8 1371 402 1 0 1 460.2227 918.4309 2 918.4308 0.0002 0 58.72 2.30E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1437.1437.2.dta 18 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 268 70903 8 8 8 8 2099 3979 1 0 1 514.7901 1027.5656 2 1027.5662 -0.0005 0 78.01 2.60E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5394.5394.2.dta 18 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 268 70903 8 8 8 8 2185 2434 1 0 1 522.2772 1042.5399 2 1042.5407 -0.0008 0 39.65 0.00025 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3703.3703.2.dta 18 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 268 70903 8 8 8 8 4210 1816 1 0 1 680.3467 1358.6788 2 1358.679 -0.0002 0 50.56 1.80E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2985.2985.2.dta 18 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 268 70903 8 8 8 8 4230 2650 1 0 1 682.3112 1362.6078 2 1362.6099 -0.0021 0 61.78 1.60E-06 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3955.3955.2.dta 18 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 268 70903 8 8 8 8 5066 7168 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 16.49 0.028 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.932.932.2.dta 18 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 268 70903 8 8 8 8 5243 3425 1 0 1 783.878 1565.7414 2 1565.7434 -0.002 0 73.15 7.10E-07 R SVGGSGGGSFGDNLVTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4795.4795.2.dta 18 IPI00216953.1 Isoform ADelta10 of Lamin-A/C 268 70903 8 8 8 8 6258 2947 1 0 1 584.9586 1751.854 3 1751.855 -0.001 0 20.61 0.012 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4277.4277.3.dta 18 IPI00216952.1 Isoform C of Lamin-A/C 259 65153 9 9 8 8 1371 402 1 0 1 460.2227 918.4309 2 918.4308 0.0002 0 58.72 2.30E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1437.1437.2.dta 18 IPI00216952.1 Isoform C of Lamin-A/C 259 65153 9 9 8 8 2099 3979 1 0 1 514.7901 1027.5656 2 1027.5662 -0.0005 0 78.01 2.60E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5394.5394.2.dta 18 IPI00216952.1 Isoform C of Lamin-A/C 259 65153 9 9 8 8 2185 2434 1 0 1 522.2772 1042.5399 2 1042.5407 -0.0008 0 39.65 0.00025 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3703.3703.2.dta 18 IPI00216952.1 Isoform C of Lamin-A/C 259 65153 9 9 8 8 4210 1816 1 0 1 680.3467 1358.6788 2 1358.679 -0.0002 0 50.56 1.80E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2985.2985.2.dta 18 IPI00216952.1 Isoform C of Lamin-A/C 259 65153 9 9 8 8 4230 2650 1 0 1 682.3112 1362.6078 2 1362.6099 -0.0021 0 61.78 1.60E-06 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3955.3955.2.dta 18 IPI00216952.1 Isoform C of Lamin-A/C 259 65153 9 9 8 8 4975 3490 1 0 1 746.3759 1490.7372 2 1490.7399 -0.0027 0 36.7 0.00036 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4865.4865.2.dta 18 IPI00216952.1 Isoform C of Lamin-A/C 259 65153 9 9 8 8 5039 2823 1 0 1 754.3672 1506.7198 2 1506.7348 -0.015 0 37.36 0.00065 R TALINSTGEEVAMR K Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4142.4142.2.dta 18 IPI00216952.1 Isoform C of Lamin-A/C 259 65153 9 9 8 8 5066 7168 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 16.49 0.028 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.932.932.2.dta 18 IPI00216952.1 Isoform C of Lamin-A/C 259 65153 9 9 8 8 6258 2947 1 0 1 584.9586 1751.854 3 1751.855 -0.001 0 20.61 0.012 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4277.4277.3.dta 18 IPI00514320.3 Lamin A/C 224 57897 8 8 7 7 1371 402 1 0 1 460.2227 918.4309 2 918.4308 0.0002 0 58.72 2.30E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1437.1437.2.dta 18 IPI00514320.3 Lamin A/C 224 57897 8 8 7 7 2099 3979 1 0 1 514.7901 1027.5656 2 1027.5662 -0.0005 0 78.01 2.60E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5394.5394.2.dta 18 IPI00514320.3 Lamin A/C 224 57897 8 8 7 7 2185 2434 1 0 1 522.2772 1042.5399 2 1042.5407 -0.0008 0 39.65 0.00025 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3703.3703.2.dta 18 IPI00514320.3 Lamin A/C 224 57897 8 8 7 7 4230 2650 1 0 1 682.3112 1362.6078 2 1362.6099 -0.0021 0 61.78 1.60E-06 K AQNTWGCGNSLR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3955.3955.2.dta 18 IPI00514320.3 Lamin A/C 224 57897 8 8 7 7 4975 3490 1 0 1 746.3759 1490.7372 2 1490.7399 -0.0027 0 36.7 0.00036 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4865.4865.2.dta 18 IPI00514320.3 Lamin A/C 224 57897 8 8 7 7 5039 2823 1 0 1 754.3672 1506.7198 2 1506.7348 -0.015 0 37.36 0.00065 R TALINSTGEEVAMR K Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4142.4142.2.dta 18 IPI00514320.3 Lamin A/C 224 57897 8 8 7 7 5066 7168 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 16.49 0.028 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.932.932.2.dta 18 IPI00514320.3 Lamin A/C 224 57897 8 8 7 7 6258 2947 1 0 1 584.9586 1751.854 3 1751.855 -0.001 0 20.61 0.012 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4277.4277.3.dta 18 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 213 55605 8 8 7 7 1371 402 1 0 1 460.2227 918.4309 2 918.4308 0.0002 0 58.72 2.30E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1437.1437.2.dta 18 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 213 55605 8 8 7 7 2099 3979 1 0 1 514.7901 1027.5656 2 1027.5662 -0.0005 0 78.01 2.60E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5394.5394.2.dta 18 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 213 55605 8 8 7 7 2185 2434 1 0 1 522.2772 1042.5399 2 1042.5407 -0.0008 0 39.65 0.00025 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3703.3703.2.dta 18 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 213 55605 8 8 7 7 4210 1816 1 0 1 680.3467 1358.6788 2 1358.679 -0.0002 0 50.56 1.80E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2985.2985.2.dta 18 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 213 55605 8 8 7 7 4975 3490 1 0 1 746.3759 1490.7372 2 1490.7399 -0.0027 0 36.7 0.00036 R TALINSTGEEVAMR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4865.4865.2.dta 18 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 213 55605 8 8 7 7 5039 2823 1 0 1 754.3672 1506.7198 2 1506.7348 -0.015 0 37.36 0.00065 R TALINSTGEEVAMR K Oxidation (M) 0.00000000000010.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4142.4142.2.dta 18 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 213 55605 8 8 7 7 5066 7168 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 16.49 0.028 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.932.932.2.dta 18 IPI00655812.1 Rhabdomyosarcoma antigen MU-RMS-40.12 213 55605 8 8 7 7 6258 2947 1 0 1 584.9586 1751.854 3 1751.855 -0.001 0 20.61 0.012 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4277.4277.3.dta 18 IPI00514204.3 Lamin A/C 172 53219 6 6 6 6 1371 402 1 0 1 460.2227 918.4309 2 918.4308 0.0002 0 58.72 2.30E-05 R SSFSQHAR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1437.1437.2.dta 18 IPI00514204.3 Lamin A/C 172 53219 6 6 6 6 2099 3979 1 0 1 514.7901 1027.5656 2 1027.5662 -0.0005 0 78.01 2.60E-07 R LADALQELR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5394.5394.2.dta 18 IPI00514204.3 Lamin A/C 172 53219 6 6 6 6 2185 2434 1 0 1 522.2772 1042.5399 2 1042.5407 -0.0008 0 39.65 0.00025 K EGDLIAAQAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3703.3703.2.dta 18 IPI00514204.3 Lamin A/C 172 53219 6 6 6 6 4210 1816 1 0 1 680.3467 1358.6788 2 1358.679 -0.0002 0 50.56 1.80E-05 R SGAQASSTPLSPTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2985.2985.2.dta 18 IPI00514204.3 Lamin A/C 172 53219 6 6 6 6 5066 7168 1 0 1 759.861 1517.7074 2 1517.707 0.0003 0 16.49 0.028 R ASSHSSQTQGGGSVTK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.932.932.2.dta 18 IPI00514204.3 Lamin A/C 172 53219 6 6 6 6 6258 2947 1 0 1 584.9586 1751.854 3 1751.855 -0.001 0 20.61 0.012 R NSNLVGAAHEELQQSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4277.4277.3.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 415 3113 1 1 0 365.7269 729.4392 2 729.4385 0.0007 0 41.45 0.0019 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4457.4457.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 428 2207 1 1 1 367.2263 732.438 2 732.4382 -0.0001 0 28.41 0.0089 K SLVSVTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3434.3434.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 842 5115 1 1 1 415.2684 828.5222 2 828.5221 0.0001 0 36.42 0.0017 R ALLFIPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6566.6566.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 2744 1233 1 1 1 571.2827 1140.5509 2 1140.5523 -0.0015 0 37.85 0.00028 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2350.2350.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 2745 1232 1 1 1 381.1918 1140.5537 3 1140.5523 0.0013 0 36.72 0.00067 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2349.2349.3.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 2848 3389 1 1 1 580.795 1159.5755 2 1159.5761 -0.0005 0 42.16 0.00011 K SIYYITGESK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4756.4756.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 3064 3869 1 1 1 597.8271 1193.6396 2 1193.6404 -0.0008 0 30.14 0.012 K IDIIPNPQER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5275.5275.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 3468 2548 1 1 1 625.3112 1248.6079 2 1248.6098 -0.002 0 25.16 0.0044 K EQVANSAFVER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3838.3838.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 4154 4676 1 1 1 675.3685 1348.7224 2 1348.7272 -0.0048 0 30.81 0.0013 R TLTLVDTGIGMTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6120.6120.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 4249 4139 1 1 1 683.3672 1364.7199 2 1364.7221 -0.0022 0 51.68 1.90E-05 R TLTLVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5567.5567.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 5053 4496 1 1 0 757.3953 1512.7761 2 1512.7784 -0.0023 0 96.61 3.80E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5938.5938.2.dta 19 1 IPI00334775.6 85 kDa protein 293 85104 12 12 10 10 6506 4096 1 1 1 924.4011 1846.7876 2 1846.7897 -0.0021 0 44.2 0.00019 R NPDDITQEEYGEFYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5521.5521.2.dta 19 2 IPI00789847.1 Protein 188 90500 8 8 7 7 18 341 6 0 1 301.1747 600.3348 2 600.3344 0.0005 0 28.7 0.027 K AGAGVAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1371.1371.2.dta 19 2 IPI00789847.1 Protein 188 90500 8 8 7 7 210 495 1 0 1 337.2033 672.3921 2 672.3919 0.0002 0 20.9 0.044 K VVVSNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1538.1538.2.dta 19 2 IPI00789847.1 Protein 188 90500 8 8 7 7 415 3113 1 0 0 365.7269 729.4392 2 729.4385 0.0007 0 41.45 0.0019 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4457.4457.2.dta 19 2 IPI00789847.1 Protein 188 90500 8 8 7 7 1558 2830 1 0 1 474.7264 947.4383 2 947.4389 -0.0006 0 35.23 0.0042 K FYEQFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4150.4150.2.dta 19 2 IPI00789847.1 Protein 188 90500 8 8 7 7 2549 5290 1 0 1 554.7742 1107.5338 2 1107.5349 -0.0011 0 29.08 0.0019 R APFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6741.6741.2.dta 19 2 IPI00789847.1 Protein 188 90500 8 8 7 7 4154 4676 1 0 1 675.3685 1348.7224 2 1348.7272 -0.0048 0 30.81 0.0013 R TLTIVDTGIGMTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6120.6120.2.dta 19 2 IPI00789847.1 Protein 188 90500 8 8 7 7 4249 4139 1 0 1 683.3672 1364.7199 2 1364.7221 -0.0022 0 51.68 1.90E-05 R TLTIVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5567.5567.2.dta 19 2 IPI00789847.1 Protein 188 90500 8 8 7 7 5053 4496 1 0 0 757.3953 1512.7761 2 1512.7784 -0.0023 0 96.61 3.80E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5938.5938.2.dta 19 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 186 19120 6 6 5 5 415 3113 1 0 0 365.7269 729.4392 2 729.4385 0.0007 0 41.45 0.0019 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4457.4457.2.dta 19 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 186 19120 6 6 5 5 2744 1233 1 0 1 571.2827 1140.5509 2 1140.5523 -0.0015 0 37.85 0.00028 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2350.2350.2.dta 19 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 186 19120 6 6 5 5 2745 1232 1 0 1 381.1918 1140.5537 3 1140.5523 0.0013 0 36.72 0.00067 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2349.2349.3.dta 19 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 186 19120 6 6 5 5 2848 3389 1 0 1 580.795 1159.5755 2 1159.5761 -0.0005 0 42.16 0.00011 K SIYYITGESK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4756.4756.2.dta 19 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 186 19120 6 6 5 5 3468 2548 1 0 1 625.3112 1248.6079 2 1248.6098 -0.002 0 25.16 0.0044 K EQVANSAFVER C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3838.3838.2.dta 19 IPI00515119.3 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 186 19120 6 6 5 5 5053 4496 1 0 0 757.3953 1512.7761 2 1512.7784 -0.0023 0 96.61 3.80E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5938.5938.2.dta 19 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 176 18245 5 5 4 4 415 3113 1 0 0 365.7269 729.4392 2 729.4385 0.0007 0 41.45 0.0019 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4457.4457.2.dta 19 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 176 18245 5 5 4 4 2744 1233 1 0 1 571.2827 1140.5509 2 1140.5523 -0.0015 0 37.85 0.00028 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2350.2350.2.dta 19 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 176 18245 5 5 4 4 2745 1232 1 0 1 381.1918 1140.5537 3 1140.5523 0.0013 0 36.72 0.00067 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2349.2349.3.dta 19 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 176 18245 5 5 4 4 2848 3389 1 0 1 580.795 1159.5755 2 1159.5761 -0.0005 0 42.16 0.00011 K SIYYITGESK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4756.4756.2.dta 19 IPI00640129.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 176 18245 5 5 4 4 5053 4496 1 0 0 757.3953 1512.7761 2 1512.7784 -0.0023 0 96.61 3.80E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5938.5938.2.dta 19 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 150 20112 4 4 3 3 415 3113 1 0 0 365.7269 729.4392 2 729.4385 0.0007 0 41.45 0.0019 R LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4457.4457.2.dta 19 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 150 20112 4 4 3 3 2744 1233 1 0 1 571.2827 1140.5509 2 1140.5523 -0.0015 0 37.85 0.00028 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2350.2350.2.dta 19 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 150 20112 4 4 3 3 2745 1232 1 0 1 381.1918 1140.5537 3 1140.5523 0.0013 0 36.72 0.00067 K LGIHEDSTNR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2349.2349.3.dta 19 IPI00514659.2 "Heat shock protein 90kDa alpha (Cytosolic), class B member 1" 150 20112 4 4 3 3 5053 4496 1 0 0 757.3953 1512.7761 2 1512.7784 -0.0023 0 96.61 3.80E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5938.5938.2.dta 19 IPI00604607.2 Hsp89-alpha-delta-N 135 63839 5 5 5 5 210 495 1 0 1 337.2033 672.3921 2 672.3919 0.0002 0 20.9 0.044 K VVVSNR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1538.1538.2.dta 19 IPI00604607.2 Hsp89-alpha-delta-N 135 63839 5 5 5 5 415 3113 1 0 0 365.7269 729.4392 2 729.4385 0.0007 0 41.45 0.0019 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4457.4457.2.dta 19 IPI00604607.2 Hsp89-alpha-delta-N 135 63839 5 5 5 5 1558 2830 1 0 1 474.7264 947.4383 2 947.4389 -0.0006 0 35.23 0.0042 K FYEQFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4150.4150.2.dta 19 IPI00604607.2 Hsp89-alpha-delta-N 135 63839 5 5 5 5 2549 5290 1 0 1 554.7742 1107.5338 2 1107.5349 -0.0011 0 29.08 0.0019 R APFDLFENR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6741.6741.2.dta 19 IPI00604607.2 Hsp89-alpha-delta-N 135 63839 5 5 5 5 5053 4496 1 0 0 757.3953 1512.7761 2 1512.7784 -0.0023 0 96.61 3.80E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5938.5938.2.dta 19 IPI00796258.1 12 kDa protein 123 11880 3 3 3 3 415 3113 1 0 0 365.7269 729.4392 2 729.4385 0.0007 0 41.45 0.0019 K LSELLR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4457.4457.2.dta 19 IPI00796258.1 12 kDa protein 123 11880 3 3 3 3 1558 2830 1 0 1 474.7264 947.4383 2 947.4389 -0.0006 0 35.23 0.0042 K FYEQFSK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4150.4150.2.dta 19 IPI00796258.1 12 kDa protein 123 11880 3 3 3 3 5053 4496 1 0 0 757.3953 1512.7761 2 1512.7784 -0.0023 0 96.61 3.80E-09 R GVVDSEDLPLNISR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5938.5938.2.dta 19 IPI00030275.5 "Heat shock protein 75 kDa, mitochondrial precursor" 97 80345 1 1 1 1 5053 4496 1 0 1 757.3953 1512.7761 2 1512.7784 -0.0023 0 96.61 3.80E-09 R GVVDSEDIPLNLSR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5938.5938.2.dta 19 IPI00411633.3 Heat shock protein beta 76 17005 3 3 2 2 3064 3869 1 0 1 597.8271 1193.6396 2 1193.6404 -0.0008 0 30.14 0.012 K IDIIPNPQER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5275.5275.2.dta 19 IPI00411633.3 Heat shock protein beta 76 17005 3 3 2 2 4154 4676 1 0 1 675.3685 1348.7224 2 1348.7272 -0.0048 0 30.81 0.0013 R TLTLVDTGIGMTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6120.6120.2.dta 19 IPI00411633.3 Heat shock protein beta 76 17005 3 3 2 2 4249 4139 1 0 1 683.3672 1364.7199 2 1364.7221 -0.0022 0 51.68 1.90E-05 R TLTLVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5567.5567.2.dta 19 IPI00555957.1 Heat shock protein 90Ad 67 47796 2 2 1 1 4154 4676 1 0 1 675.3685 1348.7224 2 1348.7272 -0.0048 0 30.81 0.0013 R TLTIVDTGIGMTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6120.6120.2.dta 19 IPI00555957.1 Heat shock protein 90Ad 67 47796 2 2 1 1 4249 4139 1 0 1 683.3672 1364.7199 2 1364.7221 -0.0022 0 51.68 1.90E-05 R TLTIVDTGIGMTK A Oxidation (M) 0.0000000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5567.5567.2.dta 19 IPI00455599.3 Heat shock protein 90Bb 53 49505 2 2 2 2 428 2207 1 0 1 367.2263 732.438 2 732.4382 -0.0001 0 28.41 0.0089 K SLVSVTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3434.3434.2.dta 19 IPI00455599.3 Heat shock protein 90Bb 53 49505 2 2 2 2 2848 3389 1 0 1 580.795 1159.5755 2 1159.5761 -0.0005 0 42.16 0.00011 K SIYYITGESK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4756.4756.2.dta 19 IPI00555614.1 Heat shock protein 90Bc 45 68624 3 3 3 3 428 2207 1 0 1 367.2263 732.438 2 732.4382 -0.0001 0 28.41 0.0089 K SLVSVTK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3434.3434.2.dta 19 IPI00555614.1 Heat shock protein 90Bc 45 68624 3 3 3 3 3064 3869 1 0 1 597.8271 1193.6396 2 1193.6404 -0.0008 0 30.14 0.012 K IDIIPNPQER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5275.5275.2.dta 19 IPI00555614.1 Heat shock protein 90Bc 45 68624 3 3 3 3 3468 2548 1 0 1 625.3112 1248.6079 2 1248.6098 -0.002 0 25.16 0.0044 K EQVANSAFVER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3838.3838.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 204 3449 1 1 1 336.7238 671.433 2 671.433 0 0 38.72 0.0023 R IGLLTR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4821.4821.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 1017 3616 1 1 1 425.737 849.4595 2 849.4596 -0.0001 0 33.08 0.0082 R FLLDTNK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5002.5002.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 1662 1032 1 1 1 321.1859 960.5359 3 960.5352 0.0007 1 20 0.04 K IRELTSSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2121.2121.3.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 1875 1231 1 1 1 332.5298 994.5677 3 994.5672 0.0005 1 16.24 0.03 R RIVDLHSR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2348.2348.3.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 1899 1545 1 1 1 500.7454 999.4762 2 999.4774 -0.0012 0 36.27 0.0004 K HVEEFSPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2689.2689.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 2119 3334 1 1 1 516.2341 1030.4537 2 1030.4542 -0.0005 0 45.83 5.00E-05 R LGFSEYCR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4696.4696.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 2997 2330 1 1 1 592.8165 1183.6184 2 1183.6197 -0.0013 0 18.43 0.019 R IQETQAELPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3587.3587.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 2998 2298 1 1 1 592.8168 1183.6191 2 1183.6197 -0.0006 0 73.12 8.50E-07 R IQETQAELPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3543.3543.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 4358 3916 1 1 1 693.8246 1385.6346 2 1385.6351 -0.0004 0 63.24 2.20E-06 K ESEDFIVEQYK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5326.5326.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 4855 5602 1 1 1 736.3649 1470.7153 2 1470.7143 0.001 0 40.74 0.0004 K DFYVAFQDLPTR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7059.7059.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 5172 3688 1 1 1 773.3806 1544.7467 2 1544.7505 -0.0038 0 42.95 0.00034 R GDINVCIVGDPSTAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5080.5080.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 5500 4769 1 1 1 809.4142 1616.8139 2 1616.8167 -0.0028 0 47.63 5.00E-05 R LVFLACCVAPTNPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6214.6214.2.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 5982 3930 1 1 1 562.625 1684.8532 3 1684.8533 -0.0001 0 26.11 0.0053 R TSILAAANPISGHYDR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5341.5341.3.dta 20 1 IPI00031517.1 DNA replication licensing factor MCM6 290 93801 14 14 13 13 6131 3509 1 1 1 572.2894 1713.8463 3 1713.8461 0.0002 1 31.97 0.0031 K ISKESEDFIVEQYK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4886.4886.3.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 1272 4161 1 1 1 450.7794 899.5442 2 899.544 0.0002 0 53.59 4.20E-05 K VLLSALER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5591.5591.2.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 2911 5710 1 1 1 585.3547 1168.6948 2 1168.6968 -0.002 0 20.56 0.012 K GVPTGFILPIR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7169.7169.2.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 3096 3231 1 1 1 600.3171 1198.6197 2 1198.6194 0.0004 0 26.39 0.0033 K TPVPSDIDISR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4585.4585.2.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 4062 4784 1 1 1 668.3301 1334.6457 2 1334.6475 -0.0018 0 20.99 0.011 K QGFGNLPICMAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6229.6229.2.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 4306 4195 1 1 1 689.8373 1377.66 2 1377.6623 -0.0023 0 62.12 1.00E-05 K TDTESELDLISR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5627.5627.2.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 4385 1247 1 1 1 464.2407 1389.7002 3 1389.7001 0.0002 0 17.82 0.031 K THLSLSHNPEQK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2365.2365.3.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 4960 5032 1 1 1 743.8833 1485.752 2 1485.7464 0.0057 0 75.85 1.80E-07 R LDIDPETITWQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6482.6482.2.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 5139 4088 1 1 1 768.843 1535.6714 2 1535.6749 -0.0035 0 54.64 8.40E-06 R GDLNDCFIPCTPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5512.5512.2.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 5616 4445 1 1 1 815.9548 1629.895 2 1629.8978 -0.0028 0 57.38 4.20E-06 K YVVVTGITPTPLGEGK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5887.5887.2.dta 21 1 IPI00218342.10 "C-1-tetrahydrofolate synthase, cytoplasmic" 269 102180 10 10 10 10 6882 3486 1 1 1 682.3494 2044.0265 3 2044.0324 -0.006 1 34.69 0.00056 R LGIEKTDPTTLTDEEINR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4861.4861.3.dta 22 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 263 193260 8 8 8 8 822 4242 1 1 1 413.247 824.4795 2 824.4796 -0.0001 0 25.27 0.025 R IAAYLFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5677.5677.2.dta 22 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 263 193260 8 8 8 8 2268 798 1 1 1 530.2931 1058.5716 2 1058.572 -0.0004 1 49.41 0.00014 K TGQIKEVER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1868.1868.2.dta 22 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 263 193260 8 8 8 8 2665 3574 1 1 1 563.7976 1125.5807 2 1125.5818 -0.0012 0 42.67 0.00037 K VANVELYYR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4956.4956.2.dta 22 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 263 193260 8 8 8 8 3819 3992 1 1 1 648.838 1295.6614 2 1295.6622 -0.0009 0 49.68 2.20E-05 K LLYNNVSNFGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5408.5408.2.dta 22 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 263 193260 8 8 8 8 3867 4700 1 1 1 652.8324 1303.6502 2 1303.652 -0.0018 0 79.51 5.80E-08 R NNLAGAEELFAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6145.6145.2.dta 22 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 263 193260 8 8 8 8 4056 2194 1 1 1 667.819 1333.6234 2 1333.6262 -0.0028 0 72.46 9.40E-07 K IYIDSNNNPER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3419.3419.2.dta 22 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 263 193260 8 8 8 8 4458 4328 1 1 1 701.8422 1401.6699 2 1401.6711 -0.0012 0 52.53 7.90E-05 R CNEPAVWSQLAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5766.5766.2.dta 22 1 IPI00024067.4 Isoform 1 of Clathrin heavy chain 1 263 193260 8 8 8 8 6320 1124 1 1 1 592.9481 1775.8225 3 1775.826 -0.0035 0 37.09 0.00033 R IHEGCEEPATHNALAK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2227.2227.3.dta 22 IPI00022881.1 Isoform 1 of Clathrin heavy chain 2 49 189020 1 1 1 1 2268 798 1 0 1 530.2931 1058.5716 2 1058.572 -0.0004 1 49.41 0.00014 K TGQIKEVER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1868.1868.2.dta 23 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 262 107484 8 8 8 8 400 3204 1 1 0 364.6842 727.3539 2 727.3541 -0.0002 0 22.75 0.042 R FDFTAK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4555.4555.2.dta 23 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 262 107484 8 8 8 8 3291 234 1 1 1 614.3251 1226.6357 2 1226.6367 -0.001 1 30.43 0.0014 K AQTAPNKDVQR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1256.1256.2.dta 23 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 262 107484 8 8 8 8 3413 1453 1 1 1 621.8622 1241.7099 2 1241.7092 0.0008 1 24.57 0.016 R RIVAVTGAEAQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2589.2589.2.dta 23 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 262 107484 8 8 8 8 4493 2912 1 1 1 704.3505 1406.6864 2 1406.6864 0 0 71.71 1.90E-07 K AVYTQDCPLAAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4239.4239.2.dta 23 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 262 107484 8 8 8 8 4497 3970 1 1 1 704.8398 1407.6651 2 1407.6671 -0.0019 0 47.03 8.20E-05 R AVFDETYPDPVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5384.5384.2.dta 23 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 262 107484 8 8 8 8 4917 5375 1 1 1 738.8824 1475.7502 2 1475.7507 -0.0005 0 63.63 9.50E-06 K DIINEEEVQFLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6827.6827.2.dta 23 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 262 107484 8 8 8 8 4945 3503 1 1 1 741.8291 1481.6437 2 1481.6456 -0.002 0 70.87 2.30E-07 K VGAEDADGIDMAYR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4879.4879.2.dta 23 1 IPI00027442.4 "Alanyl-tRNA synthetase, cytoplasmic" 262 107484 8 8 8 8 5748 2629 1 1 1 822.9009 1643.7873 2 1643.7872 0.0001 0 62.59 1.70E-06 K ITCLCQVPQNAANR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3929.3929.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 433 2095 1 1 1 368.2051 734.3957 2 734.3963 -0.0006 0 36.75 0.002 K TTWVTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3296.3296.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 575 774 1 1 1 387.2025 772.3905 2 772.3902 0.0004 0 36.36 0.004 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1842.1842.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 787 3349 1 1 1 410.2398 818.4651 2 818.465 0.0001 0 35.36 0.0037 K FIEIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4712.4712.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 1270 873 1 1 1 450.77 899.5254 2 899.5263 -0.0009 1 35.47 0.0047 R KAVVVCPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1949.1949.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 1510 1549 1 1 1 471.2922 940.5699 2 940.5706 -0.0007 1 25.45 0.017 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2693.2693.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 1512 1541 1 1 1 314.5313 940.5719 3 940.5706 0.0014 1 23.24 0.02 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2685.2685.3.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 1881 2454 1 1 1 498.7583 995.502 2 995.5036 -0.0016 0 33.48 0.0047 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3726.3726.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 2214 3368 1 1 1 524.7745 1047.5344 2 1047.5349 -0.0005 0 46.08 4.80E-05 K NGQDLGVAFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4733.4733.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 2775 4569 1 1 1 573.2648 1144.5151 2 1144.5158 -0.0007 0 31.69 0.0037 K MCLFAGFQR K Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6013.6013.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 4338 4611 1 1 1 691.8526 1381.6906 2 1381.6911 -0.0005 0 46.49 0.0003 K YNILGTNTIMDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6055.6055.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 5762 4155 1 1 1 824.4252 1646.8359 2 1646.8376 -0.0017 0 114.78 8.20E-11 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5585.5585.2.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 6060 4029 1 1 1 566.5983 1696.773 3 1696.7733 -0.0003 1 16.96 0.026 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5448.5448.3.dta 24 1 IPI00479217.1 Isoform Short of Heterogeneous nuclear ribonucleoprotein U 249 89665 13 13 12 12 6138 5163 1 1 1 857.9587 1713.9029 2 1713.905 -0.0021 0 23.13 0.045 K SSGPTSLFAVTVAPPGAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6612.6612.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 433 2095 1 0 1 368.2051 734.3957 2 734.3963 -0.0006 0 36.75 0.002 K TTWVTK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3296.3296.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 575 774 1 0 1 387.2025 772.3905 2 772.3902 0.0004 0 36.36 0.004 R APQCLGK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1842.1842.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 787 3349 1 0 1 410.2398 818.4651 2 818.465 0.0001 0 35.36 0.0037 K FIEIAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4712.4712.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 1270 873 1 0 1 450.77 899.5254 2 899.5263 -0.0009 1 35.47 0.0047 R KAVVVCPK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1949.1949.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 1510 1549 1 0 1 471.2922 940.5699 2 940.5706 -0.0007 1 25.45 0.017 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2693.2693.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 1512 1541 1 0 1 314.5313 940.5719 3 940.5706 0.0014 1 23.24 0.02 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2685.2685.3.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 1881 2454 1 0 1 498.7583 995.502 2 995.5036 -0.0016 0 33.48 0.0047 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3726.3726.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 2214 3368 1 0 1 524.7745 1047.5344 2 1047.5349 -0.0005 0 46.08 4.80E-05 K NGQDLGVAFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4733.4733.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 2775 4569 1 0 1 573.2648 1144.5151 2 1144.5158 -0.0007 0 31.69 0.0037 K MCLFAGFQR K Oxidation (M) 0.100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6013.6013.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 4338 4611 1 0 1 691.8526 1381.6906 2 1381.6911 -0.0005 0 46.49 0.0003 K YNILGTNTIMDK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6055.6055.2.dta 24 IPI00644224.1 Heterogeneous nuclear ribonucleoprotein U 245 62395 11 11 10 10 5762 4155 1 0 1 824.4252 1646.8359 2 1646.8376 -0.0017 0 114.78 8.20E-11 R NFILDQTNVSAAAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5585.5585.2.dta 24 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 72 27900 5 5 4 4 1510 1549 1 0 1 471.2922 940.5699 2 940.5706 -0.0007 1 25.45 0.017 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2693.2693.2.dta 24 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 72 27900 5 5 4 4 1512 1541 1 0 1 314.5313 940.5719 3 940.5706 0.0014 1 23.24 0.02 K VTEKIPVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2685.2685.3.dta 24 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 72 27900 5 5 4 4 1881 2454 1 0 1 498.7583 995.502 2 995.5036 -0.0016 0 33.48 0.0047 K DIDIHEVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3726.3726.2.dta 24 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 72 27900 5 5 4 4 2214 3368 1 0 1 524.7745 1047.5344 2 1047.5349 -0.0005 0 46.08 4.80E-05 K NGQDLGVAFK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4733.4733.2.dta 24 IPI00640106.1 Heterogeneous nuclear ribonucleoprotein U 72 27900 5 5 4 4 6060 4029 1 0 1 566.5983 1696.773 3 1696.7733 -0.0003 1 16.96 0.026 R GYFEYIEENKYSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5448.5448.3.dta 25 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 239 62320 9 9 9 9 674 194 1 1 1 399.1806 796.3466 2 796.3464 0.0002 0 22.52 0.021 R GGSGGSYGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1213.1213.2.dta 25 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 239 62320 9 9 9 9 759 328 1 1 1 406.7529 811.4913 2 811.4916 -0.0003 1 38.74 0.0011 K KGPAAIQK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1357.1357.2.dta 25 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 239 62320 9 9 9 9 1245 4095 1 1 1 449.2101 896.4056 2 896.4062 -0.0006 0 32.11 0.0022 R MTLDDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5520.5520.2.dta 25 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 239 62320 9 9 9 9 1669 304 1 1 1 481.7485 961.4825 2 961.4828 -0.0004 1 36.75 0.004 K SLEDTKNR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1331.1331.2.dta 25 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 239 62320 9 9 9 9 2275 3862 1 1 1 530.7847 1059.5548 2 1059.556 -0.0012 0 37.87 0.0015 K TLLDIDNTR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5267.5267.2.dta 25 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 239 62320 9 9 9 9 2350 2993 1 1 1 537.7641 1073.5136 2 1073.5142 -0.0005 0 34.08 0.0027 R QFSSSYLSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4327.4327.2.dta 25 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 239 62320 9 9 9 9 3320 1680 1 1 1 616.8024 1231.5902 2 1231.5906 -0.0004 0 81.89 2.10E-08 R SGGGGGGGLGSGGSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2835.2835.2.dta 25 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 239 62320 9 9 9 9 3361 1162 1 1 1 618.2707 1234.5268 2 1234.5215 0.0054 0 80.56 3.80E-08 R FSSSSGYGGGSSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2273.2273.2.dta 25 1 IPI00019359.3 "Keratin, type I cytoskeletal 9" 239 62320 9 9 9 9 6348 952 1 1 1 597.9136 1790.7189 3 1790.7205 -0.0016 0 32.26 0.00098 R GGSGGSYGGGGSGGGYGGGSGSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2034.2034.3.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 663 292 1 1 1 397.7115 793.4085 2 793.4083 0.0002 0 42.94 0.00019 K QGPGPGGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1318.1318.2.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 1213 2464 1 1 1 443.7529 885.4913 2 885.492 -0.0007 0 39.3 0.001 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3739.3739.2.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 2506 1945 1 1 1 550.3118 1098.6091 2 1098.6146 -0.0055 1 39.86 0.00018 R AVVIVDDRGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3125.3125.2.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 2721 1373 1 1 1 568.7598 1135.5051 2 1135.5081 -0.003 0 53.76 9.10E-06 R GMGPGTPAGYGR G Oxidation (M) 0.010000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2502.2502.2.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 2760 2350 1 1 1 381.8821 1142.6246 3 1142.6196 0.005 0 44.09 0.00059 R FATHAAALSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3610.3610.3.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 2815 4466 1 1 1 577.3211 1152.6277 2 1152.6291 -0.0015 1 28.46 0.021 K GFGFIKLESR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5907.5907.2.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 3427 2794 1 1 1 623.3502 1244.6858 2 1244.6877 -0.0019 0 44.82 0.00024 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4111.4111.2.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 3484 3655 1 1 1 626.8127 1251.6108 2 1251.6135 -0.0027 0 64.69 1.20E-06 K YGEPGEVFINK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5044.5044.2.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 3714 1057 1 1 1 642.311 1282.6075 2 1282.6088 -0.0013 0 18.63 0.018 R SPPPGMGLNQNR G Oxidation (M) 0.000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2148.2148.2.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 4128 318 1 1 1 673.8382 1345.6618 2 1345.6626 -0.0007 1 18.47 0.023 R EEYEGPNKKPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1346.1346.2.dta 26 1 IPI00010740.1 "Isoform Long of Splicing factor, proline- and glutamine-rich" 235 76216 11 11 11 11 6285 2895 1 1 1 588.2654 1761.7745 3 1761.7747 -0.0002 0 23.09 0.0068 R FAQHGTFEYEYSQR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4220.4220.3.dta 26 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 195 72332 9 9 9 9 663 292 1 0 1 397.7115 793.4085 2 793.4083 0.0002 0 42.94 0.00019 K QGPGPGGPK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1318.1318.2.dta 26 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 195 72332 9 9 9 9 1213 2464 1 0 1 443.7529 885.4913 2 885.492 -0.0007 0 39.3 0.001 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3739.3739.2.dta 26 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 195 72332 9 9 9 9 2506 1945 1 0 1 550.3118 1098.6091 2 1098.6146 -0.0055 1 39.86 0.00018 R AVVIVDDRGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3125.3125.2.dta 26 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 195 72332 9 9 9 9 2760 2350 1 0 1 381.8821 1142.6246 3 1142.6196 0.005 0 44.09 0.00059 R FATHAAALSVR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3610.3610.3.dta 26 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 195 72332 9 9 9 9 2815 4466 1 0 1 577.3211 1152.6277 2 1152.6291 -0.0015 1 28.46 0.021 K GFGFIKLESR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5907.5907.2.dta 26 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 195 72332 9 9 9 9 3427 2794 1 0 1 623.3502 1244.6858 2 1244.6877 -0.0019 0 44.82 0.00024 K GIVEFASKPAAR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4111.4111.2.dta 26 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 195 72332 9 9 9 9 3484 3655 1 0 1 626.8127 1251.6108 2 1251.6135 -0.0027 0 64.69 1.20E-06 K YGEPGEVFINK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5044.5044.2.dta 26 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 195 72332 9 9 9 9 3714 1057 1 0 1 642.311 1282.6075 2 1282.6088 -0.0013 0 18.63 0.018 R SPPPGMGLNQNR G Oxidation (M) 0.000001000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2148.2148.2.dta 26 IPI00216613.1 "Isoform Short of Splicing factor, proline- and glutamine-rich" 195 72332 9 9 9 9 6285 2895 1 0 1 588.2654 1761.7745 3 1761.7747 -0.0002 0 23.09 0.0068 R FAQHGTFEYEYSQR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4220.4220.3.dta 26 IPI00304596.3 Non-POU domain-containing octamer-binding protein 39 54311 1 1 1 1 1213 2464 1 0 1 443.7529 885.4913 2 885.492 -0.0007 0 39.3 0.001 R AVVIVDDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3739.3739.2.dta 27 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 234 92970 8 8 8 8 275 2291 1 1 0 346.69 691.3655 2 691.3653 0.0002 0 29.97 0.029 K IAADFR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3534.3534.2.dta 27 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 234 92970 8 8 8 8 449 4486 1 1 0 374.7394 747.4642 2 747.4643 -0.0001 0 26.96 0.01 K VLTFLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5928.5928.2.dta 27 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 234 92970 8 8 8 8 1150 991 1 1 0 436.2248 870.435 2 870.4348 0.0002 0 35.23 0.0039 R NHAAPFSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2077.2077.2.dta 27 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 234 92970 8 8 8 8 2390 4333 1 1 1 540.2803 1078.546 2 1078.5447 0.0013 0 34.23 0.0017 R AFNDPFIQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5770.5770.2.dta 27 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 234 92970 8 8 8 8 2622 2448 1 1 1 560.3112 1118.6078 2 1118.6084 -0.0006 0 67.11 2.50E-06 R FVVQNVSAQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3719.3719.2.dta 27 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 234 92970 8 8 8 8 4908 3685 1 1 0 738.3691 1474.7237 2 1474.7263 -0.0026 0 88.41 1.20E-08 K DISTTLNADEAVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5076.5076.2.dta 27 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 234 92970 8 8 8 8 4932 4869 1 1 1 740.357 1478.6994 2 1478.7001 -0.0007 0 42.56 0.0001 R AGGIETIANEFSDR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6314.6314.2.dta 27 1 IPI00218993.1 Isoform Beta of Heat-shock protein 105 kDa 234 92970 8 8 8 8 5135 5012 1 1 0 768.3891 1534.7636 2 1534.7636 0 0 58.56 6.80E-06 R GCALQCAILSPAFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6461.6461.2.dta 27 2 IPI00002966.1 Heat shock 70 kDa protein 4 188 95096 4 4 4 4 1150 991 1 0 0 436.2248 870.435 2 870.4348 0.0002 0 35.23 0.0039 K NHAAPFSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2077.2077.2.dta 27 2 IPI00002966.1 Heat shock 70 kDa protein 4 188 95096 4 4 4 4 3986 4441 1 0 1 661.3591 1320.7037 2 1320.7038 -0.0001 0 102.52 1.00E-09 K VLATAFDTTLGGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5883.5883.2.dta 27 2 IPI00002966.1 Heat shock 70 kDa protein 4 188 95096 4 4 4 4 4990 3809 1 0 1 748.354 1494.6935 2 1494.695 -0.0016 0 56.86 1.00E-05 R AGGIETIANEYSDR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5210.5210.2.dta 27 2 IPI00002966.1 Heat shock 70 kDa protein 4 188 95096 4 4 4 4 5135 5012 1 0 0 768.3891 1534.7636 2 1534.7636 0 0 58.56 6.80E-06 R GCALQCAILSPAFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6461.6461.2.dta 27 3 IPI00295485.1 Heat shock 70 kDa protein 4L 147 95453 3 3 3 3 3890 3595 1 0 1 653.8166 1305.6187 2 1305.6201 -0.0014 0 39.65 0.00043 R SFDDPIVQTER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4979.4979.2.dta 27 3 IPI00295485.1 Heat shock 70 kDa protein 4L 147 95453 3 3 3 3 4908 3685 1 0 0 738.3691 1474.7237 2 1474.7263 -0.0026 0 88.41 1.20E-08 K DISTTLNADEAVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5076.5076.2.dta 27 3 IPI00295485.1 Heat shock 70 kDa protein 4L 147 95453 3 3 3 3 5135 5012 1 0 0 768.3891 1534.7636 2 1534.7636 0 0 58.56 6.80E-06 R GCALQCAILSPAFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6461.6461.2.dta 27 IPI00796127.1 97 kDa protein 208 98196 7 7 7 7 275 2291 1 0 0 346.69 691.3655 2 691.3653 0.0002 0 29.97 0.029 K IAADFR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3534.3534.2.dta 27 IPI00796127.1 97 kDa protein 208 98196 7 7 7 7 449 4486 1 0 0 374.7394 747.4642 2 747.4643 -0.0001 0 26.96 0.01 K VLTFLR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5928.5928.2.dta 27 IPI00796127.1 97 kDa protein 208 98196 7 7 7 7 1150 991 1 0 0 436.2248 870.435 2 870.4348 0.0002 0 35.23 0.0039 R NHAAPFSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2077.2077.2.dta 27 IPI00796127.1 97 kDa protein 208 98196 7 7 7 7 2390 4333 1 0 1 540.2803 1078.546 2 1078.5447 0.0013 0 34.23 0.0017 R AFNDPFIQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5770.5770.2.dta 27 IPI00796127.1 97 kDa protein 208 98196 7 7 7 7 2622 2448 1 0 1 560.3112 1118.6078 2 1118.6084 -0.0006 0 67.11 2.50E-06 R FVVQNVSAQK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3719.3719.2.dta 27 IPI00796127.1 97 kDa protein 208 98196 7 7 7 7 4908 3685 1 0 0 738.3691 1474.7237 2 1474.7263 -0.0026 0 88.41 1.20E-08 K DISTTLNADEAVAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5076.5076.2.dta 27 IPI00796127.1 97 kDa protein 208 98196 7 7 7 7 5135 5012 1 0 0 768.3891 1534.7636 2 1534.7636 0 0 58.56 6.80E-06 R GCALQCAILSPAFK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6461.6461.2.dta 27 IPI00031022.1 heat shock 70kDa protein 4 isoform b 57 15851 1 1 1 1 4990 3809 1 0 1 748.354 1494.6935 2 1494.695 -0.0016 0 56.86 1.00E-05 R AGGIETIANEYSDR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5210.5210.2.dta 28 1 IPI00017303.1 DNA mismatch repair protein Msh2 205 105418 6 6 6 6 1801 3367 1 1 1 494.2951 986.5757 2 986.576 -0.0003 0 54.63 5.90E-05 K NLQSVVLSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4732.4732.2.dta 28 1 IPI00017303.1 DNA mismatch repair protein Msh2 205 105418 6 6 6 6 3085 2495 1 1 1 599.3044 1196.5943 2 1196.5925 0.0019 0 40.86 0.00015 K LTSLNEEYTK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3776.3776.2.dta 28 1 IPI00017303.1 DNA mismatch repair protein Msh2 205 105418 6 6 6 6 3386 1994 1 1 1 619.7808 1237.547 2 1237.5509 -0.004 0 61.98 5.40E-06 R QAANLQDCYR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3178.3178.2.dta 28 1 IPI00017303.1 DNA mismatch repair protein Msh2 205 105418 6 6 6 6 3420 5857 1 1 1 622.3478 1242.6811 2 1242.6819 -0.0008 0 37.1 0.0026 K DSLIIIDELGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7317.7317.2.dta 28 1 IPI00017303.1 DNA mismatch repair protein Msh2 205 105418 6 6 6 6 3789 4712 1 1 1 646.8314 1291.6482 2 1291.652 -0.0039 0 62.12 1.20E-05 K NNSFVNEIISR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6157.6157.2.dta 28 1 IPI00017303.1 DNA mismatch repair protein Msh2 205 105418 6 6 6 6 3981 3336 1 1 1 660.8481 1319.6817 2 1319.6834 -0.0016 0 61.24 9.80E-06 R QVGVGYVDSIQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4698.4698.2.dta 28 IPI00783458.1 MSH2-Ex5 isoform (Fragment) 62 11803 1 1 1 1 3386 1994 1 0 1 619.7808 1237.547 2 1237.5509 -0.004 0 61.98 5.40E-06 R QAANLQDCYR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3178.3178.2.dta 28 IPI00783348.1 MSH2-Ex3 isoform (Fragment) 55 23694 1 1 1 1 1801 3367 1 0 1 494.2951 986.5757 2 986.576 -0.0003 0 54.63 5.90E-05 K NLQSVVLSK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4732.4732.2.dta 29 1 IPI00291175.7 Isoform 1 of Vinculin 201 117220 8 8 8 8 886 842 1 1 1 419.7296 837.4447 2 837.4457 -0.001 0 35.73 0.0013 R GLVAEGHR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1915.1915.2.dta 29 1 IPI00291175.7 Isoform 1 of Vinculin 201 117220 8 8 8 8 1909 3444 1 1 1 500.8051 999.5957 2 999.5964 -0.0008 0 30.68 0.0028 R IPTISTQLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4815.4815.2.dta 29 1 IPI00291175.7 Isoform 1 of Vinculin 201 117220 8 8 8 8 2526 443 1 1 1 553.268 1104.5215 2 1104.5234 -0.0019 0 32.14 0.0022 R GQGSSPVAMQK A Oxidation (M) 0.00000000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1481.1481.2.dta 29 1 IPI00291175.7 Isoform 1 of Vinculin 201 117220 8 8 8 8 2531 3928 1 1 1 553.3088 1104.6031 2 1104.6026 0.0005 0 50.99 3.00E-05 R SLGEISALTSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5339.5339.2.dta 29 1 IPI00291175.7 Isoform 1 of Vinculin 201 117220 8 8 8 8 2697 3488 1 1 1 566.7921 1131.5697 2 1131.5706 -0.001 0 31.5 0.018 R TNLLQVCER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4863.4863.2.dta 29 1 IPI00291175.7 Isoform 1 of Vinculin 201 117220 8 8 8 8 2917 2863 1 1 1 585.8276 1169.6407 2 1169.6404 0.0003 0 57.6 7.40E-06 R ELTPQVVSAAR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4186.4186.2.dta 29 1 IPI00291175.7 Isoform 1 of Vinculin 201 117220 8 8 8 8 3934 3175 1 1 1 657.8725 1313.7304 2 1313.7303 0.0001 0 68.3 3.90E-07 K QVATALQNLQTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4524.4524.2.dta 29 1 IPI00291175.7 Isoform 1 of Vinculin 201 117220 8 8 8 8 6817 3402 1 1 1 661.6595 1981.9566 3 1981.9606 -0.004 1 29.5 0.0045 K GWLRDPSASPGDAGEQAIR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4770.4770.3.dta 30 1 IPI00000873.3 Valyl-tRNA synthetase 192 141642 6 6 6 6 501 99 1 1 1 380.2398 758.4651 2 758.465 0.0001 1 43.53 0.00081 K TAAQLKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1109.1109.2.dta 30 1 IPI00000873.3 Valyl-tRNA synthetase 192 141642 6 6 6 6 2869 4213 1 1 1 582.3242 1162.6338 2 1162.6346 -0.0008 0 61.96 8.40E-06 K LSAAVTEAFVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5645.5645.2.dta 30 1 IPI00000873.3 Valyl-tRNA synthetase 192 141642 6 6 6 6 3471 559 1 1 1 625.3298 1248.6451 2 1248.6462 -0.0011 0 27 0.0029 K IQQQQPPPGEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1607.1607.2.dta 30 1 IPI00000873.3 Valyl-tRNA synthetase 192 141642 6 6 6 6 4849 4454 1 1 1 735.3896 1468.7647 2 1468.7634 0.0013 0 92.85 4.60E-09 R SSAQDPQAVLGALGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5896.5896.2.dta 30 1 IPI00000873.3 Valyl-tRNA synthetase 192 141642 6 6 6 6 5441 2231 1 1 1 533.2426 1596.7058 3 1596.707 -0.0011 0 48.7 7.60E-05 R YGEAGEGPGWGGAHPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3460.3460.3.dta 30 1 IPI00000873.3 Valyl-tRNA synthetase 192 141642 6 6 6 6 5488 4425 1 1 1 807.3919 1612.7693 2 1612.7701 -0.0009 0 17.14 0.025 R GIEDNPMVVPLCNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5865.5865.2.dta 30 IPI00646425.2 similar to Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (Protein G7a) isoform 1 151 40256 4 4 4 4 501 99 1 0 1 380.2398 758.4651 2 758.465 0.0001 1 43.53 0.00081 K TAAQLKK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1109.1109.2.dta 30 IPI00646425.2 similar to Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (Protein G7a) isoform 1 151 40256 4 4 4 4 3471 559 1 0 1 625.3298 1248.6451 2 1248.6462 -0.0011 0 27 0.0029 K IQQQQPPPGEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1607.1607.2.dta 30 IPI00646425.2 similar to Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (Protein G7a) isoform 1 151 40256 4 4 4 4 4849 4454 1 0 1 735.3896 1468.7647 2 1468.7634 0.0013 0 92.85 4.60E-09 R SSAQDPQAVLGALGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5896.5896.2.dta 30 IPI00646425.2 similar to Valyl-tRNA synthetase (Valine--tRNA ligase) (ValRS) (Protein G7a) isoform 1 151 40256 4 4 4 4 5441 2231 1 0 1 533.2426 1596.7058 3 1596.707 -0.0011 0 48.7 7.60E-05 R YGEAGEGPGWGGAHPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3460.3460.3.dta 30 IPI00793323.1 Valyl-tRNA synthetase 121 18217 2 2 2 2 4849 4454 1 0 1 735.3896 1468.7647 2 1468.7634 0.0013 0 92.85 4.60E-09 R SSAQDPQAVLGALGR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5896.5896.2.dta 30 IPI00793323.1 Valyl-tRNA synthetase 121 18217 2 2 2 2 5441 2231 1 0 1 533.2426 1596.7058 3 1596.707 -0.0011 0 48.7 7.60E-05 R YGEAGEGPGWGGAHPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3460.3460.3.dta 30 IPI00788898.1 Valyl-tRNA synthetase 17 32775 1 1 1 1 5488 4425 1 0 1 807.3919 1612.7693 2 1612.7701 -0.0009 0 17.14 0.025 R GIEDNPMVVPLCNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5865.5865.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 475 5910 1 1 1 378.2294 754.4443 2 754.445 -0.0006 1 28.56 0.01 R VRQAPGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.737.737.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 870 2943 1 1 0 418.2202 834.4259 2 834.4269 -0.0011 0 34.38 0.0089 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4273.4273.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 871 3209 1 1 0 418.2213 834.428 2 834.4269 0.001 0 38.05 0.0044 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4561.4561.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 873 3005 1 1 0 418.2219 834.4292 2 834.4269 0.0023 0 41.04 0.002 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4340.4340.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 924 5165 1 1 0 419.7555 837.4965 2 837.496 0.0005 0 21.1 0.038 K ALPAPIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6614.6614.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 1022 2555 1 1 0 426.2176 850.4206 2 850.4218 -0.0013 0 33.36 0.0081 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3847.3847.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 1023 3119 1 1 0 426.2178 850.4211 2 850.4218 -0.0008 0 42.24 0.0011 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4463.4463.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 1026 2757 1 1 0 426.218 850.4214 2 850.4218 -0.0004 0 45.13 0.00081 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4071.4071.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 1029 2933 1 1 0 426.2186 850.4227 2 850.4218 0.0009 0 35.04 0.0083 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4262.4262.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 3619 3471 1 1 0 634.384 1266.7534 2 1266.7547 -0.0013 1 31.96 0.0031 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4845.4845.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 3620 3183 1 1 0 634.384 1266.7534 2 1266.7547 -0.0013 1 70.7 4.20E-07 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4533.4533.2.dta 31 1 IPI00816314.1 Hypothetical protein DKFZp686I15196 191 51579 12 12 4 4 3621 3057 1 1 0 634.3854 1266.7563 2 1266.7547 0.0016 1 26.32 0.0081 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4396.4396.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 870 2943 1 0 0 418.2202 834.4259 2 834.4269 -0.0011 0 34.38 0.0089 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4273.4273.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 871 3209 1 0 0 418.2213 834.428 2 834.4269 0.001 0 38.05 0.0044 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4561.4561.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 873 3005 1 0 0 418.2219 834.4292 2 834.4269 0.0023 0 41.04 0.002 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4340.4340.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 924 5165 1 0 0 419.7555 837.4965 2 837.496 0.0005 0 21.1 0.038 K ALPAPIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6614.6614.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 1022 2555 1 0 0 426.2176 850.4206 2 850.4218 -0.0013 0 33.36 0.0081 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3847.3847.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 1023 3119 1 0 0 426.2178 850.4211 2 850.4218 -0.0008 0 42.24 0.0011 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4463.4463.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 1026 2757 1 0 0 426.218 850.4214 2 850.4218 -0.0004 0 45.13 0.00081 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4071.4071.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 1029 2933 1 0 0 426.2186 850.4227 2 850.4218 0.0009 0 35.04 0.0083 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4262.4262.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 3222 3610 1 0 1 608.7943 1215.5741 2 1215.5706 0.0034 0 22.48 0.0094 R LSCAASGFTFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4995.4995.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 3619 3471 1 0 0 634.384 1266.7534 2 1266.7547 -0.0013 1 31.96 0.0031 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4845.4845.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 3620 3183 1 0 0 634.384 1266.7534 2 1266.7547 -0.0013 1 70.7 4.20E-07 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4533.4533.2.dta 31 2 IPI00423463.1 Hypothetical protein DKFZp686O01196 191 53264 12 12 4 4 3621 3057 1 0 0 634.3854 1266.7563 2 1266.7547 0.0016 1 26.32 0.0081 K ALPAPIEKTISK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4396.4396.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 870 2943 1 0 0 418.2202 834.4259 2 834.4269 -0.0011 0 34.38 0.0089 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4273.4273.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 871 3209 1 0 0 418.2213 834.428 2 834.4269 0.001 0 38.05 0.0044 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4561.4561.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 873 3005 1 0 0 418.2219 834.4292 2 834.4269 0.0023 0 41.04 0.002 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4340.4340.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 924 5165 1 0 0 419.7555 837.4965 2 837.496 0.0005 0 21.1 0.038 K ALPAPIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6614.6614.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 1022 2555 1 0 0 426.2176 850.4206 2 850.4218 -0.0013 0 33.36 0.0081 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3847.3847.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 1023 3119 1 0 0 426.2178 850.4211 2 850.4218 -0.0008 0 42.24 0.0011 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4463.4463.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 1026 2757 1 0 0 426.218 850.4214 2 850.4218 -0.0004 0 45.13 0.00081 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4071.4071.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 1029 2933 1 0 0 426.2186 850.4227 2 850.4218 0.0009 0 35.04 0.0083 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4262.4262.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 3619 3471 1 0 0 634.384 1266.7534 2 1266.7547 -0.0013 1 31.96 0.0031 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4845.4845.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 3620 3183 1 0 0 634.384 1266.7534 2 1266.7547 -0.0013 1 70.7 4.20E-07 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4533.4533.2.dta 31 IPI00168728.1 FLJ00385 protein (Fragment) 184 57272 11 11 3 3 3621 3057 1 0 0 634.3854 1266.7563 2 1266.7547 0.0016 1 26.32 0.0081 K ALPAPIEKTISK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4396.4396.2.dta 31 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 112 46716 7 7 1 1 870 2943 1 0 0 418.2202 834.4259 2 834.4269 -0.0011 0 34.38 0.0089 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4273.4273.2.dta 31 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 112 46716 7 7 1 1 871 3209 1 0 0 418.2213 834.428 2 834.4269 0.001 0 38.05 0.0044 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4561.4561.2.dta 31 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 112 46716 7 7 1 1 873 3005 1 0 0 418.2219 834.4292 2 834.4269 0.0023 0 41.04 0.002 K DTLMISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4340.4340.2.dta 31 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 112 46716 7 7 1 1 1022 2555 1 0 0 426.2176 850.4206 2 850.4218 -0.0013 0 33.36 0.0081 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3847.3847.2.dta 31 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 112 46716 7 7 1 1 1023 3119 1 0 0 426.2178 850.4211 2 850.4218 -0.0008 0 42.24 0.0011 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4463.4463.2.dta 31 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 112 46716 7 7 1 1 1026 2757 1 0 0 426.218 850.4214 2 850.4218 -0.0004 0 45.13 0.00081 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4071.4071.2.dta 31 IPI00399007.5 Hypothetical protein DKFZp686I04196 (Fragment) 112 46716 7 7 1 1 1029 2933 1 0 0 426.2186 850.4227 2 850.4218 0.0009 0 35.04 0.0083 K DTLMISR T Oxidation (M) 0.0001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4262.4262.2.dta 31 IPI00783023.1 Immunglobulin heavy chain variable region (Fragment) 22 13739 1 1 1 1 3222 3610 1 0 1 608.7943 1215.5741 2 1215.5706 0.0034 0 22.48 0.0094 R LSCAASGFTFR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4995.4995.2.dta 32 1 IPI00645078.1 Ubiquitin-activating enzyme E1 188 118858 6 6 6 6 3564 4124 1 1 1 630.3685 1258.7225 2 1258.7245 -0.002 0 41.95 0.00014 R LQTSSVLVSGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5551.5551.2.dta 32 1 IPI00645078.1 Ubiquitin-activating enzyme E1 188 118858 6 6 6 6 4701 3411 1 1 1 723.3372 1444.6599 2 1444.6617 -0.0018 0 37.35 0.00042 K DNPGVVTCLDEAR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4780.4780.2.dta 32 1 IPI00645078.1 Ubiquitin-activating enzyme E1 188 118858 6 6 6 6 5584 5461 1 1 1 541.9732 1622.8978 3 1622.8992 -0.0014 0 37.4 0.0014 R LAGTQPLEVLEAVQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6916.6916.3.dta 32 1 IPI00645078.1 Ubiquitin-activating enzyme E1 188 118858 6 6 6 6 5813 4247 1 1 1 828.3972 1654.7799 2 1654.7839 -0.004 0 82.98 6.80E-08 R YDGQVAVFGSDLQEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5681.5681.2.dta 32 1 IPI00645078.1 Ubiquitin-activating enzyme E1 188 118858 6 6 6 6 6386 4501 1 1 1 904.978 1807.9415 2 1807.9428 -0.0013 0 55.76 5.90E-06 R ALPAVQQNNLDEDLIR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5943.5943.2.dta 32 1 IPI00645078.1 Ubiquitin-activating enzyme E1 188 118858 6 6 6 6 6599 5719 1 1 1 628.6522 1882.9347 3 1882.9384 -0.0038 0 23.39 0.011 R NEEDAAELVALAQAVNAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7178.7178.3.dta 32 IPI00641319.1 Ubiquitin-activating enzyme E1 63 31030 2 2 2 2 3564 4124 1 0 1 630.3685 1258.7225 2 1258.7245 -0.002 0 41.95 0.00014 R LQTSSVLVSGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5551.5551.2.dta 32 IPI00641319.1 Ubiquitin-activating enzyme E1 63 31030 2 2 2 2 4701 3411 1 0 1 723.3372 1444.6599 2 1444.6617 -0.0018 0 37.35 0.00042 K DNPGVVTCLDEAR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4780.4780.2.dta 32 IPI00552452.1 Ubiquitin-activating enzyme E1 42 25264 1 1 1 1 3564 4124 1 0 1 630.3685 1258.7225 2 1258.7245 -0.002 0 41.95 0.00014 R LQTSSVLVSGLR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5551.5551.2.dta 32 IPI00026119.6 Ubiquitin-activating enzyme E1 37 57443 1 1 1 1 5584 5461 1 0 1 541.9732 1622.8978 3 1622.8992 -0.0014 0 37.4 0.0014 R LAGTQPLEVLEAVQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6916.6916.3.dta 33 1 IPI00017297.1 Matrin-3 186 95078 8 8 8 8 590 1953 1 1 0 388.1759 774.3372 2 774.3371 0.0001 0 23.7 0.014 K TGFYCK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3133.3133.2.dta 33 1 IPI00017297.1 Matrin-3 186 95078 8 8 8 8 716 6697 1 1 1 402.7197 803.4248 2 803.425 -0.0002 1 41.04 0.0028 K GRVETSR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.831.831.2.dta 33 1 IPI00017297.1 Matrin-3 186 95078 8 8 8 8 1041 1739 1 1 1 427.2298 852.4451 2 852.4454 -0.0003 0 37.83 0.0011 R GPGPLQER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2899.2899.2.dta 33 1 IPI00017297.1 Matrin-3 186 95078 8 8 8 8 1181 4661 1 1 1 439.2374 876.4602 2 876.4606 -0.0004 0 22.75 0.0074 K ALWFQGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6105.6105.2.dta 33 1 IPI00017297.1 Matrin-3 186 95078 8 8 8 8 2162 1875 1 1 1 520.262 1038.5094 2 1038.5094 0 0 48.68 0.00011 K SFQQSSLSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3049.3049.2.dta 33 1 IPI00017297.1 Matrin-3 186 95078 8 8 8 8 2766 3599 1 1 1 382.203 1143.5871 3 1143.5859 0.0012 0 29.81 0.0019 R VVHIMDFQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4983.4983.3.dta 33 1 IPI00017297.1 Matrin-3 186 95078 8 8 8 8 4001 1974 1 1 1 662.8376 1323.6606 2 1323.6644 -0.0037 0 57.92 4.60E-06 R GNLGAGNGNLQGPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3156.3156.2.dta 33 1 IPI00017297.1 Matrin-3 186 95078 8 8 8 8 5284 4461 1 1 1 787.3808 1572.747 2 1572.7494 -0.0023 0 61.58 5.70E-06 K LCSLFYTNEEVAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5902.5902.2.dta 33 IPI00470923.2 Hypothetical protein DKFZp686L22104 93 31601 3 3 3 3 590 1953 1 0 0 388.1759 774.3372 2 774.3371 0.0001 0 23.7 0.014 K TGFYCK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3133.3133.2.dta 33 IPI00470923.2 Hypothetical protein DKFZp686L22104 93 31601 3 3 3 3 2162 1875 1 0 1 520.262 1038.5094 2 1038.5094 0 0 48.68 0.00011 K SFQQSSLSR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3049.3049.2.dta 33 IPI00470923.2 Hypothetical protein DKFZp686L22104 93 31601 3 3 3 3 5284 4461 1 0 1 787.3808 1572.747 2 1572.7494 -0.0023 0 61.58 5.70E-06 K LCSLFYTNEEVAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5902.5902.2.dta 34 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 173 112859 9 9 9 9 689 1826 1 1 1 400.2431 798.4717 2 798.4712 0.0005 0 41.97 0.00061 K IIQVGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2996.2996.2.dta 34 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 173 112859 9 9 9 9 799 643 1 1 1 411.2474 820.4803 2 820.4807 -0.0003 1 44.2 0.00043 R KYAQAIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1699.1699.2.dta 34 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 173 112859 9 9 9 9 2274 5211 1 1 1 530.7822 1059.5499 2 1059.5502 -0.0003 0 50.53 0.00026 R SPTWFGIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6660.6660.2.dta 34 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 173 112859 9 9 9 9 2542 3844 1 1 1 554.2747 1106.5349 2 1106.5356 -0.0007 0 38.67 0.0016 R EQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5248.5248.2.dta 34 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 173 112859 9 9 9 9 2618 3186 1 1 1 559.808 1117.6014 2 1117.6019 -0.0005 0 35.86 0.004 K STVVPVPYEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4536.4536.2.dta 34 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 173 112859 9 9 9 9 2639 2452 1 1 1 562.2845 1122.5544 2 1122.5557 -0.0013 0 70.48 1.60E-06 K FAEALGSTEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3724.3724.2.dta 34 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 173 112859 9 9 9 9 3450 4174 1 1 1 624.3529 1246.6913 2 1246.6921 -0.0009 0 28.85 0.02 K FAQALGLTEAVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5605.5605.2.dta 34 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 173 112859 9 9 9 9 3638 3414 1 1 1 636.8332 1271.6518 2 1271.6544 -0.0025 0 17.14 0.025 R SILSPGGSCGPIK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4783.4783.2.dta 34 1 IPI00054042.1 Isoform 1 of General transcription factor II-I 173 112859 9 9 9 9 6228 4845 1 1 1 872.4664 1742.9183 2 1742.9203 -0.002 0 22.85 0.018 R DQSAVVVQGLPEGVAFK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6290.6290.2.dta 34 IPI00737506.2 Similar to General transcription factor II-I 134 68761 5 5 5 5 689 1826 1 0 1 400.2431 798.4717 2 798.4712 0.0005 0 41.97 0.00061 K IIQVGNR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2996.2996.2.dta 34 IPI00737506.2 Similar to General transcription factor II-I 134 68761 5 5 5 5 2274 5211 1 0 1 530.7822 1059.5499 2 1059.5502 -0.0003 0 50.53 0.00026 R SPTWFGIPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6660.6660.2.dta 34 IPI00737506.2 Similar to General transcription factor II-I 134 68761 5 5 5 5 2542 3844 1 0 1 554.2747 1106.5349 2 1106.5356 -0.0007 0 38.67 0.0016 R EQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5248.5248.2.dta 34 IPI00737506.2 Similar to General transcription factor II-I 134 68761 5 5 5 5 2639 2452 1 0 1 562.2845 1122.5544 2 1122.5557 -0.0013 0 70.48 1.60E-06 K FAEALGSTEAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3724.3724.2.dta 34 IPI00737506.2 Similar to General transcription factor II-I 134 68761 5 5 5 5 3450 4174 1 0 1 624.3529 1246.6913 2 1246.6921 -0.0009 0 28.85 0.02 K FAQALGLTEAVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5605.5605.2.dta 34 IPI00398199.2 GTF2I repeat domain containing 2B 39 108533 1 1 1 1 2542 3844 1 0 1 554.2747 1106.5349 2 1106.5356 -0.0007 0 38.67 0.0016 R EQVNDLFSR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5248.5248.2.dta 35 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 166 79336 4 4 4 4 244 3801 1 1 1 343.2212 684.4278 2 684.4282 -0.0004 0 31.52 0.0076 K LNLLGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5201.5201.2.dta 35 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 166 79336 4 4 4 4 4455 3821 1 1 1 701.3455 1400.6764 2 1400.6783 -0.002 0 56.76 1.80E-05 R ASLEDAPVDDLTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5223.5223.2.dta 35 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 166 79336 4 4 4 4 4732 1078 1 1 1 725.3494 1448.6843 2 1448.6856 -0.0013 0 81.68 2.90E-08 K ATDLGGTSQAGTSQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2171.2171.2.dta 35 1 IPI00332936.1 Isoform 2 of Zinc finger CCCH type antiviral protein 1 166 79336 4 4 4 4 5177 3392 1 1 1 773.9064 1545.7982 2 1545.7998 -0.0017 0 60.18 8.00E-06 R SSLGSLQTPEAVTTR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4759.4759.2.dta 36 1 IPI00398625.5 Hornerin 163 283140 8 8 8 8 2654 403 1 1 1 563.2678 1124.5211 2 1124.521 0.0001 1 31.86 0.0085 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1438.1438.2.dta 36 1 IPI00398625.5 Hornerin 163 283140 8 8 8 8 2735 628 1 1 1 570.2568 1138.4991 2 1138.5003 -0.0012 0 43.85 7.70E-05 R GSGSGQSPSYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1683.1683.2.dta 36 1 IPI00398625.5 Hornerin 163 283140 8 8 8 8 3394 6942 1 1 1 620.7864 1239.5582 2 1239.5592 -0.001 0 34.81 0.00054 R HGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.882.882.2.dta 36 1 IPI00398625.5 Hornerin 163 283140 8 8 8 8 4079 5328 1 1 1 670.3077 1338.6009 2 1338.6025 -0.0016 0 19.27 0.016 R QGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.678.678.2.dta 36 1 IPI00398625.5 Hornerin 163 283140 8 8 8 8 4143 4745 1 1 1 674.8084 1347.6023 2 1347.6028 -0.0006 0 25.37 0.0042 R HGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.619.619.2.dta 36 1 IPI00398625.5 Hornerin 163 283140 8 8 8 8 4421 316 1 1 1 698.3157 1394.6168 2 1394.6175 -0.0007 0 66.26 6.10E-07 R YGQQGSGSGQSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1344.1344.2.dta 36 1 IPI00398625.5 Hornerin 163 283140 8 8 8 8 6384 7103 1 1 1 603.5893 1807.7461 3 1807.747 -0.0009 0 23.58 0.017 R HGSSSGSSSSYGQHGSGSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.919.919.3.dta 36 1 IPI00398625.5 Hornerin 163 283140 8 8 8 8 6776 246 1 1 1 649.9715 1946.8927 3 1946.8943 -0.0017 0 33.95 0.00065 R QSLGHGQHGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1269.1269.3.dta 36 IPI00787362.1 similar to Hornerin 158 188565 7 7 7 7 2654 403 1 0 1 563.2678 1124.5211 2 1124.521 0.0001 1 31.86 0.0085 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1438.1438.2.dta 36 IPI00787362.1 similar to Hornerin 158 188565 7 7 7 7 2735 628 1 0 1 570.2568 1138.4991 2 1138.5003 -0.0012 0 43.85 7.70E-05 R GSGSGQSPSYGR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1683.1683.2.dta 36 IPI00787362.1 similar to Hornerin 158 188565 7 7 7 7 3394 6942 1 0 1 620.7864 1239.5582 2 1239.5592 -0.001 0 34.81 0.00054 R HGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.882.882.2.dta 36 IPI00787362.1 similar to Hornerin 158 188565 7 7 7 7 4079 5328 1 0 1 670.3077 1338.6009 2 1338.6025 -0.0016 0 19.27 0.016 R QGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.678.678.2.dta 36 IPI00787362.1 similar to Hornerin 158 188565 7 7 7 7 4143 4745 1 0 1 674.8084 1347.6023 2 1347.6028 -0.0006 0 25.37 0.0042 R HGSGSGQSPGHGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.619.619.2.dta 36 IPI00787362.1 similar to Hornerin 158 188565 7 7 7 7 4421 316 1 0 1 698.3157 1394.6168 2 1394.6175 -0.0007 0 66.26 6.10E-07 R YGQQGSGSGQSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1344.1344.2.dta 36 IPI00787362.1 similar to Hornerin 158 188565 7 7 7 7 6776 246 1 0 1 649.9715 1946.8927 3 1946.8943 -0.0017 0 33.95 0.00065 R QSLGHGQHGSGSGQSPSPSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1269.1269.3.dta 36 IPI00783478.1 129 kDa protein 32 129438 1 1 1 1 2654 403 1 0 1 563.2678 1124.5211 2 1124.521 0.0001 1 31.86 0.0085 R SSSRGPYESR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1438.1438.2.dta 37 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 162 141853 8 8 8 8 420 1533 2 1 1 366.237 730.4594 2 730.4589 0.0006 1 34.81 0.0048 R TKLELK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2676.2676.2.dta 37 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 162 141853 8 8 8 8 1171 5119 1 1 1 438.2405 874.4665 2 874.4661 0.0004 1 37.72 0.0034 K YSHVNKK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.657.657.2.dta 37 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 162 141853 8 8 8 8 2527 1264 1 1 1 553.2684 1104.5222 2 1104.5233 -0.0012 0 28.32 0.025 R EMQQLSGGQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2383.2383.2.dta 37 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 162 141853 8 8 8 8 4134 739 1 1 1 674.3201 1346.6256 2 1346.6248 0.0007 0 39.45 0.00027 K INQMATAPDSQR L Oxidation (M) 0.000100000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1803.1803.2.dta 37 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 162 141853 8 8 8 8 4574 4614 1 1 1 713.3541 1424.6937 2 1424.6936 0.0001 0 32.34 0.0014 K ALDQFVNFSEQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6058.6058.2.dta 37 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 162 141853 8 8 8 8 4865 3313 1 1 1 737.842 1473.6695 2 1473.6695 0 0 41.46 0.00019 K DLQDELAGNSEQR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4673.4673.2.dta 37 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 162 141853 8 8 8 8 5966 4067 1 1 1 841.9209 1681.8272 2 1681.8311 -0.0039 1 15.88 0.032 K ALDQFVNFSEQKEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5489.5489.2.dta 37 1 IPI00219420.3 Structural maintenance of chromosomes protein 3 162 141853 8 8 8 8 6528 4264 1 1 1 928.9537 1855.8929 2 1855.8952 -0.0022 0 72.87 7.60E-07 R ALEYTIYNQELNETR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5698.5698.2.dta 38 1 IPI00002894.2 DNA polymerase delta catalytic subunit 156 125035 4 4 4 4 1173 4824 1 1 1 438.2709 874.5273 2 874.5276 -0.0004 0 38.78 0.00045 K VGGLLAFAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6269.6269.2.dta 38 1 IPI00002894.2 DNA polymerase delta catalytic subunit 156 125035 4 4 4 4 1617 5365 1 1 1 479.2267 956.4389 2 956.4392 -0.0004 0 45.18 0.00011 R FGPPGPEAW - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6817.6817.2.dta 38 1 IPI00002894.2 DNA polymerase delta catalytic subunit 156 125035 4 4 4 4 3039 4481 1 1 1 596.322 1190.6294 2 1190.6295 -0.0002 0 79.6 1.60E-07 K LGLTEDQFIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5923.5923.2.dta 38 1 IPI00002894.2 DNA polymerase delta catalytic subunit 156 125035 4 4 4 4 3601 4639 1 1 1 633.8104 1265.6063 2 1265.6074 -0.0011 0 49.03 2.50E-05 R VLSFDIECAGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6083.6083.2.dta 38 IPI00556021.2 "Polymerase (DNA directed), delta 1, catalytic subunit 125kDa variant" 109 113097 2 2 2 2 3039 4481 1 0 1 596.322 1190.6294 2 1190.6295 -0.0002 0 79.6 1.60E-07 K LGLTEDQFIR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5923.5923.2.dta 38 IPI00556021.2 "Polymerase (DNA directed), delta 1, catalytic subunit 125kDa variant" 109 113097 2 2 2 2 3601 4639 1 0 1 633.8104 1265.6063 2 1265.6074 -0.0011 0 49.03 2.50E-05 R VLSFDIECAGR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6083.6083.2.dta 39 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 151 136575 5 5 5 5 246 2805 1 1 1 343.2344 684.4542 2 684.4534 0.0008 0 32.84 0.004 R VLIGVGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4123.4123.2.dta 39 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 151 136575 5 5 5 5 2279 2630 1 1 1 531.2523 1060.4901 2 1060.4938 -0.0037 0 30.27 0.01 K NFGDQPDIR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3930.3930.2.dta 39 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 151 136575 5 5 5 5 2836 3753 1 1 1 579.8045 1157.5945 2 1157.5941 0.0003 0 56.01 2.60E-05 K AGNGQWASVIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5149.5149.2.dta 39 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 151 136575 5 5 5 5 3864 4994 1 1 1 652.3707 1302.7269 2 1302.7296 -0.0027 0 51.42 8.80E-05 R FLAVGLVDNTVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6442.6442.2.dta 39 1 IPI00300371.5 Isoform 1 of Splicing factor 3B subunit 3 151 136575 5 5 5 5 5965 4644 1 1 1 841.4479 1680.8812 2 1680.8835 -0.0023 0 67.99 6.60E-07 K TPVEEVPAAIAPFQGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6088.6088.2.dta 39 IPI00828110.1 Isoform 3 of Splicing factor 3B subunit 3 115 44863 3 3 3 3 246 2805 1 0 1 343.2344 684.4542 2 684.4534 0.0008 0 32.84 0.004 R VLIGVGK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4123.4123.2.dta 39 IPI00828110.1 Isoform 3 of Splicing factor 3B subunit 3 115 44863 3 3 3 3 2836 3753 1 0 1 579.8045 1157.5945 2 1157.5941 0.0003 0 56.01 2.60E-05 K AGNGQWASVIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5149.5149.2.dta 39 IPI00828110.1 Isoform 3 of Splicing factor 3B subunit 3 115 44863 3 3 3 3 5965 4644 1 0 1 841.4479 1680.8812 2 1680.8835 -0.0023 0 67.99 6.60E-07 K TPVEEVPAAIAPFQGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6088.6088.2.dta 40 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 150 84903 6 6 6 6 1771 179 1 1 1 491.7201 981.4256 2 981.4264 -0.0008 0 58.74 5.90E-06 R SGGGGYSQNR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1196.1196.2.dta 40 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 150 84903 6 6 6 6 2469 96 1 1 1 364.5248 1090.5525 3 1090.5519 0.0006 1 28.54 0.029 R KRPYEENR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1105.1105.3.dta 40 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 150 84903 6 6 6 6 4092 4147 1 1 1 671.3029 1340.5912 2 1340.5932 -0.002 0 54.69 2.20E-05 K NCAVEFNFGQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5576.5576.2.dta 40 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 150 84903 6 6 6 6 4339 3515 1 1 1 692.3474 1382.6803 2 1382.683 -0.0028 0 27.03 0.036 R QNQFYDTQVIK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4892.4892.2.dta 40 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 150 84903 6 6 6 6 5749 3223 1 1 1 548.9463 1643.817 3 1643.8189 -0.0018 1 19.16 0.016 K AIVICPTDEDLKDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4576.4576.3.dta 40 1 IPI00402391.3 Isoform 3 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 150 84903 6 6 6 6 6220 3864 1 1 1 871.428 1740.8415 2 1740.8431 -0.0016 0 68.67 1.70E-06 R NYILDQTNVYGSAQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5269.5269.2.dta 40 IPI00386971.3 Isoform 5 of Heterogeneous nuclear ribonucleoprotein U-like protein 1 59 42277 1 1 1 1 1771 179 1 0 1 491.7201 981.4256 2 981.4264 -0.0008 0 58.74 5.90E-06 R SGGGGYSQNR W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1196.1196.2.dta 41 1 IPI00376317.3 autoantigen RCD8 148 152992 7 7 7 7 1154 488 1 1 1 436.7328 871.451 2 871.4512 -0.0002 0 48.28 0.00023 R ALAEGQQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1530.1530.2.dta 41 1 IPI00376317.3 autoantigen RCD8 148 152992 7 7 7 7 1162 2869 1 1 1 437.2429 872.4712 2 872.4716 -0.0003 0 42.05 0.00069 K NLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4192.4192.2.dta 41 1 IPI00376317.3 autoantigen RCD8 148 152992 7 7 7 7 1521 2748 1 1 1 471.7718 941.5291 2 941.5294 -0.0003 0 38.79 0.0014 K ALQDVQIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4061.4061.2.dta 41 1 IPI00376317.3 autoantigen RCD8 148 152992 7 7 7 7 1754 1897 1 1 1 489.2655 976.5164 2 976.5189 -0.0025 0 27.07 0.0029 R VISVSTSER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3073.3073.2.dta 41 1 IPI00376317.3 autoantigen RCD8 148 152992 7 7 7 7 2711 3344 1 1 1 567.7981 1133.5816 2 1133.5829 -0.0013 0 57.89 3.00E-05 R FLITGADQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4707.4707.2.dta 41 1 IPI00376317.3 autoantigen RCD8 148 152992 7 7 7 7 4429 137 1 1 1 466.2356 1395.685 3 1395.6855 -0.0005 1 21.54 0.042 R ALETRHEQEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1151.1151.3.dta 41 1 IPI00376317.3 autoantigen RCD8 148 152992 7 7 7 7 4812 5447 1 1 1 732.8893 1463.7641 2 1463.766 -0.0019 0 35.36 0.00056 R EAFQSVVLPAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6900.6900.2.dta 41 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 136 123252 6 6 6 6 1154 488 1 0 1 436.7328 871.451 2 871.4512 -0.0002 0 48.28 0.00023 R ALAEGQQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1530.1530.2.dta 41 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 136 123252 6 6 6 6 1162 2869 1 0 1 437.2429 872.4712 2 872.4716 -0.0003 0 42.05 0.00069 K NLTDAIAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4192.4192.2.dta 41 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 136 123252 6 6 6 6 1521 2748 1 0 1 471.7718 941.5291 2 941.5294 -0.0003 0 38.79 0.0014 K ALQDVQIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4061.4061.2.dta 41 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 136 123252 6 6 6 6 2711 3344 1 0 1 567.7981 1133.5816 2 1133.5829 -0.0013 0 57.89 3.00E-05 R FLITGADQNR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4707.4707.2.dta 41 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 136 123252 6 6 6 6 4429 137 1 0 1 466.2356 1395.685 3 1395.6855 -0.0005 1 21.54 0.042 R ALETRHEQEQR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1151.1151.3.dta 41 IPI00641449.1 "CDNA FLJ46741 fis, clone TRACH3021373, highly similar to Homo sapiens autoantigen" 136 123252 6 6 6 6 4812 5447 1 0 1 732.8893 1463.7641 2 1463.766 -0.0019 0 35.36 0.00056 R EAFQSVVLPAFEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6900.6900.2.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 147 42052 4 4 4 4 1747 1836 1 1 1 488.7275 975.4404 2 975.441 -0.0006 0 70.41 8.30E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3006.3006.2.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 147 42052 4 4 4 4 2693 2786 1 1 1 566.7646 1131.5146 2 1131.5197 -0.005 0 63.9 1.00E-06 R GYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4102.4102.2.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 147 42052 4 4 4 4 2854 3361 1 1 1 581.3127 1160.6108 2 1160.6111 -0.0003 0 32.57 0.0061 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4725.4725.2.dta 42 1 IPI00021439.1 "Actin, cytoplasmic 1" 147 42052 4 4 4 4 6347 4907 1 1 1 895.9498 1789.8851 2 1789.8846 0.0005 0 38.94 0.00045 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6353.6353.2.dta 42 IPI00008603.1 "Actin, aortic smooth muscle" 100 42381 3 3 3 3 1747 1836 1 0 1 488.7275 975.4404 2 975.441 -0.0006 0 70.41 8.30E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3006.3006.2.dta 42 IPI00008603.1 "Actin, aortic smooth muscle" 100 42381 3 3 3 3 2854 3361 1 0 1 581.3127 1160.6108 2 1160.6111 -0.0003 0 32.57 0.0061 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4725.4725.2.dta 42 IPI00008603.1 "Actin, aortic smooth muscle" 100 42381 3 3 3 3 6347 4907 1 0 1 895.9498 1789.8851 2 1789.8846 0.0005 0 38.94 0.00045 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6353.6353.2.dta 42 IPI00794523.2 ACTG1 protein 97 28478 3 3 3 3 2693 2786 1 0 1 566.7646 1131.5146 2 1131.5197 -0.005 0 63.9 1.00E-06 R GYSFTTTAER E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4102.4102.2.dta 42 IPI00794523.2 ACTG1 protein 97 28478 3 3 3 3 2854 3361 1 0 1 581.3127 1160.6108 2 1160.6111 -0.0003 0 32.57 0.0061 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4725.4725.2.dta 42 IPI00794523.2 ACTG1 protein 97 28478 3 3 3 3 6347 4907 1 0 1 895.9498 1789.8851 2 1789.8846 0.0005 0 38.94 0.00045 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6353.6353.2.dta 42 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 89 123020 2 2 2 2 1747 1836 1 0 1 488.7275 975.4404 2 975.441 -0.0006 0 70.41 8.30E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3006.3006.2.dta 42 IPI00739539.2 "similar to Prostate, ovary, testis expressed protein on chromosome 2" 89 123020 2 2 2 2 6347 4907 1 0 1 895.9498 1789.8851 2 1789.8846 0.0005 0 38.94 0.00045 K SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6353.6353.2.dta 42 IPI00414057.2 Actin alpha 1 skeletal muscle protein 80 28454 2 2 2 2 1747 1836 1 0 1 488.7275 975.4404 2 975.441 -0.0006 0 70.41 8.30E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3006.3006.2.dta 42 IPI00414057.2 Actin alpha 1 skeletal muscle protein 80 28454 2 2 2 2 2854 3361 1 0 1 581.3127 1160.6108 2 1160.6111 -0.0003 0 32.57 0.0061 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4725.4725.2.dta 42 IPI00645534.1 "Actin, alpha 2, smooth muscle, aorta" 70 16919 1 1 1 1 1747 1836 1 0 1 488.7275 975.4404 2 975.441 -0.0006 0 70.41 8.30E-07 K AGFAGDDAPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3006.3006.2.dta 42 IPI00003269.1 hypothetical protein LOC345651 39 42318 1 1 1 1 6347 4907 1 0 1 895.9498 1789.8851 2 1789.8846 0.0005 0 38.94 0.00045 R SYELPDGQVITIGNER F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6353.6353.2.dta 42 IPI00444605.1 "CDNA FLJ45296 fis, clone BRHIP3003340, moderately similar to Actin, alpha skeletal muscle 2" 33 23821 1 1 1 1 2854 3361 1 0 1 581.3127 1160.6108 2 1160.6111 -0.0003 0 32.57 0.0061 K EITALAPSTMK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4725.4725.2.dta 43 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 144 105962 6 6 6 6 223 3911 1 1 0 339.2209 676.4272 2 676.4272 0 0 19.6 0.042 R IYLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5320.5320.2.dta 43 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 144 105962 6 6 6 6 1612 2998 1 1 1 478.7792 955.5439 2 955.545 -0.0011 0 36.22 0.0043 K LNEILQAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4332.4332.2.dta 43 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 144 105962 6 6 6 6 2571 5512 1 1 1 556.345 1110.6755 2 1110.6761 -0.0006 0 68.5 4.70E-07 K ELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6968.6968.2.dta 43 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 144 105962 6 6 6 6 3385 5198 1 1 1 619.3099 1236.6053 2 1236.606 -0.0007 0 44.7 0.00069 K CLEEFELLGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6648.6648.2.dta 43 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 144 105962 6 6 6 6 3914 4562 1 1 1 437.6099 1309.8079 3 1309.8081 -0.0002 1 27.14 0.0071 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6005.6005.3.dta 43 1 IPI00016910.1 Eukaryotic translation initiation factor 3 subunit 8 144 105962 6 6 6 6 6265 4098 1 1 1 877.9664 1753.9182 2 1753.921 -0.0028 0 47.42 3.60E-05 R TEPTAQQNLALQLAEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5523.5523.2.dta 43 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 112 90789 5 5 5 5 223 3911 1 0 0 339.2209 676.4272 2 676.4272 0 0 19.6 0.042 R IYLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5320.5320.2.dta 43 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 112 90789 5 5 5 5 1612 2998 1 0 1 478.7792 955.5439 2 955.545 -0.0011 0 36.22 0.0043 K LNEILQAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4332.4332.2.dta 43 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 112 90789 5 5 5 5 2571 5512 1 0 1 556.345 1110.6755 2 1110.6761 -0.0006 0 68.5 4.70E-07 K ELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6968.6968.2.dta 43 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 112 90789 5 5 5 5 3385 5198 1 0 1 619.3099 1236.6053 2 1236.606 -0.0007 0 44.7 0.00069 K CLEEFELLGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6648.6648.2.dta 43 IPI00740719.2 "similar to eukaryotic translation initiation factor 3, subunit 8, 110kDa isoform 5" 112 90789 5 5 5 5 3914 4562 1 0 1 437.6099 1309.8079 3 1309.8081 -0.0002 1 27.14 0.0071 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6005.6005.3.dta 43 IPI00738727.1 EIF3S8 protein 109 37827 3 3 3 3 2571 5512 1 0 1 556.345 1110.6755 2 1110.6761 -0.0006 0 68.5 4.70E-07 K ELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6968.6968.2.dta 43 IPI00738727.1 EIF3S8 protein 109 37827 3 3 3 3 3914 4562 1 0 1 437.6099 1309.8079 3 1309.8081 -0.0002 1 27.14 0.0071 R AKELLGQGLLLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6005.6005.3.dta 43 IPI00738727.1 EIF3S8 protein 109 37827 3 3 3 3 6265 4098 1 0 1 877.9664 1753.9182 2 1753.921 -0.0028 0 47.42 3.60E-05 R TEPTAQQNLALQLAEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5523.5523.2.dta 44 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 143 143771 5 5 5 5 494 429 1 1 1 379.7298 757.445 2 757.4446 0.0004 1 38.36 0.0046 R INDIKR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1466.1466.2.dta 44 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 143 143771 5 5 5 5 2290 1855 1 1 1 532.2797 1062.5448 2 1062.5458 -0.001 1 30.89 0.0075 K RLEFENQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3027.3027.2.dta 44 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 143 143771 5 5 5 5 2307 4407 1 1 1 533.2824 1064.5503 2 1064.5502 0.0001 0 59.02 6.30E-06 R TALFEEISR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5847.5847.2.dta 44 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 143 143771 5 5 5 5 3048 4537 1 1 1 596.8319 1191.6493 2 1191.6499 -0.0007 0 61.59 1.20E-05 K TVALDGTLFQK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5980.5980.2.dta 44 1 IPI00291939.1 Structural maintenance of chromosomes protein 1A 143 143771 5 5 5 5 3090 1653 1 1 1 599.7808 1197.547 2 1197.5513 -0.0044 0 44.42 0.00019 K YSQSDLEQTK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2806.2806.2.dta 44 IPI00553151.2 Structural maintenance of chromosomes 1A 59 33648 1 1 1 1 2307 4407 1 0 1 533.2824 1064.5503 2 1064.5502 0.0001 0 59.02 6.30E-06 R TALFEEISR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5847.5847.2.dta 45 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 143 118104 6 6 6 6 1057 4187 1 1 1 430.2477 858.4808 2 858.4811 -0.0003 0 31.89 0.012 R SDLGNLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5618.5618.2.dta 45 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 143 118104 6 6 6 6 2524 4881 1 1 1 552.8004 1103.5862 2 1103.5863 -0.0001 0 48.4 0.0002 K AFLDSLPDVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6326.6326.2.dta 45 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 143 118104 6 6 6 6 2763 2150 1 1 1 572.7833 1143.552 2 1143.552 0 0 26.03 0.023 R EQGNIEEAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3367.3367.2.dta 45 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 143 118104 6 6 6 6 3214 4220 1 1 1 607.8519 1213.6893 2 1213.6918 -0.0025 0 32.42 0.0011 K LVSIVADQLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5653.5653.2.dta 45 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 143 118104 6 6 6 6 4396 4182 1 1 1 696.84 1391.6655 2 1391.6681 -0.0026 0 27.73 0.032 K DSGNIPEAIASYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5613.5613.2.dta 45 1 IPI00005780.3 Isoform 3 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 143 118104 6 6 6 6 5808 3164 1 1 1 828.3702 1654.7258 2 1654.7257 0.0001 0 84.1 1.30E-08 K GSVAEAEDCYNTALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4512.4512.2.dta 45 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 135 104029 5 5 5 5 2524 4881 1 0 1 552.8004 1103.5862 2 1103.5863 -0.0001 0 48.4 0.0002 K AFLDSLPDVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6326.6326.2.dta 45 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 135 104029 5 5 5 5 2763 2150 1 0 1 572.7833 1143.552 2 1143.552 0 0 26.03 0.023 R EQGNIEEAVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3367.3367.2.dta 45 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 135 104029 5 5 5 5 3214 4220 1 0 1 607.8519 1213.6893 2 1213.6918 -0.0025 0 32.42 0.0011 K LVSIVADQLEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5653.5653.2.dta 45 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 135 104029 5 5 5 5 4396 4182 1 0 1 696.84 1391.6655 2 1391.6681 -0.0026 0 27.73 0.032 K DSGNIPEAIASYR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5613.5613.2.dta 45 IPI00219856.1 Isoform 2 of UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit 135 104029 5 5 5 5 5808 3164 1 0 1 828.3702 1654.7258 2 1654.7257 0.0001 0 84.1 1.30E-08 K GSVAEAEDCYNTALR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4512.4512.2.dta 45 IPI00794271.1 20 kDa protein 32 20166 1 1 1 1 1057 4187 1 0 1 430.2477 858.4808 2 858.4811 -0.0003 0 31.89 0.012 R SDLGNLLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5618.5618.2.dta 46 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 140 141390 6 6 6 6 1910 4587 1 1 1 500.8108 999.6071 2 999.6077 -0.0006 0 63.87 3.00E-06 K LTLLQVASR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6031.6031.2.dta 46 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 140 141390 6 6 6 6 2484 7354 1 1 1 547.7568 1093.4991 2 1093.5008 -0.0017 1 16.13 0.034 R KNIQGCSCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.960.960.2.dta 46 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 140 141390 6 6 6 6 2503 3539 1 1 1 549.8286 1097.6427 2 1097.6444 -0.0018 0 48.38 0.00014 K ILAQDVAQLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4918.4918.2.dta 46 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 140 141390 6 6 6 6 2557 4757 1 1 1 554.8149 1107.6153 2 1107.6176 -0.0022 0 22.39 0.016 K YLIGELVSSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6201.6201.2.dta 46 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 140 141390 6 6 6 6 4025 5142 1 1 1 664.3767 1326.7389 2 1326.7394 -0.0006 0 57.1 2.80E-05 K ELELEVINLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6592.6592.2.dta 46 1 IPI00178150.5 Isoform 1 of Chromosome-associated kinesin KIF4A 140 141390 6 6 6 6 4193 4149 1 1 1 678.871 1355.7274 2 1355.7296 -0.0022 0 34.86 0.0064 R LQELEGQIADLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5578.5578.2.dta 46 IPI00556059.1 Isoform 2 of Chromosome-associated kinesin KIF4A 139 129235 5 5 5 5 1910 4587 1 0 1 500.8108 999.6071 2 999.6077 -0.0006 0 63.87 3.00E-06 K LTLLQVASR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6031.6031.2.dta 46 IPI00556059.1 Isoform 2 of Chromosome-associated kinesin KIF4A 139 129235 5 5 5 5 2503 3539 1 0 1 549.8286 1097.6427 2 1097.6444 -0.0018 0 48.38 0.00014 K ILAQDVAQLK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4918.4918.2.dta 46 IPI00556059.1 Isoform 2 of Chromosome-associated kinesin KIF4A 139 129235 5 5 5 5 2557 4757 1 0 1 554.8149 1107.6153 2 1107.6176 -0.0022 0 22.39 0.016 K YLIGELVSSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6201.6201.2.dta 46 IPI00556059.1 Isoform 2 of Chromosome-associated kinesin KIF4A 139 129235 5 5 5 5 4025 5142 1 0 1 664.3767 1326.7389 2 1326.7394 -0.0006 0 57.1 2.80E-05 K ELELEVINLQK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6592.6592.2.dta 46 IPI00556059.1 Isoform 2 of Chromosome-associated kinesin KIF4A 139 129235 5 5 5 5 4193 4149 1 0 1 678.871 1355.7274 2 1355.7296 -0.0022 0 34.86 0.0064 R LQELEGQIADLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5578.5578.2.dta 46 IPI00175193.4 KIF4B (Fragment) 23 136382 2 2 2 2 2484 7354 1 0 1 547.7568 1093.4991 2 1093.5008 -0.0017 1 16.13 0.034 R KNIQGCSCK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.960.960.2.dta 46 IPI00175193.4 KIF4B (Fragment) 23 136382 2 2 2 2 2557 4757 1 0 1 554.8149 1107.6153 2 1107.6176 -0.0022 0 22.39 0.016 K YLIGELVSSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6201.6201.2.dta 47 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 139 189761 8 8 7 7 119 2691 1 1 0 318.1975 634.3804 2 634.3802 0.0002 0 24.51 0.047 R LAYLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3999.3999.2.dta 47 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 139 189761 8 8 7 7 445 3266 1 1 1 374.2293 746.4441 2 746.4439 0.0002 0 36.06 0.0032 K IQAFIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4622.4622.2.dta 47 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 139 189761 8 8 7 7 831 4310 1 1 1 414.271 826.5274 2 826.5276 -0.0003 0 39.71 0.00045 R LIVDVIR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5746.5746.2.dta 47 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 139 189761 8 8 7 7 1434 2400 1 1 1 466.258 930.5015 2 930.5022 -0.0007 0 26.17 0.037 K TALQEEIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3664.3664.2.dta 47 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 139 189761 8 8 7 7 3376 2348 1 1 1 618.8339 1235.6532 2 1235.651 0.0022 0 57.59 2.30E-05 K LQQTYAALNSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3608.3608.2.dta 47 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 139 189761 8 8 7 7 4946 3836 1 1 1 742.3401 1482.6657 2 1482.6667 -0.001 0 50.48 7.40E-05 K ATFYGEQVDYYK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5239.5239.2.dta 47 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 139 189761 8 8 7 7 6261 4620 1 1 1 877.4871 1752.9597 2 1752.9622 -0.0025 0 32.89 0.00082 K VDQIQEIVTGNPTVIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6063.6063.2.dta 47 1 IPI00009342.1 Ras GTPase-activating-like protein IQGAP1 139 189761 8 8 7 7 6262 4615 1 1 1 585.3275 1752.9607 3 1752.9622 -0.0015 0 17.11 0.025 K VDQIQEIVTGNPTVIK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6059.6059.3.dta 47 IPI00328905.4 185 kDa protein 26 185426 1 1 1 1 1434 2400 1 0 1 466.258 930.5015 2 930.5022 -0.0007 0 26.17 0.037 K TALQEEIK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3664.3664.2.dta 48 1 IPI00026089.3 Splicing factor 3B subunit 1 139 146464 4 4 4 4 1912 2402 1 1 1 501.2726 1000.5307 2 1000.5301 0.0005 0 42.82 9.70E-05 R QQAADLISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3666.3666.2.dta 48 1 IPI00026089.3 Splicing factor 3B subunit 1 139 146464 4 4 4 4 3854 3366 1 1 1 651.8259 1301.6372 2 1301.6398 -0.0026 0 79.36 1.70E-07 K VQENCIDLVGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4731.4731.2.dta 48 1 IPI00026089.3 Splicing factor 3B subunit 1 139 146464 4 4 4 4 4044 3524 1 1 1 665.8644 1329.7142 2 1329.714 0.0002 0 46.46 0.00038 R QLVDTTVELANK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4902.4902.2.dta 48 1 IPI00026089.3 Splicing factor 3B subunit 1 139 146464 4 4 4 4 4279 1730 1 1 1 687.3309 1372.6473 2 1372.647 0.0003 0 30.71 0.0021 R GGDSIGETPTPGASK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2889.2889.2.dta 49 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 130 160023 4 4 4 4 2060 4498 1 1 1 512.7371 1023.4597 2 1023.4596 0.0001 0 24.32 0.043 R LQWFCDR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5940.5940.2.dta 49 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 130 160023 4 4 4 4 3637 1628 1 1 1 636.8303 1271.646 2 1271.647 -0.001 0 77.09 4.00E-07 K TVLDQQQTPSR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2779.2779.2.dta 49 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 130 160023 4 4 4 4 4035 4730 1 1 1 664.879 1327.7435 2 1327.7459 -0.0024 0 42.77 0.00068 K SNTLPISLQSIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6175.6175.2.dta 49 1 IPI00329745.4 "CDNA FLJ43793 fis, clone TESTI4000014, highly similar to 130 kDa leucine-rich protein" 130 160023 4 4 4 4 6058 3742 1 1 1 848.9135 1695.8125 2 1695.8138 -0.0013 0 56 1.30E-05 R LIASYCNVGDIEGASK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5137.5137.2.dta 50 1 IPI00022434.2 ALB protein 123 73881 4 4 3 3 650 2221 1 1 1 395.2393 788.4641 2 788.4644 -0.0002 0 26.26 0.022 K LVTDLTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3450.3450.2.dta 50 1 IPI00022434.2 ALB protein 123 73881 4 4 3 3 2680 3325 1 1 1 564.8526 1127.6906 2 1127.6914 -0.0007 1 51.56 1.50E-05 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4686.4686.2.dta 50 1 IPI00022434.2 ALB protein 123 73881 4 4 3 3 2681 3330 1 1 1 376.9043 1127.691 3 1127.6914 -0.0004 1 57.21 1.20E-05 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4692.4692.3.dta 50 1 IPI00022434.2 ALB protein 123 73881 4 4 3 3 5741 3485 1 1 1 547.3172 1638.9298 3 1638.9305 -0.0007 1 46.54 0.0001 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4860.4860.3.dta 50 IPI00216773.4 ALB protein 118 46442 3 3 2 2 2680 3325 1 0 1 564.8526 1127.6906 2 1127.6914 -0.0007 1 51.56 1.50E-05 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4686.4686.2.dta 50 IPI00216773.4 ALB protein 118 46442 3 3 2 2 2681 3330 1 0 1 376.9043 1127.691 3 1127.6914 -0.0004 1 57.21 1.20E-05 K KQTALVELVK H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4692.4692.3.dta 50 IPI00216773.4 ALB protein 118 46442 3 3 2 2 5741 3485 1 0 1 547.3172 1638.9298 3 1638.9305 -0.0007 1 46.54 0.0001 K KVPQVSTPTLVEVSR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4860.4860.3.dta 51 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 122 67889 4 4 4 4 1068 1576 1 1 1 431.735 861.4554 2 861.4556 -0.0002 0 65.98 6.10E-06 K TGTELVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2723.2723.2.dta 51 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 122 67889 4 4 4 4 1902 1732 1 1 1 500.7658 999.517 2 999.5172 -0.0001 0 37.99 0.0012 R VCTISPAPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2892.2892.2.dta 51 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 122 67889 4 4 4 4 4007 1043 1 1 1 663.2816 1324.5487 2 1324.55 -0.0013 0 52.99 1.90E-05 K ASETCSGCNIAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2133.2133.2.dta 51 1 IPI00179452.1 Isoform 1 of Protein CBFA2T2 122 67889 4 4 4 4 6884 2188 1 1 1 684.3282 2049.9627 3 2049.9637 -0.001 1 24.59 0.0056 R SADCSVPSPALDKTSATTSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3413.3413.3.dta 52 1 IPI00010951.1 Epiplakin 119 555149 3 3 3 3 1424 296 1 1 1 465.7591 929.5036 2 929.5043 -0.0007 1 41.44 0.0014 R RQEQTLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1322.1322.2.dta 52 1 IPI00010951.1 Epiplakin 119 555149 3 3 3 3 2724 5267 1 1 1 568.8553 1135.696 2 1135.6965 -0.0005 0 15.44 0.029 R APGSGLALLPLK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6717.6717.2.dta 52 1 IPI00010951.1 Epiplakin 119 555149 3 3 3 3 6339 2409 1 1 1 894.4111 1786.8077 2 1786.8081 -0.0004 0 101.68 4.80E-10 R EGQGEGETQEAAAAAAAAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3676.3676.2.dta 53 1 IPI00019502.3 Myosin-9 118 227646 4 4 4 4 1638 345 1 1 1 480.2611 958.5077 2 958.5083 -0.0006 1 19.31 0.024 K VNKDDIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1375.1375.2.dta 53 1 IPI00019502.3 Myosin-9 118 227646 4 4 4 4 2164 2667 1 1 1 347.2265 1038.6577 3 1038.655 0.0027 0 23.47 0.014 K VKPLLQVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3973.3973.3.dta 53 1 IPI00019502.3 Myosin-9 118 227646 4 4 4 4 3054 4111 1 1 1 597.311 1192.6075 2 1192.6088 -0.0013 0 64.3 1.60E-06 K ALELDSNLYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5537.5537.2.dta 53 1 IPI00019502.3 Myosin-9 118 227646 4 4 4 4 3879 4805 1 1 1 653.3373 1304.6601 2 1304.6612 -0.0011 0 69.01 2.90E-06 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6250.6250.2.dta 53 IPI00395772.4 Hypothetical protein DKFZp451J0218 115 155148 3 3 3 3 2164 2667 1 0 1 347.2265 1038.6577 3 1038.655 0.0027 0 23.47 0.014 K VKPLLQVSR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3973.3973.3.dta 53 IPI00395772.4 Hypothetical protein DKFZp451J0218 115 155148 3 3 3 3 3054 4111 1 0 1 597.311 1192.6075 2 1192.6088 -0.0013 0 64.3 1.60E-06 K ALELDSNLYR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5537.5537.2.dta 53 IPI00395772.4 Hypothetical protein DKFZp451J0218 115 155148 3 3 3 3 3879 4805 1 0 1 653.3373 1304.6601 2 1304.6612 -0.0011 0 69.01 2.90E-06 K EQADFAIEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6250.6250.2.dta 53 IPI00029818.4 Isoform 5 of Myosin-14 69 170107 1 1 1 1 3879 4805 1 0 1 653.3373 1304.6601 2 1304.6612 -0.0011 0 69.01 2.90E-06 K EQADFALEALAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6250.6250.2.dta 53 IPI00556012.1 MYH9 protein 19 24989 1 1 1 1 1638 345 1 0 1 480.2611 958.5077 2 958.5083 -0.0006 1 19.31 0.024 K VNKDDIQK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1375.1375.2.dta 54 1 IPI00220219.6 Coatomer subunit beta~ 113 103278 4 4 4 4 2814 812 1 1 1 577.301 1152.5874 2 1152.5887 -0.0013 0 38.38 0.00025 K HSEVQQANLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1883.1883.2.dta 54 1 IPI00220219.6 Coatomer subunit beta~ 113 103278 4 4 4 4 2821 3578 1 1 1 578.2928 1154.5711 2 1154.572 -0.0009 0 44.37 0.0004 R VFNYNTLER V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4960.4960.2.dta 54 1 IPI00220219.6 Coatomer subunit beta~ 113 103278 4 4 4 4 3366 4385 1 1 1 618.3076 1234.6006 2 1234.6016 -0.0011 0 49.22 6.00E-05 K TFEVCDLPVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5825.5825.2.dta 54 1 IPI00220219.6 Coatomer subunit beta~ 113 103278 4 4 4 4 4069 2870 1 1 1 669.3073 1336.6 2 1336.6007 -0.0008 0 40.47 0.00077 K DNNQFASASLDR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4193.4193.2.dta 55 1 IPI00012837.1 Kinesin heavy chain 112 110358 3 3 3 3 2286 4203 1 1 1 531.8006 1061.5866 2 1061.5869 -0.0003 0 29.3 0.008 K LFVQDLATR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5634.5634.2.dta 55 1 IPI00012837.1 Kinesin heavy chain 112 110358 3 3 3 3 3177 4912 1 1 1 604.3315 1206.6484 2 1206.6496 -0.0012 0 50.65 2.90E-05 K LYLVDLAGSEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6358.6358.2.dta 55 1 IPI00012837.1 Kinesin heavy chain 112 110358 3 3 3 3 4961 2776 1 1 1 743.8912 1485.7679 2 1485.7688 -0.0009 0 69.46 3.10E-07 R GGGAFVQNSQPVAVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4091.4091.2.dta 55 IPI00028561.1 Kinesin heavy chain isoform 5C 51 109997 1 1 1 1 3177 4912 1 0 1 604.3315 1206.6484 2 1206.6496 -0.0012 0 50.65 2.90E-05 K LYLVDLAGSEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6358.6358.2.dta 56 1 IPI00018349.5 DNA replication licensing factor MCM4 111 97068 3 3 3 3 1806 1917 1 1 1 494.7477 987.4808 2 987.4808 0 0 47.23 0.00031 R IAEPSVCGR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3094.3094.2.dta 56 1 IPI00018349.5 DNA replication licensing factor MCM4 111 97068 3 3 3 3 4245 4701 1 1 1 683.3475 1364.6804 2 1364.6824 -0.002 0 82.26 6.10E-08 R ALADDDFLTVTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6146.6146.2.dta 56 1 IPI00018349.5 DNA replication licensing factor MCM4 111 97068 3 3 3 3 6431 4736 1 1 1 913.4753 1824.9361 2 1824.937 -0.0008 0 22.9 0.0071 R TSVLAAANPIESQWNPK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6180.6180.2.dta 56 IPI00795318.1 20 kDa protein 82 20079 1 1 1 1 4245 4701 1 0 1 683.3475 1364.6804 2 1364.6824 -0.002 0 82.26 6.10E-08 R ALADDDFLTVTGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6146.6146.2.dta 57 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 109 10921 8 8 7 7 235 1447 1 1 0 341.6981 681.3816 2 681.381 0.0006 0 20.11 0.029 R HTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2583.2583.2.dta 57 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 109 10921 8 8 7 7 272 1840 1 1 0 346.1815 690.3484 2 690.3483 0.0001 0 35.99 0.0026 R QGLSMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3012.3012.2.dta 57 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 109 10921 8 8 7 7 296 266 1 1 0 349.6505 697.2864 2 697.2853 0.001 0 26.69 0.013 K AYCER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1290.1290.2.dta 57 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 109 10921 8 8 7 7 896 176 1 1 0 419.748 837.4814 2 837.4821 -0.0006 1 21.9 0.027 K RHTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1193.1193.2.dta 57 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 109 10921 8 8 7 7 2438 652 1 1 0 362.8407 1085.5003 3 1085.4998 0.0005 1 19.27 0.026 K LMKAYCER Q Oxidation (M) 0.01000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1709.1709.3.dta 57 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 109 10921 8 8 7 7 3082 1470 1 1 1 599.2957 1196.5768 2 1196.5785 -0.0018 0 73.37 1.00E-06 K TENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2608.2608.2.dta 57 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 109 10921 8 8 7 7 3083 1469 1 1 1 399.8669 1196.5787 3 1196.5785 0.0002 0 22.84 0.0087 K TENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2607.2607.3.dta 57 1 IPI00299149.1 Small ubiquitin-related modifier 2 precursor 109 10921 8 8 7 7 5477 1498 1 1 1 537.6088 1609.8046 3 1609.806 -0.0013 1 19.72 0.014 K EGVKTENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2638.2638.3.dta 57 2 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 72 11687 6 6 6 6 235 1447 1 0 0 341.6981 681.3816 2 681.381 0.0006 0 20.11 0.029 R HTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2583.2583.2.dta 57 2 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 72 11687 6 6 6 6 272 1840 1 0 0 346.1815 690.3484 2 690.3483 0.0001 0 35.99 0.0026 R QGLSMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3012.3012.2.dta 57 2 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 72 11687 6 6 6 6 296 266 1 0 0 349.6505 697.2864 2 697.2853 0.001 0 26.69 0.013 K AYCER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1290.1290.2.dta 57 2 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 72 11687 6 6 6 6 896 176 1 0 0 419.748 837.4814 2 837.4821 -0.0006 1 21.9 0.027 K RHTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1193.1193.2.dta 57 2 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 72 11687 6 6 6 6 2428 1546 1 0 1 542.2744 1082.5342 2 1082.5356 -0.0015 0 43.64 0.00023 K TENDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2690.2690.2.dta 57 2 IPI00299147.8 Small ubiquitin-related modifier 3 precursor 72 11687 6 6 6 6 2438 652 1 0 0 362.8407 1085.5003 3 1085.4998 0.0005 1 19.27 0.026 K LMKAYCER Q Oxidation (M) 0.01000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1709.1709.3.dta 57 IPI00790142.1 10 kDa protein 104 10508 7 7 6 6 235 1447 1 0 0 341.6981 681.3816 2 681.381 0.0006 0 20.11 0.029 R HTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2583.2583.2.dta 57 IPI00790142.1 10 kDa protein 104 10508 7 7 6 6 272 1840 1 0 0 346.1815 690.3484 2 690.3483 0.0001 0 35.99 0.0026 R QGLSMR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3012.3012.2.dta 57 IPI00790142.1 10 kDa protein 104 10508 7 7 6 6 296 266 1 0 0 349.6505 697.2864 2 697.2853 0.001 0 26.69 0.013 K AYCER Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1290.1290.2.dta 57 IPI00790142.1 10 kDa protein 104 10508 7 7 6 6 896 176 1 0 0 419.748 837.4814 2 837.4821 -0.0006 1 21.9 0.027 K RHTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1193.1193.2.dta 57 IPI00790142.1 10 kDa protein 104 10508 7 7 6 6 2438 652 1 0 0 362.8407 1085.5003 3 1085.4998 0.0005 1 19.27 0.026 K LMKAYCER Q Oxidation (M) 0.01000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1709.1709.3.dta 57 IPI00790142.1 10 kDa protein 104 10508 7 7 6 6 3082 1470 1 0 1 599.2957 1196.5768 2 1196.5785 -0.0018 0 73.37 1.00E-06 K TENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2608.2608.2.dta 57 IPI00790142.1 10 kDa protein 104 10508 7 7 6 6 3083 1469 1 0 1 399.8669 1196.5787 3 1196.5785 0.0002 0 22.84 0.0087 K TENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2607.2607.3.dta 57 IPI00640611.1 9 kDa protein 80 9215 4 4 3 3 235 1447 1 0 0 341.6981 681.3816 2 681.381 0.0006 0 20.11 0.029 R HTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2583.2583.2.dta 57 IPI00640611.1 9 kDa protein 80 9215 4 4 3 3 896 176 1 0 0 419.748 837.4814 2 837.4821 -0.0006 1 21.9 0.027 K RHTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1193.1193.2.dta 57 IPI00640611.1 9 kDa protein 80 9215 4 4 3 3 3082 1470 1 0 1 599.2957 1196.5768 2 1196.5785 -0.0018 0 73.37 1.00E-06 K TENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2608.2608.2.dta 57 IPI00640611.1 9 kDa protein 80 9215 4 4 3 3 3083 1469 1 0 1 399.8669 1196.5787 3 1196.5785 0.0002 0 22.84 0.0087 K TENNDHINLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2607.2607.3.dta 57 IPI00455745.2 similar to SMT3 suppressor of mif two 3 homolog 2 24 10864 2 2 2 2 235 1447 1 0 0 341.6981 681.3816 2 681.381 0.0006 0 20.11 0.029 R HTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2583.2583.2.dta 57 IPI00455745.2 similar to SMT3 suppressor of mif two 3 homolog 2 24 10864 2 2 2 2 896 176 1 0 0 419.748 837.4814 2 837.4821 -0.0006 1 21.9 0.027 K RHTPLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1193.1193.2.dta 58 1 IPI00010418.4 Myosin-Ic 107 118763 6 6 6 6 1080 3477 1 1 1 432.7447 863.4749 2 863.4752 -0.0004 0 21.08 0.042 K AVASEIFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4851.4851.2.dta 58 1 IPI00010418.4 Myosin-Ic 107 118763 6 6 6 6 2357 3526 1 1 1 537.8115 1073.6084 2 1073.6081 0.0003 0 24.13 0.042 R LLSVEGSTLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4904.4904.2.dta 58 1 IPI00010418.4 Myosin-Ic 107 118763 6 6 6 6 2359 1905 1 1 1 538.2618 1074.5091 2 1074.5094 -0.0003 0 25.85 0.0038 K DNYPQSVPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3081.3081.2.dta 58 1 IPI00010418.4 Myosin-Ic 107 118763 6 6 6 6 4239 4782 1 1 1 682.8558 1363.697 2 1363.6983 -0.0013 0 53.24 2.80E-05 K TLFATEDALEVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6227.6227.2.dta 58 1 IPI00010418.4 Myosin-Ic 107 118763 6 6 6 6 5449 5536 1 1 1 800.9367 1599.8589 2 1599.862 -0.0032 0 30.4 0.0014 R LLQSNPVLEAFGNAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6991.6991.2.dta 58 1 IPI00010418.4 Myosin-Ic 107 118763 6 6 6 6 6104 5506 1 1 1 853.9446 1705.8747 2 1705.8774 -0.0027 0 44.44 0.00015 R DGTIDFTPGSELLITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6961.6961.2.dta 58 IPI00791026.1 56 kDa protein 90 56638 4 4 4 4 1080 3477 1 0 1 432.7447 863.4749 2 863.4752 -0.0004 0 21.08 0.042 K AVASEIFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4851.4851.2.dta 58 IPI00791026.1 56 kDa protein 90 56638 4 4 4 4 2359 1905 1 0 1 538.2618 1074.5091 2 1074.5094 -0.0003 0 25.85 0.0038 K DNYPQSVPR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3081.3081.2.dta 58 IPI00791026.1 56 kDa protein 90 56638 4 4 4 4 4239 4782 1 0 1 682.8558 1363.697 2 1363.6983 -0.0013 0 53.24 2.80E-05 K TLFATEDALEVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6227.6227.2.dta 58 IPI00791026.1 56 kDa protein 90 56638 4 4 4 4 6104 5506 1 0 1 853.9446 1705.8747 2 1705.8774 -0.0027 0 44.44 0.00015 R DGTIDFTPGSELLITK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6961.6961.2.dta 59 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 107 534809 3 3 3 3 3303 5158 1 1 1 615.3498 1228.685 2 1228.6856 -0.0006 0 25.25 0.0044 R IFVFEPPPGVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6608.6608.2.dta 59 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 107 534809 3 3 3 3 3844 3034 1 1 1 650.846 1299.6775 2 1299.6783 -0.0008 0 57.61 4.80E-06 R GNEIVLSAGSTPR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4371.4371.2.dta 59 1 IPI00456969.1 "Dynein heavy chain, cytosolic" 107 534809 3 3 3 3 5051 4335 1 1 1 756.9216 1511.8286 2 1511.8308 -0.0022 0 60.36 9.50E-06 R IQGLTVEQAEAVVR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5772.5772.2.dta 60 1 IPI00301277.1 Heat shock 70 kDa protein 1L 107 70730 3 3 3 3 2017 1058 1 1 0 509.2872 1016.5599 2 1016.5614 -0.0015 1 32.01 0.013 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2149.2149.2.dta 60 1 IPI00301277.1 Heat shock 70 kDa protein 1L 107 70730 3 3 3 3 3089 5286 1 1 1 599.3516 1196.6886 2 1196.6877 0.0009 0 38.34 0.0012 K DAGVIAGLNVLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6738.6738.2.dta 60 1 IPI00301277.1 Heat shock 70 kDa protein 1L 107 70730 3 3 3 3 4963 3738 1 1 0 744.354 1486.6935 2 1486.694 -0.0005 0 79.5 3.50E-08 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5133.5133.2.dta 60 2 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 98 71082 3 3 3 3 1818 1244 1 0 1 495.2661 988.5177 2 988.5189 -0.0012 1 33.61 0.011 R LSKEDIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2362.2362.2.dta 60 2 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 98 71082 3 3 3 3 2017 1058 1 0 0 509.2872 1016.5599 2 1016.5614 -0.0015 1 32.01 0.013 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2149.2149.2.dta 60 2 IPI00003865.1 Isoform 1 of Heat shock cognate 71 kDa protein 98 71082 3 3 3 3 4963 3738 1 0 0 744.354 1486.6935 2 1486.694 -0.0005 0 79.5 3.50E-08 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5133.5133.2.dta 60 IPI00007702.1 Heat shock-related 70 kDa protein 2 90 70263 2 2 2 2 2017 1058 1 0 0 509.2872 1016.5599 2 1016.5614 -0.0015 1 32.01 0.013 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2149.2149.2.dta 60 IPI00007702.1 Heat shock-related 70 kDa protein 2 90 70263 2 2 2 2 4963 3738 1 0 0 744.354 1486.6935 2 1486.694 -0.0005 0 79.5 3.50E-08 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5133.5133.2.dta 60 IPI00011134.1 Heat shock 70 kDa protein 7 (Fragment) 80 27004 1 1 1 1 4963 3738 1 0 0 744.354 1486.6935 2 1486.694 -0.0005 0 79.5 3.50E-08 R TTPSYVAFTDTER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5133.5133.2.dta 60 IPI00647012.1 Heat shock 70kDa protein 1A 32 52200 1 1 1 1 2017 1058 1 0 0 509.2872 1016.5599 2 1016.5614 -0.0015 1 32.01 0.013 K ITITNDKGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2149.2149.2.dta 61 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 105 112386 6 6 6 6 765 4636 1 1 1 407.2631 812.5117 2 812.512 -0.0003 0 36.05 0.0015 R ALVELLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6080.6080.2.dta 61 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 105 112386 6 6 6 6 1342 916 1 1 1 455.7531 909.4917 2 909.492 -0.0002 0 40.95 0.00057 R AGAAPVAPEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1995.1995.2.dta 61 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 105 112386 6 6 6 6 1464 2154 1 1 1 468.2506 934.4866 2 934.4872 -0.0006 0 34.89 0.0089 R LQEIYNR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3372.3372.2.dta 61 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 105 112386 6 6 6 6 2751 4209 1 1 1 571.829 1141.6435 2 1141.6455 -0.002 0 26.84 0.003 K QATELALLQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5641.5641.2.dta 61 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 105 112386 6 6 6 6 3189 641 1 1 1 605.7806 1209.5467 2 1209.5482 -0.0015 1 41.2 0.00047 R CKDTLANCTK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1697.1697.2.dta 61 1 IPI00291316.5 Rho/rac guanine nucleotide exchange factor (GEF) 2 105 112386 6 6 6 6 6869 4028 1 1 1 678.7159 2033.1258 3 2033.1269 -0.0011 1 22.18 0.0083 R AGAAPVAPEKQATELALLQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5447.5447.3.dta 62 1 IPI00026970.4 FACT complex subunit SPT16 102 120409 5 5 5 5 580 2407 1 1 1 387.229 772.4435 2 772.4443 -0.0008 0 35.05 0.0037 R AALLTER T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3673.3673.2.dta 62 1 IPI00026970.4 FACT complex subunit SPT16 102 120409 5 5 5 5 4181 4381 1 1 1 677.8321 1353.6496 2 1353.6499 -0.0003 0 34.31 0.00061 R INFYCPGSALGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5821.5821.2.dta 62 1 IPI00026970.4 FACT complex subunit SPT16 102 120409 5 5 5 5 4573 3927 1 1 1 713.3534 1424.6922 2 1424.6936 -0.0014 0 52.16 1.30E-05 K YTEGVQSLNWTK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5338.5338.2.dta 62 1 IPI00026970.4 FACT complex subunit SPT16 102 120409 5 5 5 5 4598 725 1 1 1 715.3857 1428.7569 2 1428.7572 -0.0003 1 22.74 0.0092 R LTEQKGEQQIQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1788.1788.2.dta 62 1 IPI00026970.4 FACT complex subunit SPT16 102 120409 5 5 5 5 5926 4985 1 1 1 838.9169 1675.8193 2 1675.8206 -0.0013 0 25.99 0.0059 R NEGNIFPNPEATFVK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6432.6432.2.dta 63 1 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 102 65979 3 3 3 3 1482 4044 1 1 1 469.253 936.4914 2 936.4917 -0.0002 0 33.66 0.0059 K TGISDVFAK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5464.5464.2.dta 63 1 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 102 65979 3 3 3 3 1905 3404 1 1 1 500.775 999.5354 2 999.5349 0.0005 0 51.48 5.50E-05 K NDLAVVDVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4772.4772.2.dta 63 1 IPI00444262.3 "CDNA FLJ45706 fis, clone FEBRA2028457, highly similar to Nucleolin" 102 65979 3 3 3 3 3045 367 1 1 1 596.8114 1191.6083 2 1191.6095 -0.0013 1 60.87 5.60E-06 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1399.1399.2.dta 63 IPI00183526.5 NCL protein 61 51667 1 1 1 1 3045 367 1 0 1 596.8114 1191.6083 2 1191.6095 -0.0013 1 60.87 5.60E-06 R IVTDRETGSSK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1399.1399.2.dta 64 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 102 156697 4 4 4 4 462 818 1 1 1 376.6884 751.3622 2 751.3613 0.0009 0 26.72 0.023 R SFSNAAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1889.1889.2.dta 64 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 102 156697 4 4 4 4 987 2257 1 0 1 422.2378 842.461 2 842.461 0.0001 0 50.03 0.00024 K ANELLQR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3491.3491.2.dta 64 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 102 156697 4 4 4 4 3614 5919 1 1 1 634.35 1266.6854 2 1266.686 -0.0006 0 22.77 0.043 R LLEVYDQLFK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7378.7378.2.dta 64 1 IPI00026625.1 Isoform 1 of Nuclear pore complex protein Nup155 102 156697 4 4 4 4 6302 3582 1 1 1 883.9276 1765.8406 2 1765.8417 -0.0012 0 68.25 4.00E-07 K ISNQVDLSNVCAQYR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4965.4965.2.dta 64 IPI00257903.4 Probable peptidase KIAA1815 23 101023 1 1 1 1 3614 5919 1 0 1 634.35 1266.6854 2 1266.6932 -0.0078 0 22.77 0.043 K LIEVQSNSLHK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7378.7378.2.dta 65 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 101 38936 2 2 2 2 398 187 1 1 0 364.2267 726.4389 2 726.4388 0.0001 1 30.28 0.0099 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1205.1205.2.dta 65 1 IPI00215965.2 Isoform A1-B of Heterogeneous nuclear ribonucleoprotein A1 101 38936 2 2 2 2 6031 1040 1 1 1 847.8536 1693.6926 2 1693.6928 -0.0002 0 89.56 2.20E-09 R NQGGYGGSSSSSSYGSGR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2130.2130.2.dta 66 1 IPI00013508.5 Alpha-actinin-1 100 103563 4 4 4 4 1081 3868 1 1 1 432.7449 863.4752 2 863.4752 -0.0001 0 35.6 0.0046 K ALDFIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5274.5274.2.dta 66 1 IPI00013508.5 Alpha-actinin-1 100 103563 4 4 4 4 4010 519 1 1 1 442.557 1324.6493 3 1324.6483 0.0009 1 34.53 0.007 R RDQALTEEHAR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1564.1564.3.dta 66 1 IPI00013508.5 Alpha-actinin-1 100 103563 4 4 4 4 4597 4070 1 1 1 715.3845 1428.7544 2 1428.7572 -0.0029 0 49.42 0.00011 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5493.5493.2.dta 66 1 IPI00013508.5 Alpha-actinin-1 100 103563 4 4 4 4 5152 4355 1 1 1 769.3901 1536.7657 2 1536.7671 -0.0014 0 52.96 6.70E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5794.5794.2.dta 66 IPI00013808.1 Alpha-actinin-4 90 105245 3 3 3 3 1081 3868 1 0 1 432.7449 863.4752 2 863.4752 -0.0001 0 35.6 0.0046 K ALDFIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5274.5274.2.dta 66 IPI00013808.1 Alpha-actinin-4 90 105245 3 3 3 3 4597 4070 1 0 1 715.3845 1428.7544 2 1428.7572 -0.0029 0 49.42 0.00011 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5493.5493.2.dta 66 IPI00013808.1 Alpha-actinin-4 90 105245 3 3 3 3 5152 4355 1 0 1 769.3901 1536.7657 2 1536.7671 -0.0014 0 52.96 6.70E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5794.5794.2.dta 66 IPI00032137.1 Alpha-actinin-3 64 103913 2 2 2 2 1081 3868 1 0 1 432.7449 863.4752 2 863.4752 -0.0001 0 35.6 0.0046 K ALDFIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5274.5274.2.dta 66 IPI00032137.1 Alpha-actinin-3 64 103913 2 2 2 2 5152 4355 1 0 1 769.3901 1536.7657 2 1536.7671 -0.0014 0 52.96 6.70E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5794.5794.2.dta 66 IPI00019884.1 Alpha-actinin-2 53 104358 1 1 1 1 5152 4355 1 0 1 769.3901 1536.7657 2 1536.7671 -0.0014 0 52.96 6.70E-05 R FAIQDISVEETSAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5794.5794.2.dta 66 IPI00793285.1 39 kDa protein 49 39035 1 1 1 1 4597 4070 1 0 1 715.3845 1428.7544 2 1428.7572 -0.0029 0 49.42 0.00011 R TINEVENQILTR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5493.5493.2.dta 67 1 IPI00183462.7 Isoform 2 of Exosome complex exonuclease RRP44 100 106241 3 3 3 3 2685 3369 1 1 1 565.3137 1128.6129 2 1128.6139 -0.001 0 62.94 1.00E-05 K GALTLSSPEVR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4734.4734.2.dta 67 1 IPI00183462.7 Isoform 2 of Exosome complex exonuclease RRP44 100 106241 3 3 3 3 3266 3424 1 1 1 611.8245 1221.6345 2 1221.6353 -0.0008 0 39.02 0.00092 K ASLTYAEAQLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4794.4794.2.dta 67 1 IPI00183462.7 Isoform 2 of Exosome complex exonuclease RRP44 100 106241 3 3 3 3 3298 3418 1 1 1 614.829 1227.6434 2 1227.6459 -0.0025 0 42.25 0.0003 K SLTANPELIDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4787.4787.2.dta 67 IPI00827723.1 64 kDa protein 42 64376 1 1 1 1 3298 3418 1 0 1 614.829 1227.6434 2 1227.6459 -0.0025 0 42.25 0.0003 K SLTANPELIDR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4787.4787.2.dta 68 1 IPI00182757.9 Isoform 2 of Protein KIAA1967 99 103593 3 3 3 3 3196 4510 1 1 1 605.861 1209.7074 2 1209.7081 -0.0007 0 34.88 0.00054 R LTPLQLEIQR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5953.5953.2.dta 68 1 IPI00182757.9 Isoform 2 of Protein KIAA1967 99 103593 3 3 3 3 3395 3393 1 1 1 620.8655 1239.7165 2 1239.7187 -0.0022 0 46.95 0.00013 K VQTLSNQPLLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4760.4760.2.dta 68 1 IPI00182757.9 Isoform 2 of Protein KIAA1967 99 103593 3 3 3 3 3696 2426 1 1 1 640.8234 1279.6323 2 1279.6343 -0.002 0 53.57 1.40E-05 R VVTQNICQYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3694.3694.2.dta 68 IPI00382429.2 30 kDa protein 54 30531 1 1 1 1 3696 2426 1 0 1 640.8234 1279.6323 2 1279.6343 -0.002 0 53.57 1.40E-05 R VVTQNICQYR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3694.3694.2.dta 69 1 IPI00305152.6 SEC31 homolog A isoform 4 99 122544 5 5 5 5 600 2319 1 1 1 389.2166 776.4186 2 776.4181 0.0005 0 31.69 0.015 R FASSPLR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3575.3575.2.dta 69 1 IPI00305152.6 SEC31 homolog A isoform 4 99 122544 5 5 5 5 1058 4295 1 1 1 430.7349 859.4553 2 859.4552 0.0001 0 27.29 0.028 R ATVWDLR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5731.5731.2.dta 69 1 IPI00305152.6 SEC31 homolog A isoform 4 99 122544 5 5 5 5 3171 1113 1 1 1 604.2856 1206.5566 2 1206.5551 0.0016 0 35.82 0.00075 R CLSSATDPQTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2211.2211.2.dta 69 1 IPI00305152.6 SEC31 homolog A isoform 4 99 122544 5 5 5 5 3868 3918 1 1 1 652.833 1303.6515 2 1303.6521 -0.0006 0 58.52 1.20E-05 R NPAVLSAASFDGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5328.5328.2.dta 69 1 IPI00305152.6 SEC31 homolog A isoform 4 99 122544 5 5 5 5 5986 4257 1 1 1 843.8979 1685.7813 2 1685.7831 -0.0018 0 27.92 0.0024 K TQPPEDISCIAWNR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5691.5691.2.dta 69 IPI00445429.1 "CDNA FLJ43909 fis, clone TESTI4010831" 75 106512 2 2 2 2 3171 1113 1 0 1 604.2856 1206.5566 2 1206.5551 0.0016 0 35.82 0.00075 R CLSSATDPQTK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2211.2211.2.dta 69 IPI00445429.1 "CDNA FLJ43909 fis, clone TESTI4010831" 75 106512 2 2 2 2 3868 3918 1 0 1 652.833 1303.6515 2 1303.6521 -0.0006 0 58.52 1.20E-05 R NPAVLSAASFDGR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5328.5328.2.dta 70 1 IPI00028005.1 Nuclear pore complex protein Nup107 99 107048 4 4 4 4 351 963 1 1 1 357.711 713.4074 2 713.4072 0.0002 0 14.75 0.041 R ATPGLQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2046.2046.2.dta 70 1 IPI00028005.1 Nuclear pore complex protein Nup107 99 107048 4 4 4 4 2285 4809 1 1 1 531.8006 1061.5866 2 1061.5869 -0.0003 0 37.01 0.00092 K TVVEALFQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6254.6254.2.dta 70 1 IPI00028005.1 Nuclear pore complex protein Nup107 99 107048 4 4 4 4 2953 3522 1 1 1 588.3113 1174.6081 2 1174.6081 0 0 54.61 1.10E-05 K EADLDVATITK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4900.4900.2.dta 70 1 IPI00028005.1 Nuclear pore complex protein Nup107 99 107048 4 4 4 4 3458 4246 1 1 1 624.832 1247.6494 2 1247.651 -0.0016 0 49.44 0.00024 R SGFGEISSPVIR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5680.5680.2.dta 70 IPI00448974.2 NUP107 protein 36 80490 2 2 2 2 351 963 1 0 1 357.711 713.4074 2 713.4072 0.0002 0 14.75 0.041 R ATPGLQK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2046.2046.2.dta 70 IPI00448974.2 NUP107 protein 36 80490 2 2 2 2 2285 4809 1 0 1 531.8006 1061.5866 2 1061.5869 -0.0003 0 37.01 0.00092 K TVVEALFQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6254.6254.2.dta 71 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 96 127371 4 4 4 4 2167 3966 1 1 1 520.7744 1039.5342 2 1039.5338 0.0003 1 37.67 0.00076 K LSAFAFKQE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5380.5380.2.dta 71 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 96 127371 4 4 4 4 2508 2792 1 1 1 550.77 1099.5255 2 1099.5298 -0.0043 0 25.79 0.0099 K QASAASYFQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4109.4109.2.dta 71 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 96 127371 4 4 4 4 2547 3729 1 1 1 554.3055 1106.5964 2 1106.5972 -0.0008 0 46.62 0.0002 K IAAGSSDFLVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5123.5123.2.dta 71 1 IPI00411614.1 WD repeat and HMG-box DNA-binding protein 1 96 127371 4 4 4 4 6358 3290 1 1 1 897.9224 1793.8302 2 1793.8333 -0.0031 0 46.31 0.00015 K LNAGYSNTATEWSQPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4648.4648.2.dta 71 IPI00513835.1 WD repeat and HMG-box DNA binding protein 1 isoform 2 71 113945 3 3 3 3 2167 3966 1 0 1 520.7744 1039.5342 2 1039.5338 0.0003 1 37.67 0.00076 K LSAFAFKQE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5380.5380.2.dta 71 IPI00513835.1 WD repeat and HMG-box DNA binding protein 1 isoform 2 71 113945 3 3 3 3 2508 2792 1 0 1 550.77 1099.5255 2 1099.5298 -0.0043 0 25.79 0.0099 K QASAASYFQK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4109.4109.2.dta 71 IPI00513835.1 WD repeat and HMG-box DNA binding protein 1 isoform 2 71 113945 3 3 3 3 6358 3290 1 0 1 897.9224 1793.8302 2 1793.8333 -0.0031 0 46.31 0.00015 K LNAGYSNTATEWSQPR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4648.4648.2.dta 72 1 IPI00022744.5 Isoform 1 of Exportin-2 95 111145 4 4 4 4 715 1865 1 1 1 402.7056 803.3966 2 803.396 0.0007 0 45.29 0.00096 R AACDLVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3038.3038.2.dta 72 1 IPI00022744.5 Isoform 1 of Exportin-2 95 111145 4 4 4 4 1821 4783 1 1 1 495.2922 988.5699 2 988.5705 -0.0007 0 25.77 0.014 R LLQAFLER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6228.6228.2.dta 72 1 IPI00022744.5 Isoform 1 of Exportin-2 95 111145 4 4 4 4 6388 4608 1 1 1 906.4267 1810.8388 2 1810.8407 -0.0019 0 63.55 1.10E-06 K NLFEDQNTLTSICEK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6052.6052.2.dta 72 1 IPI00022744.5 Isoform 1 of Exportin-2 95 111145 4 4 4 4 6881 3260 1 1 1 681.9675 2042.8806 3 2042.8817 -0.0011 1 22.82 0.021 R AADEEAFEDNSEEYIRR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4616.4616.3.dta 73 1 IPI00032258.4 Complement C4-A precursor 93 194247 2 2 2 2 1084 2666 1 1 1 433.2241 864.4337 2 864.4341 -0.0004 0 41.53 0.00087 K ANSFLGEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3972.3972.2.dta 73 1 IPI00032258.4 Complement C4-A precursor 93 194247 2 2 2 2 5165 3168 1 1 1 771.4103 1540.8061 2 1540.8097 -0.0036 0 72.27 2.40E-07 K VLSLAQEQVGGSPEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4516.4516.2.dta 73 IPI00418163.3 complement component 4B preproprotein 72 194170 1 1 1 1 5165 3168 1 0 1 771.4103 1540.8061 2 1540.8097 -0.0036 0 72.27 2.40E-07 K VLSLAQEQVGGSPEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4516.4516.2.dta 74 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 93 72953 3 3 3 3 4262 5083 1 1 0 684.8683 1367.7221 2 1367.7231 -0.001 0 23.72 0.018 R GDGPICLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6533.6533.2.dta 74 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 93 72953 3 3 3 3 4768 2359 1 1 1 728.3444 1454.6742 2 1454.675 -0.0008 0 78.18 8.40E-08 R SSQSSSQQFSGIGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3620.3620.2.dta 74 1 IPI00023785.5 Isoform 1 of Probable ATP-dependent RNA helicase DDX17 93 72953 3 3 3 3 6006 4140 1 1 1 846.4145 1690.8145 2 1690.8162 -0.0017 0 26.16 0.0035 R ELAQQVQQVADDYGK C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5568.5568.2.dta 74 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 67 69618 2 2 2 2 1788 3944 1 0 1 493.2876 984.5606 2 984.5604 0.0002 0 64.1 3.80E-06 K LLQLVEDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5356.5356.2.dta 74 2 IPI00017617.1 Probable ATP-dependent RNA helicase DDX5 67 69618 2 2 2 2 4262 5083 1 0 0 684.8683 1367.7221 2 1367.7231 -0.001 0 23.72 0.018 R GDGPICLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6533.6533.2.dta 74 IPI00798375.1 23 kDa protein 64 23474 1 1 1 1 1788 3944 1 0 1 493.2876 984.5606 2 984.5604 0.0002 0 64.1 3.80E-06 K LLQLVEDR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5356.5356.2.dta 75 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 93 274738 2 2 2 2 2341 4110 1 1 1 536.8037 1071.5929 2 1071.5924 0.0005 0 70.21 1.80E-06 K TAEEVAALIR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5536.5536.2.dta 75 1 IPI00007928.4 Pre-mRNA-processing-splicing factor 8 93 274738 2 2 2 2 3587 1185 1 1 1 631.8198 1261.6251 2 1261.6262 -0.0011 0 45.84 0.00023 K EQSQLTATQTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2298.2298.2.dta 75 IPI00445357.1 "CDNA FLJ44181 fis, clone THYMU2038301, highly similar to Homo sapiens PRP8 protein" 46 15173 1 1 1 1 3587 1185 1 0 1 631.8198 1261.6251 2 1261.6262 -0.0011 0 45.84 0.00023 K EQSQLTATQTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2298.2298.2.dta 76 1 IPI00289334.1 Isoform 1 of Filamin-B 92 280188 4 4 4 4 1059 2421 1 1 1 430.7351 859.4557 2 859.4552 0.0004 0 36.91 0.0015 K VFGPGVER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3689.3689.2.dta 76 1 IPI00289334.1 Isoform 1 of Filamin-B 92 280188 4 4 4 4 2554 4598 1 1 1 554.8055 1107.5964 2 1107.5965 0 0 35.19 0.0005 K IFFAGDTIPK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6042.6042.2.dta 76 1 IPI00289334.1 Isoform 1 of Filamin-B 92 280188 4 4 4 4 5016 5220 1 1 1 751.416 1500.8174 2 1500.8188 -0.0014 0 13.91 0.05 K SPFTVGVAAPLDLSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6670.6670.2.dta 76 1 IPI00289334.1 Isoform 1 of Filamin-B 92 280188 4 4 4 4 6640 3887 1 1 1 952.9405 1903.8664 2 1903.8669 -0.0005 0 55.02 6.90E-06 K SPFVVQVGEACNPNACR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5294.5294.2.dta 77 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 92 92833 4 4 4 4 1423 4338 1 1 1 465.7553 929.4961 2 929.4971 -0.001 0 35.18 0.0088 R GIALWGGEK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5775.5775.2.dta 77 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 92 92833 4 4 4 4 2550 4520 1 1 1 554.7764 1107.5382 2 1107.5383 -0.0001 0 40.07 0.00033 R NLFNVVDCK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5963.5963.2.dta 77 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 92 92833 4 4 4 4 4831 5352 1 1 1 734.3829 1466.7513 2 1466.7518 -0.0005 0 53.32 1.00E-05 K GTQGVVTNFEIFR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6803.6803.2.dta 77 1 IPI00396370.5 Isoform 1 of Eukaryotic translation initiation factor 3 subunit 9 92 92833 4 4 4 4 6906 1291 1 1 1 695.6568 2083.9486 3 2083.9518 -0.0033 1 20.82 0.02 R AQAVSEDAGGNEGRAAEAEPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2413.2413.3.dta 78 1 IPI00644127.1 "Isoleucyl-tRNA synthetase, cytoplasmic" 91 146178 4 4 4 4 1742 4262 1 1 1 487.7886 973.5626 2 973.563 -0.0004 0 34.14 0.0061 R LLILMEAR L Oxidation (M) 0.00001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5696.5696.2.dta 78 1 IPI00644127.1 "Isoleucyl-tRNA synthetase, cytoplasmic" 91 146178 4 4 4 4 2943 4638 1 1 1 587.3522 1172.6898 2 1172.6917 -0.0019 0 49.29 5.00E-05 R LYLINSPVVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6082.6082.2.dta 78 1 IPI00644127.1 "Isoleucyl-tRNA synthetase, cytoplasmic" 91 146178 4 4 4 4 4454 1725 1 1 1 701.2962 1400.5779 2 1400.5813 -0.0034 0 41.32 0.00027 K MGITEYNNQCR A Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2884.2884.2.dta 78 1 IPI00644127.1 "Isoleucyl-tRNA synthetase, cytoplasmic" 91 146178 4 4 4 4 4514 6304 1 1 1 706.8687 1411.7228 2 1411.7235 -0.0008 0 25.58 0.01 K TVYVSVLPTTADF - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7782.7782.2.dta 78 IPI00013234.2 IARS protein 68 121576 3 3 3 3 1742 4262 1 0 1 487.7886 973.5626 2 973.563 -0.0004 0 34.14 0.0061 R LLILMEAR L Oxidation (M) 0.00001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5696.5696.2.dta 78 IPI00013234.2 IARS protein 68 121576 3 3 3 3 2943 4638 1 0 1 587.3522 1172.6898 2 1172.6917 -0.0019 0 49.29 5.00E-05 R LYLINSPVVR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6082.6082.2.dta 78 IPI00013234.2 IARS protein 68 121576 3 3 3 3 4514 6304 1 0 1 706.8687 1411.7228 2 1411.7235 -0.0008 0 25.58 0.01 K TVYVSVLPTTADF - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7782.7782.2.dta 78 IPI00641574.1 Isoleucine-tRNA synthetase 54 38718 2 2 2 2 1742 4262 1 0 1 487.7886 973.5626 2 973.563 -0.0004 0 34.14 0.0061 R LLILMEAR L Oxidation (M) 0.00001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5696.5696.2.dta 78 IPI00641574.1 Isoleucine-tRNA synthetase 54 38718 2 2 2 2 4454 1725 1 0 1 701.2962 1400.5779 2 1400.5813 -0.0034 0 41.32 0.00027 K MGITEYNNQCR A Oxidation (M) 0.10000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2884.2884.2.dta 79 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 88 172080 5 5 5 5 106 2059 1 1 1 315.6944 629.3743 2 629.3748 -0.0005 0 32.45 0.02 R LGLEAK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3249.3249.2.dta 79 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 88 172080 5 5 5 5 1090 2480 1 1 1 433.7576 865.5006 2 865.5022 -0.0015 0 34.49 0.0017 K VIDPVAPR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3759.3759.2.dta 79 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 88 172080 5 5 5 5 1520 1939 1 1 1 471.7715 941.5285 2 941.5294 -0.0009 0 38.48 0.0017 R VAVQGDVVR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3118.3118.2.dta 79 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 88 172080 5 5 5 5 1696 2668 1 1 1 483.7444 965.4742 2 965.4753 -0.0011 0 37.81 0.002 K SCQFVAVR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3974.3974.2.dta 79 1 IPI00013452.8 glutamyl-prolyl tRNA synthetase 88 172080 5 5 5 5 2595 3613 1 1 1 558.3223 1114.6301 2 1114.6346 -0.0045 0 35.65 0.0018 R LNLNNTVLSK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4998.4998.2.dta 80 1 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 87 232534 4 4 4 4 1089 1186 1 1 1 433.7458 865.477 2 865.477 0 0 32.75 0.005 R HLLQEAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2299.2299.2.dta 80 1 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 87 232534 4 4 4 4 2579 729 1 1 1 557.2855 1112.5565 2 1112.5574 -0.0009 0 36.7 0.0019 R NPSSAAPVQSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1792.1792.2.dta 80 1 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 87 232534 4 4 4 4 3254 1942 1 1 1 610.321 1218.6274 2 1218.6244 0.003 0 64.51 6.10E-06 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3121.3121.2.dta 80 1 IPI00166487.3 Isoform 3 of Uncharacterized protein KIAA0310 87 232534 4 4 4 4 6633 4451 1 1 1 951.0284 1900.0422 2 1900.0418 0.0004 0 14.08 0.048 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5892.5892.2.dta 80 IPI00031242.7 KIAA0310 74 54299 2 2 2 2 1089 1186 1 0 1 433.7458 865.477 2 865.477 0 0 32.75 0.005 R HLLQEAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2299.2299.2.dta 80 IPI00031242.7 KIAA0310 74 54299 2 2 2 2 3254 1942 1 0 1 610.321 1218.6274 2 1218.6244 0.003 0 64.51 6.10E-06 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3121.3121.2.dta 80 IPI00647549.3 KIAA0310 protein (Fragment) 71 56651 3 3 3 3 1089 1186 1 0 1 433.7458 865.477 2 865.477 0 0 32.75 0.005 R HLLQEAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2299.2299.2.dta 80 IPI00647549.3 KIAA0310 protein (Fragment) 71 56651 3 3 3 3 3254 1942 1 0 1 610.321 1218.6274 2 1218.6244 0.003 0 64.51 6.10E-06 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3121.3121.2.dta 80 IPI00647549.3 KIAA0310 protein (Fragment) 71 56651 3 3 3 3 6633 4451 1 0 1 951.0284 1900.0422 2 1900.0418 0.0004 0 14.08 0.048 R LLPSAPQTLPDGPLASPAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5892.5892.2.dta 80 IPI00167711.3 "CDNA FLJ37437 fis, clone BRAWH2003025" 65 41303 1 1 1 1 3254 1942 1 0 1 610.321 1218.6274 2 1218.6244 0.003 0 64.51 6.10E-06 R GLANPEPAPEPK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3121.3121.2.dta 81 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 84 165975 3 3 3 3 2788 2709 1 1 1 574.7891 1147.5637 2 1147.5656 -0.0019 0 58.5 1.10E-05 K CLGLTEAQTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4019.4019.2.dta 81 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 84 165975 3 3 3 3 3693 5349 1 1 1 639.8506 1277.6867 2 1277.6867 0 0 44.57 0.00018 K TLGVDFIDVATK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6800.6800.2.dta 81 1 IPI00011062.1 "Isoform 1 of Carbamoyl-phosphate synthase [ammonia], mitochondrial precursor" 84 165975 3 3 3 3 4535 4946 1 1 1 710.3772 1418.7398 2 1418.7405 -0.0007 0 19.82 0.032 K AVNTLNEALEFAK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6393.6393.2.dta 82 1 IPI00298363.2 Far upstream element-binding protein 2 84 73063 3 3 3 3 1155 726 1 1 1 436.7328 871.451 2 871.4512 -0.0001 0 31.28 0.0039 K IQNDAGVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1789.1789.2.dta 82 1 IPI00298363.2 Far upstream element-binding protein 2 84 73063 3 3 3 3 1836 2822 1 1 1 496.7431 991.4717 2 991.4723 -0.0006 0 37.91 0.0034 K DAFADAVQR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4141.4141.2.dta 82 1 IPI00298363.2 Far upstream element-binding protein 2 84 73063 3 3 3 3 2397 3796 1 1 1 540.3145 1078.6145 2 1078.6135 0.001 0 59.45 8.80E-06 R IGGGIDVPVPR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5196.5196.2.dta 82 IPI00063245.1 Isoform 2 of Far upstream element-binding protein 3 31 28645 1 1 1 1 1155 726 1 0 1 436.7328 871.451 2 871.4512 -0.0001 0 31.28 0.0039 K IQNDAGVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1789.1789.2.dta 83 1 IPI00409671.2 DEAD box polypeptide 42 protein 83 103197 2 2 2 2 1605 4901 1 1 1 477.7845 953.5544 2 953.5546 -0.0002 0 20.65 0.025 R DILIDPIR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6346.6346.2.dta 83 1 IPI00409671.2 DEAD box polypeptide 42 protein 83 103197 2 2 2 2 4083 5038 1 1 1 670.3824 1338.7503 2 1338.7507 -0.0004 0 81.48 5.60E-08 K DIPVLVATDVAAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6489.6489.2.dta 84 1 IPI00644231.2 cytoplasmic FMR1 interacting protein 1 isoform a 83 146742 2 2 2 2 3501 1478 1 1 1 628.2974 1254.5803 2 1254.584 -0.0038 0 75.91 2.90E-07 R YSNSEVVTGSGR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2616.2616.2.dta 84 1 IPI00644231.2 cytoplasmic FMR1 interacting protein 1 isoform a 83 146742 2 2 2 2 4161 4971 1 1 1 676.3536 1350.6926 2 1350.6932 -0.0006 0 29.1 0.012 R TVLPFSQEFQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6418.6418.2.dta 84 IPI00550212.3 cytoplasmic FMR1 interacting protein 1 isoform b 29 95660 1 1 1 1 4161 4971 1 0 1 676.3536 1350.6926 2 1350.6932 -0.0006 0 29.1 0.012 R TVLPFSQEFQR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6418.6418.2.dta 85 1 IPI00296099.6 Thrombospondin-1 precursor 82 133291 7 7 6 6 1955 2438 1 1 1 505.2686 1008.5226 2 1008.524 -0.0014 0 24.2 0.0088 R AQGYSGLSVK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3707.3707.2.dta 85 1 IPI00296099.6 Thrombospondin-1 precursor 82 133291 7 7 6 6 3175 4588 1 1 1 604.3191 1206.6236 2 1206.6245 -0.0008 0 21.29 0.01 K SITLFVQEDR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6032.6032.2.dta 85 1 IPI00296099.6 Thrombospondin-1 precursor 82 133291 7 7 6 6 4125 250 1 1 1 673.8001 1345.5857 2 1345.5867 -0.001 1 21.63 0.0094 R TCHIQECDKR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1272.1272.2.dta 85 1 IPI00296099.6 Thrombospondin-1 precursor 82 133291 7 7 6 6 4126 242 1 1 1 449.536 1345.5863 3 1345.5867 -0.0004 1 34.21 0.0022 R TCHIQECDKR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1265.1265.3.dta 85 1 IPI00296099.6 Thrombospondin-1 precursor 82 133291 7 7 6 6 4275 3215 1 1 1 686.8327 1371.6509 2 1371.6531 -0.0023 0 26.83 0.011 K GTSQNDPNWVVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4567.4567.2.dta 85 1 IPI00296099.6 Thrombospondin-1 precursor 82 133291 7 7 6 6 4415 5720 1 1 1 697.869 1393.7234 2 1393.7242 -0.0008 0 21.38 0.0099 R FVFGTTPEDILR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7179.7179.2.dta 85 1 IPI00296099.6 Thrombospondin-1 precursor 82 133291 7 7 6 6 6797 1088 1 1 1 657.2866 1968.8379 3 1968.8378 0.0001 1 32.06 0.0024 R SCDSLNNRCEGSSVQTR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2182.2182.3.dta 86 1 IPI00006025.1 Isoform 1 of Squamous cell carcinoma antigen recognized by T-cells 3 78 110721 3 3 3 3 839 1854 2 1 1 415.2426 828.4707 2 828.4705 0.0002 0 49.38 0.00021 K ALQQLEK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3026.3026.2.dta 86 1 IPI00006025.1 Isoform 1 of Squamous cell carcinoma antigen recognized by T-cells 3 78 110721 3 3 3 3 1410 4173 1 1 1 464.2842 926.5539 2 926.5549 -0.001 0 38.26 0.0012 R TQLSLLPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5604.5604.2.dta 86 1 IPI00006025.1 Isoform 1 of Squamous cell carcinoma antigen recognized by T-cells 3 78 110721 3 3 3 3 1531 2183 1 1 1 472.7268 943.4391 2 943.4399 -0.0008 0 32.17 0.0011 R YSQYLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3407.3407.2.dta 86 IPI00790281.1 38 kDa protein 32 38857 1 1 1 1 1531 2183 1 0 1 472.7268 943.4391 2 943.4399 -0.0008 0 32.17 0.0011 R YSQYLDR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3407.3407.2.dta 87 1 IPI00177817.4 Isoform SERCA2A of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 77 111103 2 2 2 2 4498 4371 1 1 1 704.8503 1407.6861 2 1407.6882 -0.0021 0 50.05 2.50E-05 R IGIFGQDEDVTSK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5810.5810.2.dta 87 1 IPI00177817.4 Isoform SERCA2A of Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 77 111103 2 2 2 2 5517 4659 1 1 1 810.9095 1619.8044 2 1619.8076 -0.0032 0 42.6 0.0001 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6102.6102.2.dta 87 IPI00004092.2 Isoform SERCA3B of Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 43 115444 1 1 1 1 5517 4659 1 0 1 810.9095 1619.8044 2 1619.8076 -0.0032 0 42.6 0.0001 K VGEATETALTCLVEK M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6102.6102.2.dta 88 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 76 37464 3 3 3 3 398 187 1 0 0 364.2267 726.4389 2 726.4388 0.0001 1 30.28 0.0099 R VVEPKR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1205.1205.2.dta 88 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 76 37464 3 3 3 3 1976 3162 1 1 1 507.2252 1012.4359 2 1012.4363 -0.0004 0 47.81 7.80E-05 R GGNFGFGDSR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4510.4510.2.dta 88 1 IPI00396378.3 Isoform B1 of Heterogeneous nuclear ribonucleoproteins A2/B1 76 37464 3 3 3 3 4299 2894 1 1 1 689.3187 1376.6229 2 1376.6222 0.0007 0 37.58 0.00055 R GGGGNFGPGPGSNFR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4219.4219.2.dta 89 1 IPI00007402.2 120 kDa protein 76 120936 2 2 2 2 2464 3474 1 1 1 545.8032 1089.5918 2 1089.5931 -0.0013 0 56.18 4.80E-05 K AIFQTIQNR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4848.4848.2.dta 89 1 IPI00007402.2 120 kDa protein 76 120936 2 2 2 2 4969 4364 1 1 1 744.8856 1487.7567 2 1487.758 -0.0013 0 40.1 0.00017 K SDQNLQTALELTR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5803.5803.2.dta 90 1 IPI00456887.2 Heterogeneous nuclear ribonucleoprotein U-like protein 2 76 85622 2 2 2 2 2987 2715 1 1 1 592.2621 1182.5096 2 1182.5094 0.0002 0 21.21 0.01 R NYYGYQGYR - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4025.4025.2.dta 90 1 IPI00456887.2 Heterogeneous nuclear ribonucleoprotein U-like protein 2 76 85622 2 2 2 2 4972 4133 1 1 1 745.3863 1488.758 2 1488.7606 -0.0026 0 71.52 4.20E-07 R DLLVQQASQCLSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5561.5561.2.dta 91 1 IPI00066641.4 81 kDa protein 76 81849 2 2 2 2 1079 5308 1 1 1 432.7399 863.4653 2 863.4654 -0.0001 0 38.85 0.0021 K SGFLVWR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6760.6760.2.dta 91 1 IPI00066641.4 81 kDa protein 76 81849 2 2 2 2 3531 2939 1 1 1 630.3127 1258.6109 2 1258.6153 -0.0044 0 61.31 1.10E-05 R NDASEVVLAGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4268.4268.2.dta 92 1 IPI00328306.8 Zinc finger CCCH domain-containing protein 11A 71 90146 3 3 3 3 2594 5323 1 1 1 558.3185 1114.6225 2 1114.6234 -0.0008 0 46.16 0.00011 K TLEEILLER A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6775.6775.2.dta 92 1 IPI00328306.8 Zinc finger CCCH domain-containing protein 11A 71 90146 3 3 3 3 2809 4564 1 1 1 576.3607 1150.7068 2 1150.7074 -0.0006 0 31.78 0.0013 K TVVLPPIVASR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6007.6007.2.dta 92 1 IPI00328306.8 Zinc finger CCCH domain-containing protein 11A 71 90146 3 3 3 3 4012 2528 1 1 1 663.3625 1324.7105 2 1324.7099 0.0006 0 28.28 0.0068 K LSVQSNPSPQLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3814.3814.2.dta 92 IPI00455725.3 similar to Zinc finger CCCH-type domain-containing protein 11A isoform 1 28 89679 1 1 1 1 4012 2528 1 0 1 663.3625 1324.7105 2 1324.7099 0.0006 0 28.28 0.0068 K LSVQSNPSPQLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3814.3814.2.dta 93 1 IPI00039626.3 Isoform D of UPF0318 protein FAM120A 70 118415 2 2 2 2 4360 3889 1 1 1 693.8591 1385.7037 2 1385.7038 -0.0001 1 70.45 1.90E-06 R EAALEAAVLNKEE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5296.5296.2.dta 93 1 IPI00039626.3 Isoform D of UPF0318 protein FAM120A 70 118415 2 2 2 2 6896 2562 1 1 1 691.0247 2070.0521 3 2070.0494 0.0028 0 19.9 0.014 K NQAAIQGRPPYAASAEEVAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3854.3854.3.dta 93 IPI00472054.1 Isoform A of UPF0318 protein FAM120A 20 117711 1 1 1 1 6896 2562 1 0 1 691.0247 2070.0521 3 2070.0494 0.0028 0 19.9 0.014 K NQAAIQGRPPYAASAEEVAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3854.3854.3.dta 94 1 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 70 71883 2 2 2 2 2603 3669 1 1 1 559.2688 1116.523 2 1116.524 -0.001 0 47.03 5.90E-05 K YAQAGFEGFK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5059.5059.2.dta 94 1 IPI00168235.4 "CDNA FLJ33352 fis, clone BRACE2005087, weakly similar to PRE-MRNA SPLICING HELICASE BRR2" 70 71883 2 2 2 2 2864 5886 1 1 1 582.2955 1162.5764 2 1162.5771 -0.0007 0 44.26 0.00084 R DIDAFWLQR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7345.7345.2.dta 95 1 IPI00167998.2 C1orf55 protein 69 50452 1 1 1 1 839 1854 1 0 1 415.2426 828.4707 2 828.4705 0.0002 0 68.55 2.50E-06 R ALGAQIEK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3026.3026.2.dta 96 1 IPI00166768.2 TUBA6 protein 68 37681 3 3 3 3 1998 3510 1 1 1 508.2927 1014.5709 2 1014.5709 0 0 63.25 1.00E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4887.4887.2.dta 96 1 IPI00166768.2 TUBA6 protein 68 37681 3 3 3 3 6083 5814 1 1 1 851.4554 1700.8962 2 1700.8985 -0.0023 0 23.95 0.0057 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7273.7273.2.dta 96 1 IPI00166768.2 TUBA6 protein 68 37681 3 3 3 3 6428 4298 1 1 1 912.995 1823.9754 2 1823.9782 -0.0027 0 16.78 0.027 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5734.5734.2.dta 96 IPI00414274.3 similar to Tubulin alpha-3 chain 63 23560 1 1 1 1 1998 3510 1 0 1 508.2927 1014.5709 2 1014.5709 0 0 63.25 1.00E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4887.4887.2.dta 96 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 60 50612 2 2 2 2 1998 3510 1 0 1 508.2927 1014.5709 2 1014.5709 0 0 63.25 1.00E-05 K DVNAAIATIK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4887.4887.2.dta 96 IPI00179709.4 Isoform 1 of Tubulin alpha-2 chain 60 50612 2 2 2 2 6428 4298 1 0 1 912.995 1823.9754 2 1823.9782 -0.0027 0 16.78 0.027 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5734.5734.2.dta 96 IPI00478908.3 29 kDa protein 24 28716 1 1 1 1 6083 5814 1 0 1 851.4554 1700.8962 2 1700.8985 -0.0023 0 23.95 0.0057 R AVFVDLEPTVIDEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7273.7273.2.dta 96 IPI00007750.1 Tubulin alpha-1 chain 17 50634 1 1 1 1 6428 4298 1 0 1 912.995 1823.9754 2 1823.9782 -0.0027 0 16.78 0.027 K VGINYQPPTVVPGGDLAK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5734.5734.2.dta 97 1 IPI00007927.3 Isoform 1 of Structural maintenance of chromosomes protein 2 68 136266 3 3 3 3 402 1718 1 1 1 364.7244 727.4342 2 727.4341 0.0001 0 14.38 0.049 R QVVIGGR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2876.2876.2.dta 97 1 IPI00007927.3 Isoform 1 of Structural maintenance of chromosomes protein 2 68 136266 3 3 3 3 5054 4222 1 1 1 757.918 1513.8215 2 1513.8239 -0.0024 0 52.67 4.00E-05 K TILEEEITPTIQK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5655.5655.2.dta 97 1 IPI00007927.3 Isoform 1 of Structural maintenance of chromosomes protein 2 68 136266 3 3 3 3 5127 5068 1 1 1 767.3907 1532.7669 2 1532.7682 -0.0013 0 36.81 0.0009 K DTSATTALELVAGER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6519.6519.2.dta 98 1 IPI00013933.2 Isoform DPI of Desmoplakin 67 334021 4 4 4 4 1329 4270 1 1 1 454.2659 906.5172 2 906.5174 -0.0002 0 27.42 0.0081 R YIELLTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5705.5705.2.dta 98 1 IPI00013933.2 Isoform DPI of Desmoplakin 67 334021 4 4 4 4 2349 1235 1 1 1 537.2805 1072.5464 2 1072.5513 -0.0049 0 32.84 0.0019 R GAGSIAGASASPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2352.2352.2.dta 98 1 IPI00013933.2 Isoform DPI of Desmoplakin 67 334021 4 4 4 4 2912 1073 1 1 1 585.7725 1169.5305 2 1169.5313 -0.0008 0 27.77 0.018 R YEVTSGGGGTSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2165.2165.2.dta 98 1 IPI00013933.2 Isoform DPI of Desmoplakin 67 334021 4 4 4 4 3636 816 1 1 1 636.8296 1271.6446 2 1271.647 -0.0023 1 43.72 0.00086 R RVEEDIQQQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1887.1887.2.dta 98 IPI00217182.4 Isoform DPII of Desmoplakin 48 262166 3 3 3 3 1329 4270 1 0 1 454.2659 906.5172 2 906.5174 -0.0002 0 27.42 0.0081 R YIELLTR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5705.5705.2.dta 98 IPI00217182.4 Isoform DPII of Desmoplakin 48 262166 3 3 3 3 2349 1235 1 0 1 537.2805 1072.5464 2 1072.5513 -0.0049 0 32.84 0.0019 R GAGSIAGASASPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2352.2352.2.dta 98 IPI00217182.4 Isoform DPII of Desmoplakin 48 262166 3 3 3 3 2912 1073 1 0 1 585.7725 1169.5305 2 1169.5313 -0.0008 0 27.77 0.018 R YEVTSGGGGTSR M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2165.2165.2.dta 99 1 IPI00163496.11 136 kDa protein 66 136607 1 1 1 1 4896 3892 1 1 1 737.8849 1473.7553 2 1473.7576 -0.0022 0 66.4 5.90E-07 R GLAAGSAETLPANFR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5300.5300.2.dta 100 1 IPI00292009.8 palladin 65 123225 2 2 2 2 2960 1930 1 1 0 589.2836 1176.5526 2 1176.5557 -0.0031 0 27.81 0.0048 K NEAGIVSCTAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3108.3108.2.dta 100 1 IPI00292009.8 palladin 65 123225 2 2 2 2 4304 2736 1 1 1 689.8132 1377.6118 2 1377.6161 -0.0043 0 54.75 1.60E-05 R QGSEIQDSPDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4048.4048.2.dta 100 2 IPI00383645.2 CGI-151 protein 61 45490 2 2 2 2 2960 1930 1 0 0 589.2836 1176.5526 2 1176.5557 -0.0031 0 27.81 0.0048 K NEAGIVSCTAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3108.3108.2.dta 100 2 IPI00383645.2 CGI-151 protein 61 45490 2 2 2 2 3798 3919 1 0 1 647.3376 1292.6607 2 1292.6612 -0.0005 0 49.88 2.90E-05 R YAALSDQGLDIK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5329.5329.2.dta 100 IPI00166197.3 "CDNA FLJ39139 fis, clone NTONG2009229" 55 45593 1 1 1 1 4304 2736 1 0 1 689.8132 1377.6118 2 1377.6161 -0.0043 0 54.75 1.60E-05 R QGSEIQDSPDFR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4048.4048.2.dta 100 IPI00477680.6 Isoform 2 of Myopalladin 28 115877 1 1 1 1 2960 1930 1 0 0 589.2836 1176.5526 2 1176.5557 -0.0031 0 27.81 0.0048 K NEAGIVSCTAR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3108.3108.2.dta 101 1 IPI00008240.2 "Methionyl-tRNA synthetase, cytoplasmic" 63 102249 1 1 1 1 3225 3002 1 1 1 608.812 1215.6095 2 1215.6095 0 0 63.21 1.20E-05 K LENDQIESLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4336.4336.2.dta 102 1 IPI00171903.2 Isoform 1 of Heterogeneous nuclear ribonucleoprotein M 63 77749 1 1 1 1 3721 2078 1 1 1 642.8181 1283.6216 2 1283.6219 -0.0003 0 62.95 1.30E-06 K QGGGGGGGSVPGIER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3272.3272.2.dta 103 1 IPI00303063.7 SCC-112 protein 63 152274 1 1 1 1 4043 1566 1 1 1 665.8508 1329.6871 2 1329.6888 -0.0017 0 62.95 1.20E-05 R TVTAAGAENIQQK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2712.2712.2.dta 104 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 63 122513 3 3 3 3 795 286 1 1 1 411.2003 820.3861 2 820.3861 -0.0001 0 27.42 0.014 K ATNVCTR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1311.1311.2.dta 104 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 63 122513 3 3 3 3 1523 1424 1 1 1 472.2636 942.5127 2 942.5134 -0.0007 0 26.68 0.0031 R LVDQNLNK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2557.2557.2.dta 104 1 IPI00297211.1 SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 63 122513 3 3 3 3 2677 3116 1 1 1 564.8219 1127.6292 2 1127.6299 -0.0006 0 47.24 0.00021 R LDSIVIQQGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4460.4460.2.dta 104 IPI00216046.2 Isoform 1 of Probable global transcription activator SNF2L1 47 123211 1 1 1 1 2677 3116 1 0 1 564.8219 1127.6292 2 1127.6299 -0.0006 0 47.24 0.00021 R LDSIVIQQGR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4460.4460.2.dta 105 1 IPI00293464.5 DNA damage-binding protein 1 63 128142 2 2 2 2 1056 2227 1 1 1 430.2476 858.4806 2 858.4811 -0.0005 0 56.44 5.90E-05 R LGDSQLVK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3456.3456.2.dta 105 1 IPI00293464.5 DNA damage-binding protein 1 63 128142 2 2 2 2 1240 6000 1 1 1 448.7202 895.4259 2 895.426 -0.0001 0 26.61 0.0032 R AHGNVQDR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.746.746.2.dta 106 1 IPI00022970.4 Nucleoprotein TPR 61 266106 1 1 1 1 3661 1036 1 1 1 638.3174 1274.6202 2 1274.6215 -0.0012 0 61.23 1.40E-05 R ASTALSNEQQAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2125.2125.2.dta 107 1 IPI00013881.6 Heterogeneous nuclear ribonucleoprotein H 61 49484 1 1 1 1 5022 3956 1 1 1 752.8455 1503.6765 2 1503.6776 -0.0011 0 60.93 5.20E-06 R GLPWSCSADEVQR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5369.5369.2.dta 108 1 IPI00220991.2 Hypothetical protein DKFZp781K0743 59 106695 2 2 2 2 3295 3320 1 1 0 614.785 1227.5554 2 1227.5554 0 0 27.16 0.0076 K DCEDPNPLIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4681.4681.2.dta 108 1 IPI00220991.2 Hypothetical protein DKFZp781K0743 59 106695 2 2 2 2 3681 2688 1 1 1 639.3454 1276.6762 2 1276.6775 -0.0013 0 50.83 5.20E-05 K LQNNNVYTIAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3996.3996.2.dta 108 2 IPI00328257.4 Isoform A of AP-1 complex subunit beta-1 52 105452 3 3 3 3 3178 4033 1 0 1 604.3371 1206.6596 2 1206.6608 -0.0012 0 18.12 0.03 K LQSSNIFTVAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5452.5452.2.dta 108 2 IPI00328257.4 Isoform A of AP-1 complex subunit beta-1 52 105452 3 3 3 3 3295 3320 1 0 0 614.785 1227.5554 2 1227.5554 0 0 27.16 0.0076 K DCEDPNPLIR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4681.4681.2.dta 108 2 IPI00328257.4 Isoform A of AP-1 complex subunit beta-1 52 105452 3 3 3 3 3584 1845 1 0 1 631.7869 1261.5593 2 1261.5608 -0.0015 0 41.95 0.00036 R DCPLNAEAASSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3017.3017.2.dta 108 IPI00385007.2 Hypothetical protein DKFZp686A01208 43 20636 2 2 2 2 3178 4033 1 0 1 604.3371 1206.6596 2 1206.6608 -0.0012 0 18.12 0.03 K LQSSNIFTVAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5452.5452.2.dta 108 IPI00385007.2 Hypothetical protein DKFZp686A01208 43 20636 2 2 2 2 3584 1845 1 0 1 631.7869 1261.5593 2 1261.5608 -0.0015 0 41.95 0.00036 R DCPLNAEAASSK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3017.3017.2.dta 109 1 IPI00305267.2 Isoform 1 of Golgin subfamily A member 3 59 167765 1 1 1 1 4782 4359 1 1 1 730.3671 1458.7196 2 1458.7202 -0.0006 0 58.58 3.20E-06 K VLELEDELQESR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5798.5798.2.dta 110 1 IPI00019848.1 Isoform 1 of Host cell factor 59 210707 3 3 3 3 1699 3777 1 1 1 483.8028 965.591 2 965.591 0 0 29.91 0.0012 K GPLPAGTILK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5175.5175.2.dta 110 1 IPI00019848.1 Isoform 1 of Host cell factor 59 210707 3 3 3 3 2910 1296 1 1 1 390.5335 1168.5788 3 1168.5771 0.0017 0 26.98 0.027 R AGHCAVAINTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2418.2418.3.dta 110 1 IPI00019848.1 Isoform 1 of Host cell factor 59 210707 3 3 3 3 4113 4708 1 1 1 672.8788 1343.743 2 1343.7449 -0.0019 0 42.32 0.00089 R SPAFVQLAPLSSK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6152.6152.2.dta 110 IPI00641238.1 14 kDa protein 27 14298 1 1 1 1 2910 1296 1 0 1 390.5335 1168.5788 3 1168.5771 0.0017 0 26.98 0.027 R AGHCAVAINTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2418.2418.3.dta 111 1 IPI00162563.5 Isoform 1 of E3 ubiquitin-protein ligase BRE1B 58 114350 2 2 2 2 5131 4279 1 1 1 767.9138 1533.8131 2 1533.8151 -0.002 0 41.38 0.00013 R EGPSLGPPPVASALSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5715.5715.2.dta 111 1 IPI00162563.5 Isoform 1 of E3 ubiquitin-protein ligase BRE1B 58 114350 2 2 2 2 6419 3773 1 1 1 607.3267 1818.9582 3 1818.9588 -0.0006 1 33.35 0.0015 R EREGPSLGPPPVASALSR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5171.5171.3.dta 112 1 IPI00647217.2 Superkiller viralicidic activity 2-like 2 58 118756 1 1 1 1 2500 3443 1 1 1 549.3187 1096.6228 2 1096.624 -0.0013 0 57.83 1.10E-05 K LTEQLAGPLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4814.4814.2.dta 113 1 IPI00302925.3 "Chaperonin containing TCP1, subunit 8 (Theta) variant" 57 60311 1 1 1 1 2800 4424 1 1 1 575.7979 1149.5812 2 1149.5818 -0.0007 0 57.32 3.70E-05 K FAEAFEAIPR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5864.5864.2.dta 114 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 57 18296 4 4 3 3 541 3640 1 1 0 383.2201 764.4256 2 764.4255 0.0002 0 33.21 0.013 - MQIFVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5028.5028.2.dta 114 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 57 18296 4 4 3 3 5090 2110 1 1 1 508.5979 1522.7718 3 1522.774 -0.0022 1 14.87 0.04 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3317.3317.3.dta 114 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 57 18296 4 4 3 3 5091 1108 1 1 1 762.3937 1522.7729 2 1522.774 -0.001 1 21.99 0.0087 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2203.2203.2.dta 114 1 IPI00179330.6 ubiquitin and ribosomal protein S27a precursor 57 18296 4 4 3 3 6340 4398 1 1 1 894.4659 1786.9172 2 1786.92 -0.0028 0 40.44 0.00023 K TITLEVEPSDTIENVK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5838.5838.2.dta 114 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 34 18355 3 3 2 2 541 3640 1 0 0 383.2201 764.4256 2 764.4255 0.0002 0 33.21 0.013 - MQIFVK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5028.5028.2.dta 114 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 34 18355 3 3 2 2 5090 2110 1 0 1 508.5979 1522.7718 3 1522.774 -0.0022 1 14.87 0.04 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3317.3317.3.dta 114 IPI00397808.3 similar to ubiquitin and ribosomal protein S27a precursor 34 18355 3 3 2 2 5091 1108 1 0 1 762.3937 1522.7729 2 1522.774 -0.001 1 21.99 0.0087 K IQDKEGIPPDQQR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2203.2203.2.dta 115 1 IPI00025057.1 Isoform 2 of Double-stranded RNA-specific adenosine deaminase 57 134317 2 2 2 2 1772 2049 1 1 1 491.7236 981.4327 2 981.4338 -0.0012 0 52.23 3.70E-05 K LGNSCEFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3237.3237.2.dta 115 1 IPI00025057.1 Isoform 2 of Double-stranded RNA-specific adenosine deaminase 57 134317 2 2 2 2 3514 1686 1 1 1 629.3434 1256.6723 2 1256.6724 -0.0001 1 21.94 0.0088 R VLIGENEKAER M C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2842.2842.2.dta 116 1 IPI00182469.2 Isoform 1AB of Catenin delta-1 57 107853 3 3 3 3 3736 2190 1 1 1 643.8262 1285.6379 2 1285.6415 -0.0036 0 39.86 0.0012 R QDVYGPQPQVR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3415.3415.2.dta 116 1 IPI00182469.2 Isoform 1AB of Catenin delta-1 57 107853 3 3 3 3 4238 3354 1 1 1 682.8301 1363.6457 2 1363.648 -0.0023 0 34.21 0.0029 K SDFQVNLNNASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4718.4718.2.dta 116 1 IPI00182469.2 Isoform 1AB of Catenin delta-1 57 107853 3 3 3 3 4734 5621 1 1 1 725.3902 1448.7658 2 1448.7664 -0.0005 0 26.34 0.016 R GYELLFQPEVVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7077.7077.2.dta 116 IPI00219743.1 Isoform 4ABC of Catenin delta-1 40 72571 2 2 2 2 4238 3354 1 0 1 682.8301 1363.6457 2 1363.648 -0.0023 0 34.21 0.0029 K SDFQVNLNNASR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4718.4718.2.dta 116 IPI00219743.1 Isoform 4ABC of Catenin delta-1 40 72571 2 2 2 2 4734 5621 1 0 1 725.3902 1448.7658 2 1448.7664 -0.0005 0 26.34 0.016 R GYELLFQPEVVR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7077.7077.2.dta 117 1 IPI00027808.1 DNA-directed RNA polymerase II 140 kDa polypeptide 57 135236 2 2 2 2 1919 2785 1 1 1 501.7769 1001.5392 2 1001.5393 -0.0001 0 48.85 0.00036 R VSGDDVIIGK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4101.4101.2.dta 117 1 IPI00027808.1 DNA-directed RNA polymerase II 140 kDa polypeptide 57 135236 2 2 2 2 7004 3442 1 1 1 758.7152 2273.1238 3 2273.1288 -0.005 1 28.39 0.0022 K VSANKGEIGDATPFNDAVNVQK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4813.4813.3.dta 118 1 IPI00374732.4 similar to peptidylprolyl isomerase A isoform 1 56 24316 1 1 1 1 3448 3250 1 1 1 624.3176 1246.6207 2 1246.6227 -0.002 1 56.29 3.50E-05 K KITIADCGQLE - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4605.4605.2.dta 119 1 IPI00065931.3 A-kinase anchor protein 13 isoform 1 56 310733 1 1 1 1 6244 4281 1 1 1 874.433 1746.8514 2 1746.8537 -0.0023 0 55.73 5.90E-06 R IGDVLVNQFSGENAER L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5717.5717.2.dta 120 1 IPI00217030.10 "40S ribosomal protein S4, X isoform" 55 29807 1 1 1 1 1827 4940 1 1 1 495.8026 989.5906 2 989.591 -0.0004 0 55.35 1.10E-05 R LSNIFVIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6386.6386.2.dta 121 1 IPI00295857.6 Coatomer subunit alpha 54 139783 3 3 3 3 2253 4097 1 1 1 528.7714 1055.5283 2 1055.5288 -0.0005 0 43.64 8.10E-05 K GFFEGTIASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5522.5522.2.dta 121 1 IPI00295857.6 Coatomer subunit alpha 54 139783 3 3 3 3 3415 2924 1 1 1 622.3177 1242.6208 2 1242.6204 0.0004 0 21.82 0.024 K NLSPGAVESDVR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4252.4252.2.dta 121 1 IPI00295857.6 Coatomer subunit alpha 54 139783 3 3 3 3 5058 3588 1 1 1 758.3345 1514.6545 2 1514.6534 0.0011 0 20.04 0.013 K CPLSGACYSPEFK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4971.4971.2.dta 122 1 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 54 87804 3 3 2 2 1286 7229 1 1 1 452.2251 902.4356 2 902.4359 -0.0003 0 23.29 0.022 R VYSGHQGR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.942.942.2.dta 122 1 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 54 87804 3 3 2 2 2881 4053 1 1 1 582.8578 1163.7011 2 1163.7026 -0.0015 0 41.78 9.60E-05 R APQVLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5474.5474.2.dta 122 1 IPI00015953.3 Isoform 1 of Nucleolar RNA helicase 2 54 87804 3 3 2 2 2882 4069 1 1 1 582.8582 1163.7018 2 1163.7026 -0.0009 0 19.8 0.015 R APQVLVLAPTR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5491.5491.2.dta 123 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 53 129274 3 3 3 3 774 2252 1 1 1 408.71 815.4055 2 815.4065 -0.001 0 25.24 0.022 R YTYLEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3484.3484.2.dta 123 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 53 129274 3 3 3 3 1688 4283 1 1 1 482.7891 963.5636 2 963.5641 -0.0005 0 46.39 0.00011 R LLEIVSYK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5719.5719.2.dta 123 1 IPI00003965.4 Ubiquitin carboxyl-terminal hydrolase 7 53 129274 3 3 3 3 1814 1147 1 1 1 495.244 988.4734 2 988.4726 0.0007 0 19.58 0.03 R HNYEGTLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2257.2257.2.dta 123 IPI00783739.1 128 kDa protein 26 129318 2 2 2 2 774 2252 1 0 1 408.71 815.4055 2 815.4065 -0.001 0 25.24 0.022 R YTYLEK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3484.3484.2.dta 123 IPI00783739.1 128 kDa protein 26 129318 2 2 2 2 1814 1147 1 0 1 495.244 988.4734 2 988.4726 0.0007 0 19.58 0.03 R HNYEGTLR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2257.2257.2.dta 124 1 IPI00020985.3 Histone acetyltransferase p300 51 266881 2 2 2 2 1318 4610 1 0 1 453.7558 905.4971 2 905.4971 0 0 52.42 0.00011 R DAFLTLAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6054.6054.2.dta 124 1 IPI00020985.3 Histone acetyltransferase p300 51 266881 2 2 2 2 2184 539 1 0 1 522.2768 1042.539 2 1042.5407 -0.0017 0 18.44 0.019 R TQAAGPVSQGK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1585.1585.2.dta 124 IPI00023339.2 CREB-binding protein 52 268033 1 1 1 1 1318 4610 1 0 1 453.7558 905.4971 2 905.4971 0 0 52.42 0.00011 R DAFLTLAR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6054.6054.2.dta 125 1 IPI00025273.1 Isoform Long of Trifunctional purine biosynthetic protein adenosine-3 52 108953 3 3 3 3 388 5711 1 1 1 363.2067 724.3988 2 724.398 0.0008 0 18.16 0.02 K VVTHGGR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.717.717.2.dta 125 1 IPI00025273.1 Isoform Long of Trifunctional purine biosynthetic protein adenosine-3 52 108953 3 3 3 3 2191 4168 1 1 1 522.3032 1042.5918 2 1042.5923 -0.0006 0 46.58 0.00021 R AIAFLQQPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5599.5599.2.dta 125 1 IPI00025273.1 Isoform Long of Trifunctional purine biosynthetic protein adenosine-3 52 108953 3 3 3 3 5452 2364 1 1 1 801.4006 1600.7867 2 1600.7879 -0.0012 0 20.48 0.012 K QVLVAPGNAGTACSEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3625.3625.2.dta 125 IPI00384624.1 GARS-AIRS-GART (Fragment) 47 10783 1 1 1 1 2191 4168 1 0 1 522.3032 1042.5918 2 1042.5923 -0.0006 0 46.58 0.00021 R AIAFLQQPR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5599.5599.2.dta 125 IPI00657647.1 24 kDa protein 20 24653 1 1 1 1 5452 2364 1 0 1 801.4006 1600.7867 2 1600.7879 -0.0012 0 20.48 0.012 K QVLVAPGNAGTACSEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3625.3625.2.dta 126 1 IPI00028888.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein D0 51 38581 1 1 1 1 4968 3965 1 1 1 744.8815 1487.7485 2 1487.7508 -0.0023 0 51.23 8.00E-05 K IFVGGLSPDTPEEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5379.5379.2.dta 127 1 IPI00217540.7 Isoform 2 of Lysine-specific histone demethylase 1 51 95609 1 1 1 1 3294 5118 1 1 1 614.3396 1226.6646 2 1226.6659 -0.0013 0 51.22 0.0001 R TLQLWLDNPK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6569.6569.2.dta 128 1 IPI00329672.4 Myosin-Ie 51 127531 3 3 3 3 1166 5435 1 1 1 437.7408 873.467 2 873.4668 0.0002 0 39.17 0.0033 K GRPTTAGSK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.689.689.2.dta 128 1 IPI00329672.4 Myosin-Ie 51 127531 3 3 3 3 2043 5598 1 1 1 511.3006 1020.5866 2 1020.5855 0.0011 0 20.16 0.021 K TEFLSLLAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7054.7054.2.dta 128 1 IPI00329672.4 Myosin-Ie 51 127531 3 3 3 3 3820 5996 1 1 1 648.8453 1295.676 2 1295.6762 -0.0002 0 32.99 0.0022 R VFDFLVDSINK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7456.7456.2.dta 129 1 IPI00329352.3 Nodal modulator 1 precursor 50 135237 2 2 2 2 3009 2784 1 1 1 593.806 1185.5975 2 1185.5989 -0.0014 0 44.68 6.50E-05 R EQQLAEIEAR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4100.4100.2.dta 129 1 IPI00329352.3 Nodal modulator 1 precursor 50 135237 2 2 2 2 5104 5184 1 1 1 763.4267 1524.8388 2 1524.8399 -0.0011 0 19.55 0.015 K SSIDSEPALVLGPLK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6634.6634.2.dta 130 1 IPI00031982.1 Nck-associated protein 1 48 130018 2 2 2 2 1809 502 1 1 1 494.7927 987.5708 2 987.5713 -0.0005 1 21.14 0.017 K TISQAVNKK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1545.1545.2.dta 130 1 IPI00031982.1 Nck-associated protein 1 48 130018 2 2 2 2 2784 4826 1 1 1 574.3075 1146.6004 2 1146.6033 -0.0029 0 47.97 0.00042 K AAEDLFVNIR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6270.6270.2.dta 131 1 IPI00413895.2 "Golgi autoantigen, golgin subfamily A member 2" 47 113644 1 1 1 1 2123 1294 1 1 1 516.7878 1031.561 2 1031.5611 -0.0001 0 47.45 0.00031 R ALSAVSTQQK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2416.2416.2.dta 132 1 IPI00034049.1 Isoform 1 of Regulator of nonsense transcripts 1 47 125578 3 3 3 3 673 487 1 1 1 398.7375 795.4604 2 795.4603 0.0001 0 22.18 0.046 K IHQTGLK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1529.1529.2.dta 132 1 IPI00034049.1 Isoform 1 of Regulator of nonsense transcripts 1 47 125578 3 3 3 3 3272 4415 1 1 1 612.3587 1222.7029 2 1222.7034 -0.0005 0 36.69 0.0019 K VLVEGPLNNLR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5854.5854.2.dta 132 1 IPI00034049.1 Isoform 1 of Regulator of nonsense transcripts 1 47 125578 3 3 3 3 4325 3139 1 1 1 690.8298 1379.6451 2 1379.647 -0.0019 0 26.37 0.0034 R AYQHGGVTGLSQY - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4485.4485.2.dta 133 1 IPI00009104.7 RuvB-like 2 47 51296 1 1 1 1 2822 4348 1 1 1 578.3027 1154.5909 2 1154.5931 -0.0022 0 47.09 0.00031 R GLGLDDALEPR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5786.5786.2.dta 134 1 IPI00375731.1 Hypothetical protein DKFZp686E2459 47 110613 1 1 1 1 4676 3874 1 1 1 719.8557 1437.6968 2 1437.6987 -0.0019 0 46.75 0.00018 R ESATADAGYAILEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5280.5280.2.dta 135 1 IPI00000015.2 "Splicing factor, arginine/serine-rich 4" 46 56759 1 1 1 1 2118 3298 1 1 1 515.7981 1029.5816 2 1029.5818 -0.0002 0 46.3 0.0001 R LIVENLSSR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4657.4657.2.dta 136 1 IPI00100160.3 Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 45 137999 2 2 2 2 4962 5146 1 1 1 743.8979 1485.7813 2 1485.7828 -0.0014 0 15.71 0.034 K EGPAVVGQFIQDVK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6596.6596.2.dta 136 1 IPI00100160.3 Isoform 1 of Cullin-associated NEDD8-dissociated protein 1 45 137999 2 2 2 2 5570 4986 1 1 1 811.4194 1620.8242 2 1620.8246 -0.0005 0 43.15 9.00E-05 K SVILEAFSSPSEEVK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6433.6433.2.dta 137 1 IPI00004534.3 Phosphoribosylformylglycinamidine synthase 45 146226 1 1 1 1 4977 4251 1 1 1 746.8839 1491.7533 2 1491.7569 -0.0036 0 44.69 0.00011 K ELSDPAGAIIYTSR F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5685.5685.2.dta 138 1 IPI00219330.2 Isoform 5 of Interleukin enhancer-binding factor 3 44 74959 1 1 1 1 2036 4215 1 1 1 510.7896 1019.5647 2 1019.5651 -0.0004 0 43.93 0.00054 K AYAALAALEK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5647.5647.2.dta 139 1 IPI00020194.1 Isoform Short of TATA-binding protein-associated factor 2N 44 61749 1 1 1 1 4537 2918 1 1 1 710.8333 1419.652 2 1419.6518 0.0002 0 43.52 8.30E-05 K GEATVSFDDPPSAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4245.4245.2.dta 140 1 IPI00027834.3 heterogeneous nuclear ribonucleoprotein L isoform a 42 64720 1 1 1 1 3262 4342 1 1 1 611.8002 1221.5859 2 1221.5877 -0.0018 0 42.33 0.00066 R SSSGLLEWESK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5780.5780.2.dta 141 1 IPI00465294.2 Cell division cycle 5-like protein 42 92422 1 1 1 1 1762 5233 1 1 1 489.8209 977.6272 2 977.6273 -0.0001 0 41.9 6.50E-05 R LGLLGLPAPK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6684.6684.2.dta 142 1 IPI00306369.3 NOL1/NOP2/Sun domain family 2 protein 41 87214 1 1 1 1 4700 3632 1 1 1 723.2868 1444.5591 2 1444.5677 -0.0087 0 41.43 0.00016 R NNSGEEFDCAFR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5019.5019.2.dta 143 1 IPI00303105.3 Small ubiquitin-related modifier 1 precursor 41 11607 1 1 1 1 1244 3974 1 1 1 448.735 895.4554 2 895.4552 0.0002 0 40.89 0.0017 R FLFEGQR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5389.5389.2.dta 144 1 IPI00745628.1 hypothetical protein 40 38367 2 2 1 1 3931 2810 1 1 1 657.8076 1313.6007 2 1313.5921 0.0086 0 32.59 0.0053 K GMEEIYNLSSR K Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4128.4128.2.dta 144 1 IPI00745628.1 hypothetical protein 40 38367 2 2 1 1 3932 2876 1 1 1 657.8082 1313.6019 2 1313.5921 0.0098 0 30.32 0.01 K GMEEIYNLSSR K Oxidation (M) 0.01000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4200.4200.2.dta 145 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 40 71184 2 2 2 2 1409 4787 1 1 1 464.2557 926.4969 2 926.4974 -0.0005 0 37.01 0.0034 K AGPIWDLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6231.6231.2.dta 145 1 IPI00012074.3 Heterogeneous nuclear ribonucleoprotein R 40 71184 2 2 2 2 4788 6047 1 1 1 730.8951 1459.7757 2 1459.777 -0.0012 0 22.85 0.0072 R NLATTVTEEILEK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7509.7509.2.dta 145 IPI00018140.3 Isoform 1 of Heterogeneous nuclear ribonucleoprotein Q 37 69788 1 1 1 1 1409 4787 1 0 1 464.2557 926.4969 2 926.4974 -0.0005 0 37.01 0.0034 K AGPIWDLR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6231.6231.2.dta 146 1 IPI00023334.1 Isoform 1 of Mitochondrial 39S ribosomal protein L4 40 34954 1 1 1 1 1366 2765 1 1 1 459.2499 916.4852 2 916.4767 0.0086 0 40.16 0.0018 K LLWQDSR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4080.4080.2.dta 147 1 IPI00218288.6 "SEC24 related gene family, member D" 40 114547 1 1 1 1 2311 1019 1 1 1 533.7669 1065.5193 2 1065.5203 -0.0011 0 39.97 0.00092 R GGQVYATNTR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2107.2107.2.dta 148 1 IPI00298961.3 Exportin-1 40 124447 1 1 1 1 1369 3760 1 1 1 459.2637 916.5129 2 916.513 -0.0001 0 39.52 0.0022 K LISGWVSR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5157.5157.2.dta 149 1 IPI00256684.1 Isoform B of AP-2 complex subunit alpha-1 39 106387 1 1 1 1 3960 4577 1 1 1 659.3569 1316.6993 2 1316.701 -0.0017 0 38.69 0.0016 R LVECLETVLNK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6020.6020.2.dta 150 1 IPI00219018.7 Glyceraldehyde-3-phosphate dehydrogenase 38 36201 2 2 2 2 1337 173 1 1 1 455.2483 908.4821 2 908.4828 -0.0007 0 31.42 0.0028 K AGAHLQGGAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1190.1190.2.dta 150 1 IPI00219018.7 Glyceraldehyde-3-phosphate dehydrogenase 38 36201 2 2 2 2 4510 4012 1 1 1 706.3978 1410.781 2 1410.7831 -0.0021 0 23.08 0.0068 R GALQNIIPASTGAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5430.5430.2.dta 150 IPI00794605.1 18 kDa protein 31 17596 1 1 1 1 1337 173 1 0 1 455.2483 908.4821 2 908.4828 -0.0007 0 31.42 0.0028 K AGAHLQGGAK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1190.1190.2.dta 150 IPI00793922.1 9 kDa protein 23 8772 1 1 1 1 4510 4012 1 0 1 706.3978 1410.781 2 1410.7831 -0.0021 0 23.08 0.0068 R GALQNIIPASTGAAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5430.5430.2.dta 151 1 IPI00216592.2 Isoform C1 of Heterogeneous nuclear ribonucleoproteins C1/C2 38 32375 1 1 1 1 4036 4976 1 1 1 665.3329 1328.6512 2 1328.6513 -0.0001 0 38.38 0.00025 K GFAFVQYVNER N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6423.6423.2.dta 152 1 IPI00005613.3 Splicing factor U2AF 35 kDa subunit 38 28368 1 1 1 1 4278 1115 1 1 1 687.3261 1372.6377 2 1372.6331 0.0046 0 38.21 0.00026 R NPQNSSQSADGLR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2214.2214.2.dta 153 1 IPI00290791.1 Isoform A of Caspase-10 precursor 38 59597 1 1 1 1 1400 430 1 0 1 462.768 923.5214 2 923.515 0.0064 1 37.77 0.0023 R MLKFLEK T Oxidation (M) 0.1000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1467.1467.2.dta 154 1 IPI00103994.4 "Leucyl-tRNA synthetase, cytoplasmic" 38 135577 2 2 2 2 3021 3852 1 1 1 595.3187 1188.6228 2 1188.6238 -0.001 0 21.55 0.019 K SLGLSDEEIVK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5256.5256.2.dta 154 1 IPI00103994.4 "Leucyl-tRNA synthetase, cytoplasmic" 38 135577 2 2 2 2 3470 3594 1 1 1 625.3243 1248.6341 2 1248.635 -0.0009 0 34.14 0.0016 R VFEVNASNLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4978.4978.2.dta 154 IPI00383290.1 HSPC192 34 18548 1 1 1 1 3470 3594 1 0 1 625.3243 1248.6341 2 1248.635 -0.0009 0 34.14 0.0016 R VFEVNASNLEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4978.4978.2.dta 155 1 IPI00293655.3 ATP-dependent RNA helicase DDX1 37 83349 1 1 1 1 4348 32 1 1 1 693.3419 1384.6692 2 1384.6695 -0.0003 0 37.13 0.00033 K SQHSGNAQVTQTK F C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1036.1036.2.dta 156 1 IPI00024661.4 Protein transport protein Sec24C 37 119779 1 1 1 1 5857 4226 1 1 1 833.9429 1665.8712 2 1665.8726 -0.0014 0 36.84 0.00035 K TLFQPQTGAYQTLAK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5659.5659.2.dta 157 1 IPI00387100.1 Ig kappa chain V-I region Roy 37 11889 1 1 1 1 1384 3605 1 1 1 461.7636 921.5127 2 921.5171 -0.0044 0 36.74 0.0026 K LLIYDASK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4990.4990.2.dta 158 1 IPI00297191.1 CRSP complex subunit 2 36 162043 1 1 1 1 3774 4561 1 1 1 645.8578 1289.7011 2 1289.702 -0.0008 0 36.49 0.00038 K LVEGFYPAPGLK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6004.6004.2.dta 159 1 IPI00027230.3 Endoplasmin precursor 35 92696 1 1 1 1 3012 4703 1 1 1 594.3419 1186.6692 2 1186.671 -0.0018 0 35.45 0.0033 K SILFVPTSAPR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6148.6148.2.dta 160 1 IPI00411733.4 Isoform 1 of Putative ATP-dependent RNA helicase DHX30 35 134938 1 1 1 1 1770 4672 1 1 1 491.308 980.6014 2 980.6018 -0.0004 0 35.33 0.00064 R IPQLLLER Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6115.6115.2.dta 161 1 IPI00444592.1 Isoform 1 of Trafficking kinesin-binding protein 1 34 106943 1 1 1 1 495 3326 1 1 1 379.7421 757.4696 2 757.4698 -0.0002 0 34.45 0.0078 R IGQSLLK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4687.4687.2.dta 162 1 IPI00022371.1 Histidine-rich glycoprotein precursor 34 60510 2 2 2 2 633 3329 1 1 1 393.7395 785.4645 2 785.4647 -0.0002 0 31.45 0.0089 K ALDLINK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4691.4691.2.dta 162 1 IPI00022371.1 Histidine-rich glycoprotein precursor 34 60510 2 2 2 2 2651 6469 1 1 1 562.808 1123.6015 2 1123.6026 -0.0011 0 21.17 0.01 R DGYLFQLLR I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7979.7979.2.dta 163 1 IPI00827931.1 HRV Fab 025-VH (Fragment) 34 13017 1 1 1 1 664 1086 1 1 1 397.7297 793.4449 2 793.4446 0.0003 1 33.5 0.004 K GRFTVSK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2180.2180.2.dta 164 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 33 178843 3 3 3 3 1453 1956 1 1 1 467.7581 933.5017 2 933.5032 -0.0015 0 27.08 0.0067 R GGPPGPPISR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3136.3136.2.dta 164 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 33 178843 3 3 3 3 2083 1273 1 1 1 514.2616 1026.5086 2 1026.5094 -0.0008 0 23 0.03 R HGVESTLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2393.2393.2.dta 164 1 IPI00220365.5 EIF4G1 variant protein (Fragment) 33 178843 3 3 3 3 6729 2938 1 1 1 640.6566 1918.948 3 1918.9497 -0.0017 1 17.71 0.022 R FSALQQAVPTESTDNRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4267.4267.3.dta 164 IPI00791833.1 24 kDa protein 29 24098 2 2 2 2 1453 1956 1 0 1 467.7581 933.5017 2 933.5032 -0.0015 0 27.08 0.0067 R GGPPGPPISR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3136.3136.2.dta 164 IPI00791833.1 24 kDa protein 29 24098 2 2 2 2 6729 2938 1 0 1 640.6566 1918.948 3 1918.9497 -0.0017 1 17.71 0.022 R FSALQQAVPTESTDNRR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4267.4267.3.dta 164 IPI00442069.1 Isoform 2 of Eukaryotic translation initiation factor 4 gamma 1 23 50243 1 1 1 1 2083 1273 1 0 1 514.2616 1026.5086 2 1026.5094 -0.0008 0 23 0.03 R HGVESTLER S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2393.2393.2.dta 165 1 IPI00023095.1 Myeloid leukemia factor 2 33 28186 1 1 1 1 1817 1788 1 1 1 495.2606 988.5066 2 988.505 0.0016 1 33.01 0.011 R LESSGAGGRR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2951.2951.2.dta 166 1 IPI00373968.5 IMP dehydrogenase/GMP reductase family protein 33 70998 1 1 1 1 2600 1813 1 1 1 558.7856 1115.5567 2 1115.5571 -0.0003 0 32.68 0.0058 R GSQLEDQALR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2982.2982.2.dta 167 1 IPI00000874.1 Peroxiredoxin-1 33 22324 1 1 1 1 3200 3787 1 1 1 606.3402 1210.6659 2 1210.667 -0.0011 0 32.62 0.0079 R QITVNDLPVGR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5186.5186.2.dta 168 1 IPI00011606.2 Islet cell autoantigen 1 32 55180 1 1 1 1 1168 6427 1 1 1 437.7443 873.4741 2 873.4807 -0.0066 1 32.33 0.022 K LVEKEEK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.792.792.2.dta 169 1 IPI00333858.3 117 kDa protein 32 118259 1 1 1 1 4770 3901 1 1 1 728.4059 1454.7972 2 1454.7981 -0.0009 0 32.07 0.008 K STPVTSAVQIPEVK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5309.5309.2.dta 170 1 IPI00006038.4 Isoform 1 of Nuclear pore complex protein Nup98-Nup96 precursor 31 188643 1 1 1 1 2291 4277 1 1 1 532.2927 1062.5709 2 1062.5709 0 0 31.33 0.0086 R EYIQILER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5712.5712.2.dta 171 1 IPI00741630.2 85 kDa protein 31 86068 1 1 1 1 393 68 1 1 1 364.1963 726.3781 2 726.3773 0.0008 0 31.25 0.003 K GLSSHAR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1075.1075.2.dta 172 1 IPI00072534.2 Isoform 1 of UNC45 homolog A 31 104266 1 1 1 1 5595 5356 1 1 1 813.4595 1624.9044 2 1624.9036 0.0008 0 30.82 0.0013 R ALIPLALEGTDVGQTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6807.6807.2.dta 173 1 IPI00006715.3 Double-strand-break repair protein rad21 homolog 31 71930 1 1 1 1 4725 5082 1 1 1 724.8743 1447.7341 2 1447.7341 0 0 30.81 0.0013 K TGAESISLLELCR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6532.6532.2.dta 174 1 IPI00025491.1 Eukaryotic initiation factor 4A-I 30 46353 1 1 1 1 2589 5045 1 1 1 557.8452 1113.6758 2 1113.6758 0 0 30.48 0.0016 R VLITTDLLAR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6495.6495.2.dta 175 1 IPI00163866.4 330 kDa protein 30 332411 1 1 1 1 3739 4479 1 1 1 644.3558 1286.6971 2 1286.6983 -0.0012 0 30.18 0.0015 R ISNPSAFSIVPR R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5920.5920.2.dta 176 1 IPI00010204.1 "Splicing factor, arginine/serine-rich 3" 30 19546 1 1 1 1 2181 4275 1 1 1 522.269 1042.5234 2 1042.5236 -0.0002 0 30.12 0.0037 R AFGYYGPLR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5710.5710.2.dta 177 1 IPI00171611.7 Histone H3.2 30 15436 1 1 1 1 2124 2030 1 1 1 344.8698 1031.5877 3 1031.5876 0.0001 0 29.99 0.013 R YRPGTVALR E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3217.3217.3.dta 178 1 IPI00745833.2 similar to Doublecortin domain-containing protein 2 30 59738 1 1 1 1 1515 1062 1 1 1 471.7535 941.4925 2 941.493 -0.0005 0 29.93 0.016 R VPSEVQQR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2154.2154.2.dta 179 1 IPI00335101.1 Ribosomal protein S6 kinase alpha-5 30 90379 2 2 2 2 431 3495 1 1 0 367.7319 733.4493 2 733.4486 0.0007 0 25.08 0.02 K LGIIYR D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4871.4871.2.dta 179 1 IPI00335101.1 Ribosomal protein S6 kinase alpha-5 30 90379 2 2 2 2 641 5790 1 1 1 394.2553 786.496 2 786.4963 -0.0003 1 25.62 0.021 K KATIVQK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.725.725.2.dta 180 1 IPI00249982.4 Isoform 1 of Death-inducer obliterator 1 29 130526 1 1 1 1 3198 1055 1 1 1 606.3218 1210.629 2 1210.6306 -0.0016 0 29.39 0.009 R QAGPAPAAATAASK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2146.2146.2.dta 181 1 IPI00743683.2 Rheumatoid factor RF-ET11 (Fragment) 29 10316 1 1 1 1 3730 2654 1 1 1 643.3403 1284.6661 2 1284.6674 -0.0013 0 29.08 0.0019 - ESGGGLVQPGGSLK L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3959.3959.2.dta 182 1 IPI00031023.1 Protein flightless-1 homolog 29 146142 1 1 1 1 4265 3242 1 1 1 685.8657 1369.7168 2 1369.7201 -0.0033 0 28.97 0.0019 R NAEAVLQSPGLSGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4596.4596.2.dta 183 1 IPI00386765.2 "Isoform 7 of cAMP-specific 3~,5~-cyclic phosphodiesterase 4D" 29 23995 1 1 1 1 1104 4378 1 1 1 434.7664 867.5182 2 867.5178 0.0004 0 28.77 0.0037 K LSPVISPR N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5818.5818.2.dta 184 1 IPI00216049.1 Isoform 1 of Heterogeneous nuclear ribonucleoprotein K 28 51230 1 1 1 1 6327 2623 1 1 1 890.9026 1779.7907 2 1779.7911 -0.0004 0 28.13 0.0023 R TDYNASVSVPDSSGPER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3922.3922.2.dta 185 1 IPI00180687.3 Isoform 3 of Mucin and cadherin-like protein precursor 28 53857 1 1 1 1 483 7113 1 1 1 379.2323 756.4501 2 756.4494 0.0007 0 28.11 0.027 R GAGAGVVVK D C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.921.921.2.dta 186 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 28 117803 2 2 2 2 3044 1141 1 1 1 596.8002 1191.5858 2 1191.5884 -0.0026 0 27.4 0.012 R LQNSYQPTNK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2250.2250.2.dta 186 1 IPI00329791.8 Probable ATP-dependent RNA helicase DDX46 28 117803 2 2 2 2 6641 3816 1 1 1 635.6413 1903.9021 3 1903.9064 -0.0044 1 18.7 0.031 R AGNKGYAYTFITEDQAR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5217.5217.3.dta 187 1 IPI00216811.1 "TBC1 domain family, member 10C" 27 50194 1 1 1 1 1627 2251 1 1 1 479.7689 957.5232 2 957.5243 -0.0011 0 27.42 0.026 R LALGTAEQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3483.3483.2.dta 188 1 IPI00103373.1 Cytoglobin 27 21505 1 1 1 1 3944 3282 1 1 1 658.8325 1315.6505 2 1315.6442 0.0063 1 27.34 0.031 M EKVPGEMEIER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4640.4640.2.dta 189 1 IPI00007277.2 Isoform 1 of Leucine-rich repeat flightless-interacting protein 2 26 82349 1 1 1 1 496 1008 1 1 1 379.7421 757.4697 2 757.4698 -0.0001 1 26.46 0.049 K KIGALEK Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2095.2095.2.dta 190 1 IPI00793696.1 19 kDa protein 26 19569 1 1 1 1 309 2289 1 1 1 351.2315 700.4485 2 700.4483 0.0002 0 26.44 0.046 K LLLGASK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3532.3532.2.dta 191 1 IPI00012066.2 poly(rC)-binding protein 2 isoform b 26 38597 1 1 1 1 4588 3686 1 1 1 714.8964 1427.7783 2 1427.7806 -0.0023 0 26.38 0.0044 R LVVPASQCGSLIGK G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5077.5077.2.dta 192 1 IPI00296374.3 Isoform 1 of Zinc finger protein-like 1 26 34833 1 1 1 1 1425 3465 1 1 1 465.7612 929.5078 2 929.5083 -0.0004 0 26.1 0.0036 K LATVNWAR A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4838.4838.2.dta 193 1 IPI00002543.1 Procollagen C-endopeptidase enhancer 2 precursor 26 46542 1 1 1 1 3967 4167 1 1 1 659.8387 1317.6628 2 1317.6751 -0.0123 1 26.06 0.004 K CTWKITVPEGK V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5598.5598.2.dta 194 1 IPI00010368.4 Kinesin-like protein KIF2A 26 78385 1 1 1 1 3357 5523 1 1 1 617.8247 1233.6349 2 1233.6353 -0.0005 0 25.85 0.012 K FSLIDLAGNER G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6978.6978.2.dta 195 1 IPI00013891.1 Isoform Long of Transformer-2 protein homolog 26 32726 1 1 1 1 1431 1038 1 1 1 466.2092 930.4038 2 930.3978 0.006 0 25.75 0.0098 R SHSPMSNR R Oxidation (M) 0.00001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2128.2128.2.dta 196 1 IPI00783829.3 Importin beta-3 26 125032 1 1 1 1 5614 5343 1 1 1 815.917 1629.8194 2 1629.8218 -0.0024 0 25.52 0.004 R VAAAESMPLLLECAR V C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6794.6794.2.dta 197 1 IPI00783527.1 Conserved hypothetical protein 26 4859 1 1 1 1 1020 2314 1 1 1 426.2073 850.4001 2 850.4032 -0.0032 0 25.51 0.04 R SSSLSSQVG - C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3567.3567.2.dta 198 1 IPI00299608.3 Isoform 1 of 26S proteasome non-ATPase regulatory subunit 1 26 106795 1 1 1 1 1220 1468 1 1 1 444.73 887.4455 2 887.4461 -0.0005 0 25.5 0.041 K NASNDIVR H C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2606.2606.2.dta 199 1 IPI00020258.3 Mitogen-activated protein kinase kinase kinase kinase 1 25 92265 1 1 1 1 6253 4380 1 1 1 876.4185 1750.8224 2 1750.8117 0.0106 1 25.07 0.0049 K MVKMEPDDDVSTLQK E Oxidation (M) 0.100000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5820.5820.2.dta 200 1 IPI00071824.3 Isoform 1 of Cytoskeleton-associated protein 2 25 77509 1 1 1 1 410 2751 1 1 1 365.2288 728.443 2 728.4432 -0.0003 0 24.78 0.044 K LSATIPK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4064.4064.2.dta 201 1 IPI00163227.2 Membrane-spanning 4-domains subfamily A member 10 24 30040 1 1 1 1 1524 4324 1 1 1 472.2639 942.5132 2 942.5134 -0.0002 0 24.43 0.029 K AEATVIPSR C C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5761.5761.2.dta 202 1 IPI00298067.4 PDZ domain-containing protein 1 24 57379 1 1 1 1 1930 4057 1 1 1 502.2838 1002.5531 2 1002.5532 -0.0001 0 24.42 0.02 K NVTLLVCGK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5478.5478.2.dta 203 1 IPI00000875.6 Elongation factor 1-gamma 24 50429 1 1 1 1 3402 4231 1 1 1 621.3292 1240.6438 2 1240.6452 -0.0014 1 23.73 0.0059 K STFVLDEFKR K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5665.5665.2.dta 204 1 IPI00395813.1 Isoform 1 of Zinc finger protein 687 24 131898 1 1 1 1 4220 1800 1 1 1 681.3539 1360.6933 2 1360.6947 -0.0014 0 23.67 0.022 K TATGPSTGGGTVISR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2965.2965.2.dta 205 1 IPI00414440.2 "CDNA FLJ29008 fis, clone TST06032" 23 38841 1 1 1 1 1282 280 1 1 1 451.7746 901.5346 2 901.5419 -0.0073 1 23.18 0.021 K QKVMVAVK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1305.1305.2.dta 206 1 IPI00027915.5 similar to deltex 4 homolog 23 82755 1 1 1 1 7431 5949 1 1 1 844.395 3373.551 4 3373.5274 0.0236 0 23.01 0.017 K AQSWPVSPGPATSPPMSPCSCPQCVLVMSVK A 2 Oxidation (M) 0.0000000000000001000000000001000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7408.7408.4.dta 207 1 IPI00639925.1 129 kDa protein 23 130628 1 1 1 1 2008 657 1 1 1 508.7777 1015.5409 2 1015.5345 0.0063 1 22.63 0.019 R KPGTCAARR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1714.1714.2.dta 208 1 IPI00427501.1 Isoform 1 of GH3 domain-containing protein precursor 23 58058 1 1 1 1 803 1780 1 1 1 411.7466 821.4787 2 821.4759 0.0028 0 22.61 0.028 R NHLPLTK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2943.2943.2.dta 209 1 IPI00412147.1 Long-chain fatty acid transport protein 4 23 72930 1 1 1 1 793 5541 1 1 1 410.75 819.4854 2 819.4854 0 1 22.56 0.022 K IAKDVFK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6997.6997.2.dta 210 1 IPI00009841.4 "CDNA FLJ31747 fis, clone NT2RI2007377, highly similar to RNA-BINDING PROTEIN EWS" 22 69208 1 1 1 1 4741 2152 1 1 1 725.8389 1449.6633 2 1449.6624 0.001 0 22.47 0.0078 K GDATVSYEDPPTAK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3369.3369.2.dta 211 1 IPI00022184.1 Isoform 3 of Pumilio homolog 2 22 114503 1 1 1 1 2379 1644 1 1 1 539.282 1076.5495 2 1076.5502 -0.0007 0 22.25 0.046 R YISAAPGAEAK Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2796.2796.2.dta 212 1 IPI00472675.2 228 kDa protein 22 230398 1 1 1 1 5018 1668 1 1 1 751.8826 1501.7507 2 1501.7485 0.0022 0 21.76 0.012 K ASTEGVAIQGQQGTR L C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2822.2822.2.dta 213 1 IPI00216654.1 Isoform Beta of Nucleolar phosphoprotein p130 22 74819 1 1 1 1 2781 136 1 1 1 573.8089 1145.6032 2 1145.604 -0.0008 0 21.74 0.0091 K NSSNKPAVTTK S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1150.1150.2.dta 214 1 IPI00339379.3 Isoform 2 of Rho guanine nucleotide exchange factor 1 21 99277 1 1 1 1 1601 4091 1 1 1 477.2939 952.5732 2 952.5818 -0.0086 1 20.94 0.017 R LLLKSHSR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5515.5515.2.dta 215 1 IPI00010810.1 "Electron transfer flavoprotein subunit alpha, mitochondrial precursor" 21 35400 1 1 1 1 210 495 1 0 1 337.2033 672.3921 2 672.3919 0.0002 0 20.9 0.044 K VVVSGGR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1538.1538.2.dta 216 1 IPI00069232.4 G-protein coupled receptor-associated sorting protein 2 21 94285 1 1 1 1 1334 2696 1 1 1 455.2248 908.4351 2 908.4386 -0.0035 1 20.8 0.011 K SKGLSMDR E Oxidation (M) 0.00000100.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4005.4005.2.dta 217 1 IPI00643920.2 Transketolase 20 68519 1 1 1 1 1761 1381 1 1 1 489.7903 977.5661 2 977.5658 0.0003 0 20.16 0.013 K HQPTAIIAK T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2510.2510.2.dta 218 1 IPI00247871.1 Transcription elongation regulator 1 20 124110 1 1 1 1 4397 4399 1 1 1 696.8445 1391.6745 2 1391.6755 -0.001 0 20.07 0.023 R YLVLDCVPEER R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5839.5839.2.dta 219 1 IPI00018009.2 Enhancer of mRNA decapping protein 3 20 56784 1 1 1 1 4509 1001 1 1 1 471.2559 1410.7457 3 1410.7467 -0.0009 0 19.9 0.023 K KPASSSSAPQNIPK R C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.2087.2087.3.dta 220 1 IPI00165598.10 Transcription factor COE2 20 63181 1 1 1 1 2297 438 1 1 1 532.755 1063.4955 2 1063.4968 -0.0013 0 19.87 0.017 K SLGAEMDSVR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1476.1476.2.dta 221 1 IPI00020128.1 U3 small nucleolar RNA-associated protein 6 homolog 20 70804 1 1 1 1 2411 1906 1 1 1 541.2493 1080.4841 2 1080.491 -0.0069 0 19.65 0.014 R DSGTMWQLK L Oxidation (M) 0.000010000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3082.3082.2.dta 222 1 IPI00002483.4 Zinc transporter 1 20 56318 1 1 1 1 3678 4731 1 1 1 639.2991 1276.5836 2 1276.5904 -0.0068 0 19.5 0.046 K SSVVPCELACR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6176.6176.2.dta 223 1 IPI00013894.1 Stress-induced-phosphoprotein 1 19 63227 1 1 1 1 4970 4753 1 1 1 744.9008 1487.787 2 1487.7871 -0.0001 0 19.38 0.025 R LAYINPDLALEEK N C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6198.6198.2.dta 224 1 IPI00001159.9 GCN1-like protein 1 19 295139 1 1 1 1 3079 4558 1 1 1 598.3373 1194.66 2 1194.6608 -0.0008 0 19.36 0.015 K ASLLDPVPEVR T C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6001.6001.2.dta 225 1 IPI00022228.1 Vigilin 19 141979 1 1 1 1 1914 890 1 1 1 501.29 1000.5655 2 1000.5665 -0.0011 1 18.72 0.018 R TIIGQKGER I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1967.1967.2.dta 226 1 IPI00736860.2 Hypothetical protein LOC649897 19 22287 1 1 1 1 6739 5074 1 1 1 640.9793 1919.9161 3 1919.8975 0.0186 0 18.59 0.018 K TTPPMLDSNGSFFLYSK L Oxidation (M) 0.00001000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6525.6525.3.dta 227 1 IPI00009790.1 6-phosphofructokinase type C 17 86454 1 1 1 1 3519 4860 1 1 1 629.3629 1256.7113 2 1256.7129 -0.0016 0 16.92 0.026 R NVIFQPVAELK K C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6305.6305.2.dta 228 1 IPI00006444.1 Isoform 1 of Sodium/potassium/calcium exchanger 2 precursor 17 74130 1 1 1 1 2315 20 1 1 1 534.268 1066.5215 2 1066.5155 0.0059 0 16.82 0.043 R QNGAANHVEK I C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1022.1022.2.dta 229 1 IPI00645934.2 Similar to cyclin M3 isoform 2 17 17719 1 1 1 1 1864 6290 1 1 1 498.2844 994.5543 2 994.5447 0.0096 0 16.51 0.028 K AIDLNPQPK W C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7767.7767.2.dta 230 1 IPI00005634.3 Tetratricopeptide repeat protein KIAA0372 16 177485 1 1 1 1 4628 5866 1 1 1 718.4164 1434.8182 2 1434.8194 -0.0012 0 16.5 0.028 K SNPDQPAVILLLR Q C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7325.7325.2.dta 231 1 IPI00000606.4 Tetratricopeptide repeat protein 4 16 45178 1 1 1 1 1239 2589 1 1 1 448.2654 894.5163 2 894.5109 0.0053 0 16.08 0.037 K LKPCHLK A C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.3885.3885.2.dta 232 1 IPI00154528.3 Isoform 1 of Structural maintenance of chromosomes protein 6 16 127216 1 1 1 1 4094 3433 1 1 1 671.3242 1340.6338 2 1340.636 -0.0023 0 15.98 0.032 R AYNEAEVLYNR S C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4803.4803.2.dta 233 1 IPI00033019.2 Potassium voltage-gated channel subfamily B member 1 16 96672 1 1 1 1 5915 2893 1 1 1 836.8884 1671.7623 2 1671.7709 -0.0086 1 15.82 0.033 R NGSIVSMNMKDAFAR S 2 Oxidation (M) 0.000000101000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.4218.4218.2.dta 234 1 IPI00376229.1 Isoform 1 of Phosphofurin acidic cluster sorting protein 1 16 105233 1 1 1 1 3508 97 1 1 1 628.7899 1255.5653 2 1255.5654 -0.0001 0 15.72 0.034 R GGAGGGPGGAGGGSGQR G C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.1106.1106.2.dta 235 1 IPI00030915.1 Ubiquitin carboxyl-terminal hydrolase 8 16 128413 1 1 1 1 2891 5300 1 1 1 583.8135 1165.6124 2 1165.6132 -0.0008 0 15.57 0.038 K FLDPITGTFR Y C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.6751.6751.2.dta 236 1 IPI00301527.4 Isoform 1 of ETS domain-containing protein Elk-1 15 45031 1 1 1 1 3592 4457 1 1 1 632.3688 1262.7231 2 1262.7234 -0.0003 1 15.45 0.039 R ALPPEVKVEGPK E C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.5899.5899.2.dta 237 1 IPI00174962.2 MICAL-like protein 1 15 94352 1 1 1 1 4878 5647 1 1 1 492.2474 1473.7203 3 1473.7333 -0.013 1 15.29 0.037 - MAGPRGALLAWCR R Oxidation (M) 0.1000000000000.0 C:\ProgramData\Matrix Science\Mascot Daemon\MGF\1604 AE-MF-2\orb_160921_AE-MF-2_#4-2.7102.7102.3.dta